RPSBLAST alignment for GI: 254780744 and conserved domain: cd03235

>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.. Length = 213
 Score =  154 bits (391), Expect = 2e-38
 Identities = 78/216 (36%), Positives = 119/216 (55%), Gaps = 13/216 (6%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           LT  Y    V++ V   VKPGE + ++GPNGAGK+T    + GL+   SGSI++ G  + 
Sbjct: 5   LTVSYGGHPVLEDVSFEVKPGEFLAIVGPNGAGKSTLLKAILGLLKPTSGSIRVFGKPLE 64

Query: 91  KMPMYRRARLGISYLPQEASIFRG--LTVEENILAVL----EVYEKDKKKRHEKLDSLLK 144
           K       R  I Y+PQ  SI R   ++V + +L  L     ++ +  K    K+D  L+
Sbjct: 65  KE------RKRIGYVPQRRSIDRDFPISVRDVVLMGLYGHKGLFRRLSKADKAKVDEALE 118

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
              +++        LSGGQ++R+ +AR+LV  P  +LLDEPFAGVDP    DI+ L+R+L
Sbjct: 119 RVGLSELADRQIGELSGGQQQRVLLARALVQDPDLLLLDEPFAGVDPKTQEDIYELLREL 178

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHG 240
              G+ IL+  H++  +L   DR  ++    V+A G
Sbjct: 179 RREGMTILVVTHDLGLVLEYFDRVLLL-NRTVVASG 213