RPSBLAST alignment for GI: 254780744 and conserved domain: KOG0063

>gnl|CDD|35286 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC superfamily [RNA processing and modification]. Length = 592
 Score = 37.2 bits (86), Expect = 0.004
 Identities = 38/186 (20%), Positives = 74/186 (39%), Gaps = 26/186 (13%)

Query: 49  KPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYR------------ 96
           +PG+++GL+G NG GK+T   ++ G    + G      +    +  +R            
Sbjct: 98  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDNPPDWQEILTYFRGSELQNYFTKIL 157

Query: 97  ----RARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWR 152
               +A +   Y+ Q     +G TV   +         D+K   +  + +  + ++    
Sbjct: 158 EDNLKAIIKPQYVDQIPRAVKG-TVGSLL---------DRKDERDNKEEVCDQLDLNNLL 207

Query: 153 HVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGIL 212
                 LSGG+ +R  IA   V      + DEP + +D        + IR L +    I+
Sbjct: 208 DREVEQLSGGELQRFAIAMVCVQKADVYMFDEPSSYLDVKQRLKAAITIRSLINPDRYII 267

Query: 213 ITDHNV 218
           + +H++
Sbjct: 268 VVEHDL 273