RPSBLAST alignment for GI: 254780744 and conserved domain: PRK14270

>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional. Length = 251
 Score = 69.2 bits (169), Expect = 1e-12
 Identities = 61/243 (25%), Positives = 116/243 (47%), Gaps = 23/243 (9%)

Query: 35  YNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL-----ICADSGSIKIDGNDI 89
           Y     +  ++L +   +I  L+GP+G GK+TF   +  +          G + +DG +I
Sbjct: 14  YGEKQALNDINLPIYENKITALIGPSGCGKSTFLRCLNRMNDLISNVKIEGEVLLDGKNI 73

Query: 90  --TKMPMYR-RARLGISYLPQEASIFRGLTVEENILAVLEVYE-KDKKKRHEKLDSLLKE 145
               + +   R R+G+ +  Q+ + F  +++ +N+     ++  KDKK+  + ++  LK+
Sbjct: 74  YDKDVDVVELRKRVGMVF--QKPNPF-PMSIYDNVAYGPRIHGIKDKKELDKIVEWALKK 130

Query: 146 FNITKWRHVLAPL------LSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
             +  W  V   L      LSGGQ++RL IAR++   P  IL+DEP + +DP++   I  
Sbjct: 131 AAL--WDEVKDDLKKSALKLSGGQQQRLCIARTIAVKPDVILMDEPTSALDPISTLKIED 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL--YLG 257
           L+ +L  +   I+I  HN+ +   + D       G ++     ++I      +    Y+ 
Sbjct: 189 LMVELK-KEYTIVIVTHNMQQASRVSDYTAFFLMGDLIEFNKTEKIFLEPQKKETEDYIS 247

Query: 258 DRF 260
            RF
Sbjct: 248 GRF 250