RPSBLAST alignment for GI: 254780744 and conserved domain: COG4181

>gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 228
 Score = 87.3 bits (216), Expect = 4e-18
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 4/185 (2%)

Query: 37  SVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYR 96
            + ++KGV+L VK GE V ++GP+G+GK+T   ++ GL    SG +++ G  + K+    
Sbjct: 22  ELSILKGVELVVKRGETVAIVGPSGSGKSTLLAVLAGLDDPSSGEVRLLGQPLHKLDEDA 81

Query: 97  RARL---GISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRH 153
           RA L    + ++ Q   +   LT  EN+   LE+  +          +LL+   + K   
Sbjct: 82  RAALRARHVGFVFQSFHLIPNLTALENVALPLELRGESSADSRAGAKALLEAVGLGKRLT 141

Query: 154 VLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL-ASRGIGIL 212
                LSGG+++R+ +AR+    P  +  DEP   +D      I  L+  L   RG  ++
Sbjct: 142 HYPAQLSGGEQQRVALARAFAGRPDVLFADEPTGNLDRATGDKIADLLFALNRERGTTLV 201

Query: 213 ITDHN 217
           +  H+
Sbjct: 202 LVTHD 206