HHsearch alignment of GI: 254780745 and MMDB domain: 2r19_A_

>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A
Probab=99.91  E-value=4.4e-23  Score=143.20  Aligned_cols=137  Identities=17%  Similarity=0.173  Sum_probs=124.0

Q ss_pred             CCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCC--CEEEEEECCCCCCCCCCCCE
Q ss_conf             4457778479991169999238879998008999787599996899996176654442--00122201222024556533
Q gi|254780745|r   37 FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINV  114 (181)
Q Consensus        37 ~~~d~~~Pi~I~AD~~~~d~~~~~~~~~GNV~i~qg~~~i~aD~l~i~~~~~~~~~~~--~i~~~~a~gnv~~~~~~~~~  114 (181)
                      .+.+.++|++|+||++++|..++.++|+|||+|++++..|+||+++++++++.....+  ....+.+.|+|.+.+++..+
T Consensus         2 ~~~~~~~~i~i~Ad~~~~~~~~~~~~~~GnV~i~~~~~~l~ad~~~~~~~~~~~~~~~~~~~~~~~~~g~v~~~~~~~~~   81 (159)
T 2r19_A            2 VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEG   81 (159)
T ss_dssp             CGGGGGSCEEEEESEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTTSCCEEE
T ss_pred             CCCCCCCCEEEEECEEEEECCCCEEEEECCEEEEECCEEEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECCCCCEEEE
T ss_conf             87677899799956599235699999975689980867999989999977886642578751341189995168833999


Q ss_pred             EEEEEEEECCCCEEEEEECCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCEEEEEEEC
Q ss_conf             211279941665899994786349997179769922999992165899992899809999811
Q gi|254780745|r  115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY  177 (181)
Q Consensus       115 ~a~~~~y~~~~~~~~l~Gna~~~v~l~q~~~~i~gdki~yn~~tg~~~~~g~~~~rV~~i~~~  177 (181)
                      +|+++.|+..++.++|+||+    .++++.+.++|+++.|+++++.+.+.|..+.+++..+.+
T Consensus        82 ~~~~~~y~~~~~~~~~~g~~----~~~~~~~~~~g~~~~~~~~~~~~t~~~~~~~~~~~~~~~  140 (159)
T 2r19_A           82 HASQMHYELAKDFVVLTGNA----YLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVP  140 (159)
T ss_dssp             ECSEEEEEGGGTEEEEEEEE----EEEETTEEEEEEEEEEETTTTEEEEECSSSCCCCCCC--
T ss_pred             EEEEEEEECCCCEEEEECCE----EEEECCCEEEECEEEEEECCCEEEEECCCCCCEEEEECC
T ss_conf             98457997468889980678----999589999967899991689999965899945999998