RPSBLAST alignment for GI: 254780744 and conserved domain: PRK11831

>gnl|CDD|183331 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional. Length = 269
 Score =  116 bits (291), Expect = 7e-27
 Identities = 74/221 (33%), Positives = 111/221 (50%), Gaps = 20/221 (9%)

Query: 44  VDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYR--RARLG 101
           + L V  G+I  ++GP+G GKTT   ++ G I  D G I  DG +I  M   R    R  
Sbjct: 26  ISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKR 85

Query: 102 ISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL-DSLLKEFNITKWRHV------ 154
           +S L Q  ++F  + V +N+   L        + H +L   LL    + K   V      
Sbjct: 86  MSMLFQSGALFTDMNVFDNVAYPL--------REHTQLPAPLLHSTVMMKLEAVGLRGAA 137

Query: 155 -LAPL-LSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASR-GIGI 211
            L P  LSGG  RR  +AR++   P  I+ DEPF G DP+ +  +  LI +L S  G+  
Sbjct: 138 KLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTC 197

Query: 212 LITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           ++  H+V E+L++ D AYI+    ++AHG+ Q +  N D R
Sbjct: 198 VVVSHDVPEVLSIADHAYIVADKKIVAHGSAQALQANPDPR 238