RPSBLAST alignment for GI: 254780744 and conserved domain: cd03251

>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 234
 Score = 86.0 bits (213), Expect = 9e-18
 Identities = 62/226 (27%), Positives = 106/226 (46%), Gaps = 35/226 (15%)

Query: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT--KMPMYRR 97
           V++ + L +  GE V L+GP+G+GK+T   ++      DSG I IDG+D+    +   RR
Sbjct: 17  VLRDISLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVDSGRILIDGHDVRDYTLASLRR 76

Query: 98  ARLGISYLPQEASIFRGLTVEENIL-----AVLEVYEKDKKKRH---------EKLDSLL 143
               I  + Q+  +F   TV ENI      A  E  E+  +  +         E  D+++
Sbjct: 77  Q---IGLVSQDVFLFND-TVAENIAYGRPGATREEVEEAARAANAHEFIMELPEGYDTVI 132

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  +          LSGGQR+R+ IAR+L+  P  ++LDE  + +D  +   +   +  
Sbjct: 133 GERGVK---------LSGGQRQRIAIARALLKDPPILILDEATSALDTESERLVQAALER 183

Query: 204 LASRGIGILITDHNVHEILTL--IDRAYIIHAGGVLAHGTVQEIID 247
           L       +I     H + T+   DR  ++  G ++  GT +E++ 
Sbjct: 184 LMKNRTTFVIA----HRLSTIENADRIVVLEDGKIVERGTHEELLA 225