RPSBLAST alignment for GI: 254780744 and conserved domain: cd03271

>gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 261
 Score = 38.6 bits (90), Expect = 0.002
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 18/99 (18%)

Query: 156 APLLSGGQRRRLEIARSLVSFPS-----YILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
           A  LSGG+ +R+++A+ L S  S     YIL DEP  G+    +  +  +++ L  +G  
Sbjct: 167 ATTLSGGEAQRIKLAKEL-SKRSTGKTLYIL-DEPTTGLHFHDVKKLLEVLQRLVDKGNT 224

Query: 211 ILITDHNVHEILTLIDRAYII--------HAGGVLAHGT 241
           +++ +HN+  I       +II          G V+A GT
Sbjct: 225 VVVIEHNLDVIKCA---DWIIDLGPEGGDGGGQVVASGT 260