RPSBLAST alignment for GI: 254780744 and conserved domain: PRK13650

>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 279
 Score = 77.5 bits (191), Expect = 4e-15
 Identities = 62/220 (28%), Positives = 118/220 (53%), Gaps = 7/220 (3%)

Query: 31  LTKKYNS---VYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGN 87
           LT KY      Y +  V  +VK GE + ++G NG+GK+T   ++ GL+ A+SG I IDG+
Sbjct: 10  LTFKYKEDQEKYTLNDVSFHVKQGEWLSIIGHNGSGKSTTVRLIDGLLEAESGQIIIDGD 69

Query: 88  DITKMPMY-RRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEF 146
            +T+  ++  R ++G+ +   +   F G TVE+++   LE      ++  E+++  L+  
Sbjct: 70  LLTEENVWDIRHKIGMVFQNPDNQ-FVGATVEDDVAFGLENKGIPHEEMKERVNEALELV 128

Query: 147 NITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLAS 206
            +  ++      LSGGQ++R+ IA ++   P  I+LDE  + +DP    ++   I+ +  
Sbjct: 129 GMQDFKEREPARLSGGQKQRVAIAGAVAMRPKIIILDEATSMLDPEGRLELIKTIKGIRD 188

Query: 207 R-GIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEI 245
              + ++   H++ E+  L DR  ++  G V +  T +E+
Sbjct: 189 DYQMTVISITHDLDEV-ALSDRVLVMKNGQVESTSTPREL 227