Query         gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 181
No_of_seqs    112 out of 1078
Neff          8.1 
Searched_HMMs 23785
Date          Mon May 30 13:45:57 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780745.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2r19_A Protein YHBN; beta-jell 100.0 2.4E-30   1E-34  181.8  15.6  141   36-180     1-143 (159)
  2 3my2_A Lipopolysaccharide expo  98.8 2.5E-07   1E-11   57.0  14.3  126   37-180    36-171 (175)
  3 3my2_A Lipopolysaccharide expo  98.5 2.2E-06 9.2E-11   51.9  10.8   85   40-134    72-162 (175)
  4 2r19_A Protein YHBN; beta-jell  98.1 1.1E-05 4.6E-10   48.1   7.8   54   72-134    77-130 (159)
  5 2ptl_A Protein L; binding prot  22.5      30  0.0013   13.2   2.2   28   39-66     12-39  (78)
  6 1xf5_L Protein L, monoclonal a  20.0      34  0.0014   12.9   2.1   29   38-66     12-40  (80)
  7 2a3m_A COG3005: nitrate/TMAO r  12.9      53  0.0022   11.9   0.9   18   50-67     29-46  (130)
  8 3hun_A Penicillin-binding prot  12.6      33  0.0014   13.0  -0.2   16   52-67     74-89  (453)
  9 1hz6_A Protein L; four strande  10.8      62  0.0026   11.5   1.0   23   43-65     10-32  (72)
 10 2bv4_A Lectin CV-IIL; mannose;   9.3      71   0.003   11.2   2.6   26  155-181    47-72  (113)

No 1  
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A
Probab=99.97  E-value=2.4e-30  Score=181.75  Aligned_cols=141  Identities=16%  Similarity=0.160  Sum_probs=120.3

Q ss_pred             CCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEECCEEEEEEEEEEEECCCCCCCCC--CEEEEEECCCCCCCCCCCC
Q ss_conf             24457778479991169999238879998008999787599996899996176654442--0012220122202455653
Q gi|254780745|r   36 RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEIN  113 (181)
Q Consensus        36 ~~~~d~~~Pi~I~AD~~~~d~~~~~~~~~GNV~i~qg~~~i~aD~l~i~~~~~~~~~~~--~i~~~~a~gnv~~~~~~~~  113 (181)
                      |+++|+++||+|+||+++||++++.++|+|||++.||++.|+||+++++++.+......  ......+...+....+...
T Consensus         1 A~~~D~~qpi~I~Ad~l~~d~~~~~~~~~GnV~i~~g~~~i~ad~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (159)
T 2r19_A            1 AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVE   80 (159)
T ss_dssp             -CGGGGGSCEEEEESEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTTSCCEE
T ss_pred             CCCCCCCCCEEEEECEEEEECCCCEEEEECCEEEEECCEEEEEEEEEEEECCCCCCEEEEEECCCEEEEEEEECCCCEEE
T ss_conf             98867789989997779966089999998148998487699997799995377652146762143168999715884399


Q ss_pred             EEEEEEEEECCCCEEEEEECCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCEEEEEEECCCC
Q ss_conf             3211279941665899994786349997179769922999992165899992899809999811876
Q gi|254780745|r  114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR  180 (181)
Q Consensus       114 ~~a~~~~y~~~~~~~~l~Gna~~~v~l~q~~~~i~gdki~yn~~tg~~~~~g~~~~rV~~i~~~~~r  180 (181)
                      ++|+++.|+..++.++|+||+    .++|+++.++|++|+||++++.+.+.|++++||+++|.|...
T Consensus        81 a~a~~~~Y~~~~~~~~l~Gna----~l~q~~~~i~g~~i~y~~~~~~~~~~g~~~~RV~~~~~P~~~  143 (159)
T 2r19_A           81 GHASQMHYELAKDFVVLTGNA----YLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQL  143 (159)
T ss_dssp             EECSEEEEEGGGTEEEEEEEE----EEEETTEEEEEEEEEEETTTTEEEEECSSSCCCCCCC-----
T ss_pred             EEEEEEEEECCCCEEEEECCE----EEEECCCEEEEEEEEEECCCCEEEEECCCCCCEEEEECCCCC
T ss_conf             999899997779999996419----999799999975999990689999965899958999997655


No 2  
>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli}
Probab=98.81  E-value=2.5e-07  Score=57.01  Aligned_cols=126  Identities=16%  Similarity=0.182  Sum_probs=99.2

Q ss_pred             CCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEE-E--CC--EEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCC
Q ss_conf             4457778479991169999238879998008999-7--87--59999689999617665444200122201222024556
Q gi|254780745|r   37 FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT-Q--ED--FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE  111 (181)
Q Consensus        37 ~~~d~~~Pi~I~AD~~~~d~~~~~~~~~GNV~i~-q--g~--~~i~aD~l~i~~~~~~~~~~~~i~~~~a~gnv~~~~~~  111 (181)
                      +..+...-.+|+|++++.....+.+.+..-+... .  |.  ..|+||+..++ +.         ..+...|||.+....
T Consensus        36 ~d~~G~l~~~l~A~~~~~~~~~~~~~l~~P~~~~~~~~~~~~w~itA~~g~~~-~~---------~~l~L~gnV~i~~~~  105 (175)
T 3my2_A           36 YNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLT-ND---------RMLYLYGHVEVNALV  105 (175)
T ss_dssp             -------CEEEECSSEEEETTTTEEEEESCEEEEECTTCCEEEEEECSEEEEC-TT---------SEEEEEEEEEEEECS
T ss_pred             ECCCCCEEEEEECCHHEECCCCCCEEEECCEEEEECCCCCCEEEEEECEEEEC-CC---------CEEEEECEEEEEECC
T ss_conf             99999899999916314214889648825599997489982299993858987-99---------689996409999637


Q ss_pred             -----CCEEEEEEEEECCCCEEEEEECCCCEEEEEECCCEEEEEEEEEEECCCEEEEEECCCCEEEEEEECCCC
Q ss_conf             -----533211279941665899994786349997179769922999992165899992899809999811876
Q gi|254780745|r  112 -----INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR  180 (181)
Q Consensus       112 -----~~~~a~~~~y~~~~~~~~l~Gna~~~v~l~q~~~~i~gdki~yn~~tg~~~~~g~~~~rV~~i~~~~~r  180 (181)
                           ..+.++.+.|++.++.+.-.+.    |.+++++..++|..+.+|++++.+++.|    +|++.+.+.+|
T Consensus       106 ~~~~~~~l~T~~L~~~~~~~~~~td~~----V~i~~~~~~~~g~gm~~~l~~~~~~l~~----~Vk~~ye~~~~  171 (175)
T 3my2_A          106 PDSQLRRITTDNAQINLVTQDVTSEDL----VTLYGTTFNSSGLKMRGNLRSKNAELIE----KVRTSYEIQNK  171 (175)
T ss_dssp             SSCSEEEEEEEEEEEETTTCEEEEEEE----EEEEESSCEEEEEEEEEETTTTEEEEEE----EEEETTCC---
T ss_pred             CCCCCEEEEEEEEEEEECCCEEEECCC----EEEECCCCEEEEEEEEEECCCCEEEEEC----CEEEEEECCCC
T ss_conf             888746999815999915679994884----9999299699977899996389999940----62899928866


No 3  
>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli}
Probab=98.45  E-value=2.2e-06  Score=51.88  Aligned_cols=85  Identities=12%  Similarity=0.091  Sum_probs=70.7

Q ss_pred             CCCC-CEEEEEEEEEEECCCCEEEEEEEEEEEECC-----EEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCC
Q ss_conf             7778-479991169999238879998008999787-----5999968999961766544420012220122202455653
Q gi|254780745|r   40 LGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQED-----FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN  113 (181)
Q Consensus        40 d~~~-Pi~I~AD~~~~d~~~~~~~~~GNV~i~qg~-----~~i~aD~l~i~~~~~~~~~~~~i~~~~a~gnv~~~~~~~~  113 (181)
                      +... .+.|+||...++.. +...+.|||++.+-.     ++|.++.+.++.+.+         .+...+.|.+..++..
T Consensus        72 ~~~~~~w~itA~~g~~~~~-~~l~L~gnV~i~~~~~~~~~~~l~T~~L~~~~~~~---------~~~td~~V~i~~~~~~  141 (175)
T 3my2_A           72 KDKIPTWSVKADKAKLTND-RMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQ---------DVTSEDLVTLYGTTFN  141 (175)
T ss_dssp             TTCCEEEEEECSEEEECTT-SEEEEEEEEEEEECSSSCSEEEEEEEEEEEETTTC---------EEEEEEEEEEEESSCE
T ss_pred             CCCCCEEEEEECEEEECCC-CEEEEECEEEEEECCCCCCCEEEEEEEEEEEECCC---------EEEECCCEEEECCCCE
T ss_conf             8998229999385898799-68999640999963788874699981599991567---------9994884999929969


Q ss_pred             EEEEEEEEECCCCEEEEEECC
Q ss_conf             321127994166589999478
Q gi|254780745|r  114 VIASNGYVDFQKRILVLNGDR  134 (181)
Q Consensus       114 ~~a~~~~y~~~~~~~~l~Gna  134 (181)
                      .+|.-+.++...+.+.|.|+.
T Consensus       142 ~~g~gm~~~l~~~~~~l~~~V  162 (175)
T 3my2_A          142 SSGLKMRGNLRSKNAELIEKV  162 (175)
T ss_dssp             EEEEEEEEETTTTEEEEEEEE
T ss_pred             EEEEEEEEECCCCEEEEECCE
T ss_conf             997789999638999994062


No 4  
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A
Probab=98.10  E-value=1.1e-05  Score=48.11  Aligned_cols=54  Identities=11%  Similarity=0.115  Sum_probs=24.3

Q ss_pred             CCEEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCEEEEEEEEECCCCEEEEEECC
Q ss_conf             875999968999961766544420012220122202455653321127994166589999478
Q gi|254780745|r   72 EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR  134 (181)
Q Consensus        72 g~~~i~aD~l~i~~~~~~~~~~~~i~~~~a~gnv~~~~~~~~~~a~~~~y~~~~~~~~l~Gna  134 (181)
                      .....+||++.|+.+++         .+...||+.+.+++...+|++++|+..++.+...|+.
T Consensus        77 ~~~~a~a~~~~Y~~~~~---------~~~l~Gna~l~q~~~~i~g~~i~y~~~~~~~~~~g~~  130 (159)
T 2r19_A           77 KPVEGHASQMHYELAKD---------FVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDK  130 (159)
T ss_dssp             CCEEEECSEEEEEGGGT---------EEEEEEEEEEEETTEEEEEEEEEEETTTTEEEEECSS
T ss_pred             CEEEEEEEEEEEECCCC---------EEEEECCEEEEECCCEEEEEEEEEECCCCEEEEECCC
T ss_conf             43999998999977799---------9999641999979999997599999068999996589


No 5  
>2ptl_A Protein L; binding protein(immunoglobulin L chain); NMR {Finegoldia magna atcc 29328} SCOP: d.15.7.1
Probab=22.48  E-value=30  Score=13.17  Aligned_cols=28  Identities=32%  Similarity=0.466  Sum_probs=21.8

Q ss_pred             CCCCCCEEEEEEEEEEECCCCEEEEEEE
Q ss_conf             5777847999116999923887999800
Q gi|254780745|r   39 VLGNEKIHIKADMLEVKDAVQKAFFKGN   66 (181)
Q Consensus        39 ~d~~~Pi~I~AD~~~~d~~~~~~~~~GN   66 (181)
                      .+..+.+.|.++-+..|...+.+.|.|-
T Consensus        12 ~~~~EeVTIKaNlifadG~tQtAeFkGT   39 (78)
T 2ptl_A           12 TDSEEEVTIKANLIFANGSTQTAEFKGT   39 (78)
T ss_dssp             SCSSCSEEEEEEEECSSSCCEEEEEEES
T ss_pred             CCCCCEEEEEEEEEECCCCEEEEEEEEE
T ss_conf             8864247999889971695787786200


No 6  
>1xf5_L Protein L, monoclonal antibody 19D9D6 light chain; crystal packing, FAB, peptide complex, immune system; 2.60A {Finegoldia magna atcc 29328} PDB: 1xct_L 1xcq_L
Probab=20.00  E-value=34  Score=12.88  Aligned_cols=29  Identities=28%  Similarity=0.400  Sum_probs=21.3

Q ss_pred             CCCCCCCEEEEEEEEEEECCCCEEEEEEE
Q ss_conf             45777847999116999923887999800
Q gi|254780745|r   38 KVLGNEKIHIKADMLEVKDAVQKAFFKGN   66 (181)
Q Consensus        38 ~~d~~~Pi~I~AD~~~~d~~~~~~~~~GN   66 (181)
                      +..+.+.+.|.++-+..|...+.+.|.|-
T Consensus        12 peepkEeVTIK~NlifadG~tQtAeFkGT   40 (80)
T 1xf5_L           12 PEEPKEEVTIKVNLIFADGKIQTAEFKGT   40 (80)
T ss_dssp             CSSCCCCEEEEEEEEETTSCEEEEEEEES
T ss_pred             CCCCCCEEEEEEEEEECCCCEEEEEEEEE
T ss_conf             98875237899989971695787887301


No 7  
>2a3m_A COG3005: nitrate/TMAO reductases, membrane-bound tetraheme cytochrome C subunit; electron transport; HET: HEM; 1.50A {Desulfovibrio desulfuricans subsp} PDB: 2a3p_A*
Probab=12.88  E-value=53  Score=11.86  Aligned_cols=18  Identities=17%  Similarity=0.300  Sum_probs=7.5

Q ss_pred             EEEEEECCCCEEEEEEEE
Q ss_conf             169999238879998008
Q gi|254780745|r   50 DMLEVKDAVQKAFFKGNV   67 (181)
Q Consensus        50 D~~~~d~~~~~~~~~GNV   67 (181)
                      |.+.++...+-+.|.=.+
T Consensus        29 ~~~~~~~~~~pV~F~H~~   46 (130)
T 2a3m_A           29 DGLKMENTKMPVIFNHSS   46 (130)
T ss_dssp             SCEEECSSSSCEEECGGG
T ss_pred             CCCCCCCCCCCEECCHHH
T ss_conf             333335788986457789


No 8  
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, antibiotics; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A*
Probab=12.62  E-value=33  Score=13.00  Aligned_cols=16  Identities=6%  Similarity=0.088  Sum_probs=6.4

Q ss_pred             EEEECCCCEEEEEEEE
Q ss_conf             9999238879998008
Q gi|254780745|r   52 LEVKDAVQKAFFKGNV   67 (181)
Q Consensus        52 ~~~d~~~~~~~~~GNV   67 (181)
                      +-+|..+|.+.|.-|.
T Consensus        74 il~da~tG~iLy~KN~   89 (453)
T 3hun_A           74 AVNVSQTGQLLYQYNI   89 (453)
T ss_dssp             EEEEETTSBEEEEEST
T ss_pred             EEEECCCCCEEEEECC
T ss_conf             9999899949335784


No 9  
>1hz6_A Protein L; four stranded beta-sheet with central alpha helix, binds kappa light chain of immunoglobulins, protein binding; 1.70A {Finegoldia magna atcc 29328} SCOP: d.15.7.1 PDB: 1hz5_A 1k53_A 1k51_A 1k52_A 1jml_A 1k50_A 2jzp_A 2kac_A 1kh0_A 1ymh_E 1mhh_E* 1hez_E 1ynt_E
Probab=10.81  E-value=62  Score=11.49  Aligned_cols=23  Identities=39%  Similarity=0.599  Sum_probs=12.0

Q ss_pred             CCEEEEEEEEEEECCCCEEEEEE
Q ss_conf             84799911699992388799980
Q gi|254780745|r   43 EKIHIKADMLEVKDAVQKAFFKG   65 (181)
Q Consensus        43 ~Pi~I~AD~~~~d~~~~~~~~~G   65 (181)
                      +.+.|.++-+..|.+.+.++|.|
T Consensus        10 EeVTIK~NlifadG~tQtAeFKG   32 (72)
T 1hz6_A           10 EEVTIKANLIFANGSTQTAEFKG   32 (72)
T ss_dssp             SCEEEEEEEECTTSCEEEEEEEE
T ss_pred             HEEEEEEEEEECCCCEEEEEEEE
T ss_conf             23787888998179588888720


No 10 
>2bv4_A Lectin CV-IIL; mannose; HET: MMA; 1.0A {Chromobacterium violaceum} PDB: 2boi_A*
Probab=9.26  E-value=71  Score=11.16  Aligned_cols=26  Identities=15%  Similarity=0.242  Sum_probs=0.0

Q ss_pred             EECCCEEEEEECCCCEEEEEEECCCCC
Q ss_conf             921658999928998099998118769
Q gi|254780745|r  155 NIDTSFASLQGCESDQVQSIIRYDGRP  181 (181)
Q Consensus       155 n~~tg~~~~~g~~~~rV~~i~~~~~r~  181 (181)
                      |-..++....++.++ ||..+.-+|||
T Consensus        47 d~~~~t~~lnSG~Gk-VrieV~~nGKp   72 (113)
T 2bv4_A           47 DNNLGTKVINSGSGN-VRVQITANGRQ   72 (113)
T ss_dssp             EEEEEEEEEECTTSE-EEEEEEETTEE
T ss_pred             CCCCCEEEEECCCCE-EEEEEEECCCC
T ss_conf             775111999669970-99999848943


Done!