RPSBLAST alignment for GI: 254780744 and conserved domain: COG4555

>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]. Length = 245
 Score =  150 bits (380), Expect = 3e-37
 Identities = 72/222 (32%), Positives = 117/222 (52%), Gaps = 3/222 (1%)

Query: 25  LLSACSLTKKYNS-VYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +L    LTK Y S V  V+ V    + GEI GLLG NGAGKTT   M+  L+  DSG + 
Sbjct: 1   MLEVTDLTKSYGSKVQAVRDVSFEAEEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVT 60

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           IDG D  + P + R ++G+  L  E  ++  LT  EN+     +    +K+   ++  L 
Sbjct: 61  IDGVDTVRDPSFVRRKIGV--LFGERGLYARLTARENLKYFARLNGLSRKEIKARIAELS 118

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           K   + ++        S G ++++ IAR+LV  PS ++LDEP +G+D       H  I+ 
Sbjct: 119 KRLQLLEYLDRRVGEFSTGMKQKVAIARALVHDPSILVLDEPTSGLDIRTRRKFHDFIKQ 178

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEI 245
           L + G  ++ + H + E+  L DR  ++H G V+  G+++ +
Sbjct: 179 LKNEGRAVIFSSHIMQEVEALCDRVIVLHKGEVVLEGSIEAL 220