RPSBLAST alignment for GI: 254780744 and conserved domain: COG1116

>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248
 Score =  149 bits (378), Expect = 8e-37
 Identities = 65/213 (30%), Positives = 109/213 (51%), Gaps = 7/213 (3%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
            +LL    ++K +  V V++ ++L V+ GE V +LGP+G GK+T   ++ GL    SG +
Sbjct: 1   MALLEIEGVSKSFGGVEVLEDINLSVEKGEFVAILGPSGCGKSTLLRLIAGLEKPTSGEV 60

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            +DG  +T           I Y+ QE ++   LTV +N+   LE+  K K +  E+   L
Sbjct: 61  LLDGRPVT------GPGPDIGYVFQEDALLPWLTVLDNVALGLELRGKSKAEARERAKEL 114

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+   +  +       LSGG R+R+ IAR+L + P  +LLDEPF  +D +   ++   + 
Sbjct: 115 LELVGLAGFEDKYPHQLSGGMRQRVAIARALATRPKLLLLDEPFGALDALTREELQDELL 174

Query: 203 DLASR-GIGILITDHNVHEILTLIDRAYIIHAG 234
            L       +L+  H+V E + L DR  ++   
Sbjct: 175 RLWEETRKTVLLVTHDVDEAVYLADRVVVLSNR 207