RPSBLAST alignment for GI: 254780744 and conserved domain: cd03299

>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235
 Score =  135 bits (341), Expect = 1e-32
 Identities = 69/220 (31%), Positives = 117/220 (53%), Gaps = 5/220 (2%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L+K +   + +K V L V+ G+   +LGP G+GK+     + G I  DSG I ++G DI
Sbjct: 5   NLSKDWKE-FKLKNVSLEVERGDYFVILGPTGSGKSVLLETIAGFIKPDSGKILLNGKDI 63

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T +P  +R    ISY+PQ  ++F  +TV +NI   L+  + DKK+   K+  + +   I 
Sbjct: 64  TNLPPEKR---DISYVPQNYALFPHMTVYKNIAYGLKKRKVDKKEIERKVLEIAEMLGID 120

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASR-G 208
              +     LSGG+++R+ IAR+LV  P  +LLDEPF+ +D      +   ++ +    G
Sbjct: 121 HLLNRKPETLSGGEQQRVAIARALVVNPKILLLDEPFSALDVRTKEKLREELKKIRKEFG 180

Query: 209 IGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           + +L   H+  E   L D+  I+  G ++  G  +E+   
Sbjct: 181 VTVLHVTHDFEEAWALADKVAIMLNGKLIQVGKPEEVFKK 220