RPSBLAST alignment for GI: 254780744 and conserved domain: PRK13548

>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional. Length = 258
 Score =  110 bits (277), Expect = 4e-25
 Identities = 72/245 (29%), Positives = 127/245 (51%), Gaps = 22/245 (8%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A +L+ +     ++  V L ++PGE+V +LGPNGAGK+T    ++G +  DSG +++
Sbjct: 2   MLEARNLSVRLGGRTLLDDVSLTLRPGEVVAILGPNGAGKSTLLRALSGELSPDSGEVRL 61

Query: 85  DGNDITKMPMYRRA-RLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +G  +        A R  +  LPQ +S+    TVEE +      +   + +    + + L
Sbjct: 62  NGRPLADWSPAELARRRAV--LPQHSSLSFPFTVEEVVAMGRAPHGLSRAEDDALVAAAL 119

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLV------SFPSYILLDEPFAGVDPVAISDI 197
            + ++        P LSGG+++R+++AR L         P ++LLDEP + +D       
Sbjct: 120 AQVDLAHLAGRDYPQLSGGEQQRVQLARVLAQLWEPDGPPRWLLLDEPTSALDLA--HQH 177

Query: 198 HVL--IRDLA-SRGIGILITDHNVHEILTLI----DRAYIIHAGGVLAHGTVQEIIDNQD 250
           HVL   R LA  RG+ +++  H+    L L     DR  ++H G ++A GT  E++  + 
Sbjct: 178 HVLRLARQLAHERGLAVIVVLHD----LNLAARYADRIVLLHQGRLVADGTPAEVLTPET 233

Query: 251 VRRLY 255
           +RR+Y
Sbjct: 234 LRRVY 238