RPSBLAST alignment for GI: 254780744 and conserved domain: COG4618

>gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]. Length = 580
 Score =  104 bits (262), Expect = 2e-23
 Identities = 64/220 (29%), Positives = 116/220 (52%), Gaps = 22/220 (10%)

Query: 39  YVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRA 98
            ++KG+   ++ GE +G++GP+G+GK+T   ++ G+    SGS+++DG D+ +   + R 
Sbjct: 350 PILKGISFALQAGEALGIIGPSGSGKSTLARLLVGIWPPTSGSVRLDGADLRQ---WDRE 406

Query: 99  RLG--ISYLPQEASIFRGLTVEENILAVLE------VYEKDKKKR-HEKLDSLLKEFNIT 149
           +LG  I YLPQ+  +F G T+ ENI    E      V E  +    HE +  L + ++  
Sbjct: 407 QLGRHIGYLPQDVELFDG-TIAENIARFGEEADPEKVIEAARLAGVHELILRLPQGYDT- 464

Query: 150 KWRHVLAP---LLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLAS 206
                +      LSGGQR+R+ +AR+L   P  ++LDEP + +D    + +   I    +
Sbjct: 465 ----RIGEGGATLSGGQRQRIALARALYGDPFLVVLDEPNSNLDSEGEAALAAAILAAKA 520

Query: 207 RGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEII 246
           RG  +++  H     L  +D+  ++  G + A G  +E++
Sbjct: 521 RGGTVVVIAHRP-SALASVDKILVLQDGRIAAFGPREEVL 559