RPSBLAST alignment for GI: 254780744 and conserved domain: COG3845

>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]. Length = 501
 Score =  109 bits (274), Expect = 8e-25
 Identities = 71/252 (28%), Positives = 121/252 (48%), Gaps = 19/252 (7%)

Query: 10  IEMPEFQENRASKDSLLSACSLT-KKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           + +   +      + +L    L+ K    V  VK V   V+ GEIVG+ G  G G++   
Sbjct: 242 VVLRVVKPPSTPGEVVLEVEDLSVKDRRGVTAVKDVSFEVRAGEIVGIAGVAGNGQSELV 301

Query: 69  YMMTGLICADSGSIKIDGNDI-TKMPMYRRARLGISYLPQEASIFRGL----TVEENILA 123
             ++GL    SG I ++G D+  ++    R RLG++Y+P++     GL    ++ EN+  
Sbjct: 302 EAISGLRKPASGRILLNGKDVLGRLSPRERRRLGLAYVPED-RHGHGLVLDLSLAENL-- 358

Query: 124 VLEVYEKDKKKRHEKLD---------SLLKEFNI-TKWRHVLAPLLSGGQRRRLEIARSL 173
           VL  ++K    R   LD          L++EF++        A  LSGG +++L +AR L
Sbjct: 359 VLGRHDKKPFSRGGFLDRRAIRKFARELIEEFDVRAPSPDAPARSLSGGNQQKLILAREL 418

Query: 174 VSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHA 233
              P  ++  +P  G+D  AI  IH  + +L   G  +L+   ++ EIL L DR  +I+ 
Sbjct: 419 ARRPDLLIAAQPTRGLDVGAIEFIHERLLELRDAGKAVLLISEDLDEILELSDRIAVIYE 478

Query: 234 GGVLAHGTVQEI 245
           G ++     +E 
Sbjct: 479 GRIVGIVPPEEA 490