RPSBLAST alignment for GI: 254780744 and conserved domain: KOG0055

>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228
 Score =  118 bits (296), Expect = 2e-27
 Identities = 65/223 (29%), Positives = 112/223 (50%), Gaps = 15/223 (6%)

Query: 37  SVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPM-Y 95
            V ++KGV L +  G+ V L+GP+G+GK+T   ++       SG + IDG DI  + + +
Sbjct: 365 DVKILKGVSLKIPSGQTVALVGPSGSGKSTLIQLLARFYDPTSGEVLIDGEDIRNLNLKW 424

Query: 96  RRARLGISYLPQEASIFRGLTVEENIL-----AVLEVYEKDKKKR--HEKLDSLLKEFNI 148
            R+++G+  + QE  +F   T+ ENI      A  E  E+  K    H+ +  L   ++ 
Sbjct: 425 LRSQIGL--VSQEPVLF-ATTIRENIRYGKPDATREEIEEAAKAANAHDFILKLPDGYDT 481

Query: 149 TKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRG 208
                     LSGGQ++R+ IAR+LV  P  +LLDE  + +D  +   +   + D AS+G
Sbjct: 482 LVGER--GVQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESERVVQEAL-DKASKG 538

Query: 209 IGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
              ++  H +  I    D+  ++  G ++  GT  E+I    +
Sbjct: 539 RTTIVVAHRLSTIRN-ADKIAVMEEGKIVEQGTHDELIALGGI 580