HHsearch alignment for GI: 254780745 and conserved domain: pfam06835

>pfam06835 DUF1239 Protein of unknown function (DUF1239). This family consists of several hypothetical bacterial proteins of around 190 residues in length. The function of this family is unknown.
Probab=98.93  E-value=2.8e-07  Score=57.91  Aligned_cols=121  Identities=19%  Similarity=0.216  Sum_probs=95.2

Q ss_pred             CCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEEC----CEEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCC--
Q ss_conf             45777847999116999923887999800899978----759999689999617665444200122201222024556--
Q gi|254780745|r   38 KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE----DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE--  111 (181)
Q Consensus        38 ~~d~~~Pi~I~AD~~~~d~~~~~~~~~GNV~i~qg----~~~i~aD~l~i~~~~~~~~~~~~i~~~~a~gnv~~~~~~--  111 (181)
T Consensus        46 d~~G~l~~~l~a~~~~~~~~~~~~~l~~P~~~~~~~~~~~w~i~A~~g~~~~~~~---------~i~L~g~V~i~~~~~~  116 (176)
T pfam06835        46 DEQGKLQYRLTADKLEHYPDDDTTEFTNPVLIIYQDGKPPWTITADRAKLNKDGQ---------TLYLYGNVVIQSLEDK  116 (176)
T ss_pred             CCCCCEEEEEEECEEEEECCCCCEEEEEEEEEEECCCCCEEEEEECEEEEECCCC---------EEEEECCEEEEECCCC
T ss_conf             9999899999904579965899689996399997799836999979499937996---------9999899999976899


Q ss_pred             ---CCEEEEEEEEECCCCEEEEEECCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCEEEEEE
Q ss_conf             ---5332112799416658999947863499971797699229999921658999928998099998
Q gi|254780745|r  112 ---INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII  175 (181)
Q Consensus       112 ---~~~~a~~~~y~~~~~~~~l~Gna~~~v~l~q~~~~i~gdki~yn~~tg~~~~~g~~~~rV~~i~  175 (181)
T Consensus       117 ~~~~~l~T~~l~~~~~~~~~~td~----~V~i~~~~~~~~g~gm~~~l~~~~~~l~~----~Vr~~y  175 (176)
T pfam06835       117 SRLTTITTENLTVNLDTQDASTDQ----PVTITGPNFVSTGTGMKANLKTGTAELLS----NVRGRY  175 (176)
T ss_pred             CCCEEEEEHEEEEECCCCEEEECC----CEEEEECCCEEEEEEEEEECCCCEEEEEC----CCEEEE
T ss_conf             875699922099994777999487----49999099799988899997589999943----616995