RPSBLAST alignment for GI: 254780744 and conserved domain: COG4138

>gnl|CDD|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]. Length = 248
 Score = 87.8 bits (217), Expect = 3e-18
 Identities = 60/215 (27%), Positives = 105/215 (48%), Gaps = 14/215 (6%)

Query: 48  VKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQ 107
           V+ GEI+ L+GPNGAGK+T    M G+    SGSI+  G  +        AR   +YL Q
Sbjct: 22  VRAGEILHLVGPNGAGKSTLLARMAGMTSG-SGSIQFAGQPLEAWSATELARHR-AYLSQ 79

Query: 108 EASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRL 167
           + +    + V       L +++ DK  R E L+ +     +          LSGG+ +R+
Sbjct: 80  QQTPPFAMPV----WHYLTLHQPDKT-RTELLNDVAGALALDDKLGRSTNQLSGGEWQRV 134

Query: 168 EIARSLVSF-----PS--YILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHE 220
            +A  ++       P+   +LLDEP   +D    S +  L+  L  +G+ I+++ H+++ 
Sbjct: 135 RLAAVVLQITPDANPAGQLLLLDEPMNSLDVAQQSALDRLLSALCQQGLAIVMSSHDLNH 194

Query: 221 ILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
            L    RA+++  G +LA G  +E++    + + Y
Sbjct: 195 TLRHAHRAWLLKRGKLLASGRREEVLTPPVLAQAY 229