RPSBLAST alignment for GI: 254780744 and conserved domain: PRK13540

>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional. Length = 200
 Score = 70.7 bits (173), Expect = 4e-13
 Identities = 49/193 (25%), Positives = 92/193 (47%), Gaps = 9/193 (4%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L   Y+   +++ +  ++  G ++ L G NGAGKTT   ++ GL+  + G I  
Sbjct: 1   MLDVIELDFDYHDQPLLQQISFHLPAGGLLHLKGSNGAGKTTLLKLIAGLLNPEKGEILF 60

Query: 85  DGNDITK-MPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +   I K +  Y++    + ++   + I   LT+ EN L     Y+         +  L 
Sbjct: 61  ERQSIKKDLCTYQKQ---LCFVGHRSGINPYLTLRENCL-----YDIHFSPGAVGITELC 112

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           + F++         LLS GQ+R++ + R  +S     LLDEP   +D +++  I   I++
Sbjct: 113 RLFSLEHLIDYPCGLLSSGQKRQVALLRLWMSKAKLWLLDEPLVALDELSLLTIITKIQE 172

Query: 204 LASRGIGILITDH 216
             ++G  +L+T H
Sbjct: 173 HRAKGGAVLLTSH 185