RPSBLAST alignment for GI: 254780744 and conserved domain: cd03256

>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 241
 Score =  128 bits (323), Expect = 1e-30
 Identities = 73/245 (29%), Positives = 127/245 (51%), Gaps = 19/245 (7%)

Query: 26  LSACSLTKKY-NSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +   +L+K Y N    +K V L + PGE V L+GP+GAGK+T    + GL+   SGS+ I
Sbjct: 1   IEVENLSKTYPNGKKALKDVSLSINPGEFVALIGPSGAGKSTLLRCLNGLVEPTSGSVLI 60

Query: 85  DGNDITKMPMY--RRARLGISYLPQEASIFRGLTVEENIL-----------AVLEVYEKD 131
           DG DI K+     R+ R  I  + Q+ ++   L+V EN+L           ++  ++ K+
Sbjct: 61  DGTDINKLKGKALRQLRRQIGMIFQQFNLIERLSVLENVLSGRLGRRSTWRSLFGLFPKE 120

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
           +K   ++  + L+   +    +  A  LSGGQ++R+ IAR+L+  P  IL DEP A +DP
Sbjct: 121 EK---QRALAALERVGLLDKAYQRADQLSGGQQQRVAIARALMQQPKLILADEPVASLDP 177

Query: 192 VAISDIHVLIRDLA-SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQD 250
            +   +  L++ +    GI ++++ H V       DR   +  G ++  G   E + ++ 
Sbjct: 178 ASSRQVMDLLKRINREEGITVIVSLHQVDLAREYADRIVGLKDGRIVFDGPPAE-LTDEV 236

Query: 251 VRRLY 255
           +  +Y
Sbjct: 237 LDEIY 241