RPSBLAST alignment for GI: 254780744 and conserved domain: cd03219

>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).. Length = 236
 Score =  214 bits (548), Expect = 2e-56
 Identities = 90/236 (38%), Positives = 138/236 (58%), Gaps = 10/236 (4%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    LTK++  +  +  V   V+PGEI GL+GPNGAGKTT F +++G +   SGS+  D
Sbjct: 1   LEVRGLTKRFGGLVALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSVLFD 60

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENIL----------AVLEVYEKDKKKR 135
           G DIT +P +  ARLGI    Q   +F  LTV EN++           +L    +++++ 
Sbjct: 61  GEDITGLPPHEIARLGIGRTFQIPRLFPELTVLENVMVAAQARTGSGLLLARARREEREA 120

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            E+ + LL+   +       A  LS GQ+RRLEIAR+L + P  +LLDEP AG++P    
Sbjct: 121 RERAEELLERVGLADLADRPAGELSYGQQRRLEIARALATDPKLLLLDEPAAGLNPEETE 180

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           ++  LIR+L  RGI +L+ +H++  +++L DR  ++  G V+A GT  E+ +N  V
Sbjct: 181 ELAELIRELRERGITVLLVEHDMDVVMSLADRVTVLDQGRVIAEGTPDEVRNNPRV 236