BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780745|ref|YP_003065158.1| OstA family protein
[Candidatus Liberibacter asiaticus str. psy62]
         (181 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040422|gb|ACT57218.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 181

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK
Sbjct: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY
Sbjct: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR
Sbjct: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180

Query: 181 P 181
           P
Sbjct: 181 P 181


>gi|315121908|ref|YP_004062397.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495310|gb|ADR51909.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 155

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 111/157 (70%), Gaps = 7/157 (4%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           +K DLS+A +SY + FK+  +++I+I +D L+V+D ++KA F+G V +TQ D ++QA+++
Sbjct: 1   MKTDLSRAESSYFSSFKIGRDQEIYIHSDTLDVQDDLKKASFRGGVTVTQGDTNMQAEEI 60

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y     D S++++RMD+  N+ I S +   +A NGY DFQK+ILVL G   DKVI +
Sbjct: 61  ILHYT----DSSDQLSRMDMRNNVIINSDKNKAMAKNGYCDFQKKILVLYG---DKVIFQ 113

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           E +NTFLGC+L V +D   A LQGC S QV+SII+Y+
Sbjct: 114 EGMNTFLGCRLTVKLDVGTAYLQGCGSQQVKSIIKYN 150


>gi|227820606|ref|YP_002824576.1| putative OstA-like protein [Sinorhizobium fredii NGR234]
 gi|227339605|gb|ACP23823.1| putative OstA-like protein [Sinorhizobium fredii NGR234]
          Length = 187

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 81/152 (53%), Gaps = 7/152 (4%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            ++    L+QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA
Sbjct: 23  LIIASGALAQATSSRMKGMQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQA 82

Query: 79  DKMTIDYNNTNRDV----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
             MT+ Y  T        +  I+R++V   +F+ SG        G V+   + +VL G  
Sbjct: 83  GNMTVFYKATEGATITSGNADIDRIEVNNKVFLSSGAQQATGDTGLVNLTNQTIVLKG-- 140

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
            DKV+L E  N F+GC+L V +DT  A L+ C
Sbjct: 141 -DKVVLSEGKNVFVGCQLNVQMDTGEAQLEAC 171


>gi|150395245|ref|YP_001325712.1| OstA family protein [Sinorhizobium medicae WSM419]
 gi|150026760|gb|ABR58877.1| OstA family protein [Sinorhizobium medicae WSM419]
          Length = 186

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 82/150 (54%), Gaps = 6/150 (4%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           ++  A  +QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA 
Sbjct: 24  LIASAAFAQATSSRMQGLQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAG 83

Query: 80  KMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            MT+ Y      V++    I+R++V   +F+ SG       +G V+   + +VL G   +
Sbjct: 84  NMTVFYKAGGGSVTSGNADIDRIEVNNKVFLSSGTQQATGESGIVNLTNQTIVLKG---E 140

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           KV+L E  N F+GC+L V ++T  A L  C
Sbjct: 141 KVVLSEGKNVFVGCQLNVQMNTGEAQLDAC 170


>gi|159184263|ref|NP_353366.2| hypothetical protein Atu0334 [Agrobacterium tumefaciens str. C58]
 gi|159139590|gb|AAK86151.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 187

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 12/168 (7%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +A L +  L+   LA V        +Q   S M   K+ G++ I I++D LE++D  +KA
Sbjct: 13  TAGLTAAGLFFSCLATV------AFAQNTTSSMQGVKLSGDQPIAIESDQLEIRDQERKA 66

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEINVIASN 118
           +F GNV + Q   +LQA KMT++Y      +++    I ++ V+ N+++ S      A +
Sbjct: 67  YFTGNVKVVQGTTTLQAGKMTVNYKGQGSSLTSGDANIEKIFVDNNVYLTSETQKATADH 126

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           G  D   +  +L G +   V+L E  N F GCKL V ++T  A L+ C
Sbjct: 127 GEFDMAAQTFILTGKQ---VVLSEGTNVFTGCKLTVLMNTGQAKLESC 171


>gi|15964136|ref|NP_384489.1| hypothetical protein SMc01137 [Sinorhizobium meliloti 1021]
 gi|307301281|ref|ZP_07581043.1| OstA family protein [Sinorhizobium meliloti BL225C]
 gi|307317952|ref|ZP_07597389.1| OstA family protein [Sinorhizobium meliloti AK83]
 gi|7404503|sp|P25893|Y383_RHIME RecName: Full=Uncharacterized protein R00383; Flags: Precursor
 gi|15073312|emb|CAC41820.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896354|gb|EFN27103.1| OstA family protein [Sinorhizobium meliloti AK83]
 gi|306903737|gb|EFN34324.1| OstA family protein [Sinorhizobium meliloti BL225C]
          Length = 186

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 77/142 (54%), Gaps = 6/142 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA  MT+ Y  
Sbjct: 32  QATSSRMQGLQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGNMTVFYKA 91

Query: 88  TNRDVSNK---INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
               V++    I+R++V   +F+ SG       +G V+   + +VL G    KV+L E  
Sbjct: 92  GGGSVTSGNADIDRIEVSNKVFLSSGAQQATGESGIVNLTNQTIVLKG---KKVVLSEGK 148

Query: 145 NTFLGCKLIVNIDTSFASLQGC 166
           N F+GC+L V +DT  A L  C
Sbjct: 149 NVFVGCQLNVQMDTGEAQLDAC 170


>gi|325291769|ref|YP_004277633.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
 gi|325059622|gb|ADY63313.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
          Length = 218

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 6/149 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L     +Q   S MT  K+ G++ I I++D LE++D  +KA+F GNV + Q   +LQA K
Sbjct: 56  LATVAFAQNTTSNMTGVKLSGDQPIAIESDQLEIRDQERKAYFTGNVKVVQGTTTLQAGK 115

Query: 81  MTIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           MT++Y      +++    I ++ V+ N+++ S      A +G  D   +  +L G    +
Sbjct: 116 MTVNYKGEGSSLTSGDANIEKIFVDNNVYLTSETQKATADHGEFDMAAQTFILTG---KQ 172

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           V+L E  N F GCKL V +++  A L+ C
Sbjct: 173 VVLSEGANVFTGCKLTVLMNSGQAKLESC 201


>gi|163757835|ref|ZP_02164924.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43]
 gi|162285337|gb|EDQ35619.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43]
          Length = 183

 Score = 84.3 bits (207), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 76/143 (53%), Gaps = 6/143 (4%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +Q + S MT   + G+E I I++D+L++ +   +A F GNV + Q D  LQA +M + Y 
Sbjct: 28  AQTSESRMTGLALSGDEPIQIESDLLQINEETSQATFTGNVRVLQGDTVLQAGEMIVHYA 87

Query: 87  NTNRDVSNK---INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
                V++    I  +D+ + + I+SG     A  G  +    +LVL+G   +KV+L + 
Sbjct: 88  KNGGSVASGAADIREIDLFKKVLIRSGTQTATADTGNFNMANEVLVLSG---EKVVLTDA 144

Query: 144 LNTFLGCKLIVNIDTSFASLQGC 166
            N F+GCKL V +    A L  C
Sbjct: 145 ENVFIGCKLTVQMQNGQAKLDSC 167


>gi|222147329|ref|YP_002548286.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4]
 gi|221734319|gb|ACM35282.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4]
          Length = 187

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 75/142 (52%), Gaps = 6/142 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q+A S M   K+ G++ I I++D LEV     KA F GNV + Q   ++++  M + Y  
Sbjct: 33  QSATSNMNSLKLSGDKPIQIESDALEVHQQENKANFNGNVKVVQGTTTMRSGTMVVKYKG 92

Query: 88  TNRDVSN---KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
               V++   KI+ +DV  N+ + +      A  G+ D   +I  L+G   DKV+L E  
Sbjct: 93  QGAAVTSGDAKIDTIDVADNVILNTETQQATADKGHFDMNTQIFTLDG---DKVVLSEGG 149

Query: 145 NTFLGCKLIVNIDTSFASLQGC 166
           N F+GCKL V++ T  A L  C
Sbjct: 150 NVFVGCKLTVHMTTGEAKLDSC 171


>gi|116250189|ref|YP_766027.1| outer membrane OstA family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254837|emb|CAK05911.1| putative outer membrane OstA family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 213

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 79/171 (46%), Gaps = 21/171 (12%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           AL+     A   QA A+ M   K+  ++ I I++D LE++D    A F GNV + Q   +
Sbjct: 22  ALILTASGAGAQQATAT-MPGMKLSNDQPIQIESDKLEIRDQEHTALFTGNVKVVQGTTT 80

Query: 76  LQADKMTIDYNNTNRDV--------------------SNKINRMDVERNIFIQSGEINVI 115
           +Q+ KMT+ Y +                         S  I+++ V   +F+ SG     
Sbjct: 81  MQSGKMTVYYKDKAAKPAADGAQPAAQPDQSASLASGSADIDKILVTDKVFLSSGTQTAT 140

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           A +G  D   +  +L  D  +KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 141 ADDGNFDMASQTFILTADEGNKVILSDGPNVFTGCKLTVHMQTGQAELESC 191


>gi|260460503|ref|ZP_05808754.1| OstA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259033608|gb|EEW34868.1| OstA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 196

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 91/187 (48%), Gaps = 19/187 (10%)

Query: 4   FLNS-IHLYIHLLALVFVLLKADLSQA-AASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +LNS   L     AL+ + L    +Q+ AAS M+  K+ G++ I I++D LEV  A   A
Sbjct: 2   WLNSSTRLVAATSALLLLGLAPSSAQSGAASQMSGLKLSGDQPIQIESDKLEVHQADSTA 61

Query: 62  FFKGNVFMTQEDFSLQADKMTI----DYNNTNRDV----------SNKINRMDVERNIFI 107
            F GNV + Q    ++A KMT+    D N   +            S  I+ ++V   ++I
Sbjct: 62  IFTGNVTVVQGATMMKAGKMTVYYVKDPNAGAKGTEAAGAAAMTGSANIDHLEVSSKVYI 121

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
           +S +      NG  D + ++LVL+G    +V+L +  N   GCKL V + +  A +  C 
Sbjct: 122 KSNDQVATGDNGTFDMKTQVLVLSG---KEVVLSQGDNVLKGCKLTVQMKSGLAQVDACG 178

Query: 168 SDQVQSI 174
              + SI
Sbjct: 179 GRVIMSI 185


>gi|241202816|ref|YP_002973912.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856706|gb|ACS54373.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 204

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 77/176 (43%), Gaps = 25/176 (14%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
            AL+     A   QA A+ M   K+  ++ I I++D LE+ D    A F GNV + Q   
Sbjct: 8   FALILTASGAGAQQATAT-MPGMKLSNDQPIQIESDKLEIHDQEHTALFTGNVKVVQGAT 66

Query: 75  SLQADKMTIDYNNTNRDV------------------------SNKINRMDVERNIFIQSG 110
           ++Q+ KMT+ Y +                             S  I+++ V   +F+ SG
Sbjct: 67  TMQSGKMTVYYKDKAAKPATDGTQPAAQPAAQPQQSASLASGSADIDKILVTDKVFLTSG 126

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
                A +G  D   +  +L  D   KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 127 TQTATADDGNFDMASQTFILTADEGKKVILSDGPNVFTGCKLTVHMQTGQAELESC 182


>gi|190890074|ref|YP_001976616.1| hypothetical protein RHECIAT_CH0000444 [Rhizobium etli CIAT 652]
 gi|190695353|gb|ACE89438.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327193442|gb|EGE60340.1| hypothetical protein RHECNPAF_159005 [Rhizobium etli CNPAF512]
          Length = 212

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 81/186 (43%), Gaps = 22/186 (11%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           +SA    +       AL+  +  A   QA  + M+  K+  ++ I I++D LE+ D    
Sbjct: 7   ISACKTGVAFIAGAFALILTVSGAAAQQA--TTMSGMKLSNDQPIQIESDKLEIHDQEHT 64

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--------------------SNKINRMD 100
           A F G V + Q   ++Q+ KMT+ Y +                         S  I+++ 
Sbjct: 65  ALFTGKVKVVQGTTTMQSGKMTVYYKDKAAKPAADGAQPAAQPEKSASLASGSADIDKIL 124

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
           V   + + SG     A +G  D   +   L  D+ +KVIL +  N F GCKL V++ T  
Sbjct: 125 VTDKVLLTSGTQTATADDGKFDMASQTFTLTADQGNKVILSDGPNVFTGCKLTVHMQTGQ 184

Query: 161 ASLQGC 166
           A L+ C
Sbjct: 185 AELESC 190


>gi|13472790|ref|NP_104357.1| hypothetical protein mll3198 [Mesorhizobium loti MAFF303099]
 gi|14023537|dbj|BAB50143.1| mll3198 [Mesorhizobium loti MAFF303099]
          Length = 199

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI----D 84
            A+S ++  K+ G++ I I++D LEV+ A   A F GNV + Q    L+A KM +    D
Sbjct: 29  GASSQVSGLKLSGDKPIQIESDKLEVRQAENLAVFTGNVTVVQGPTLLKAGKMMVYYVKD 88

Query: 85  YNNTNRDV---------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
            N   +           S  I+ ++V   ++I+S +      NG  D + ++LVL+G   
Sbjct: 89  PNAAAKGTEAAGAAMTGSANIDHLEVSSKVYIKSDDQVATGDNGTFDMKTQVLVLSG--- 145

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
            +V+L +  N   GCKL V + T  A++ GC
Sbjct: 146 KEVVLSQGPNVLKGCKLTVQMKTGLANVDGC 176


>gi|239831005|ref|ZP_04679334.1| OstA family protein [Ochrobactrum intermedium LMG 3301]
 gi|239823272|gb|EEQ94840.1| OstA family protein [Ochrobactrum intermedium LMG 3301]
          Length = 216

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 90/181 (49%), Gaps = 24/181 (13%)

Query: 7   SIHLYIHLLALVFVLLK-ADLSQAAASYMTRFKVLGNEKIHIK--ADMLEVKDAVQKAFF 63
           ++ +   +LAL  V    A L+Q  A+ +   K L N K  +K  AD LE++D    A F
Sbjct: 16  TLRMGFAVLALGMVAAPTASLAQEGAA-VNGLK-LSNSKAPVKIDADKLEMRDKEGVAVF 73

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDV----------------SNKINRMDVERNIFI 107
            GNV ++Q D  L+A +MT+ YN   +D                 S+ I+ +D+   +++
Sbjct: 74  TGNVAVSQGDALLKAGQMTVYYNKAKKDGDAQAPEPASAGVGGLDSSSIDHIDISGKVYL 133

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
           +SG        G  D + +++VL G    KV+L +  N   GCKL  ++DT  A+++ C+
Sbjct: 134 KSGTQVATGDTGRYDAKNQVMVLQG---QKVVLTDGDNVVTGCKLTAHLDTGRANVESCK 190

Query: 168 S 168
            
Sbjct: 191 G 191


>gi|86356059|ref|YP_467951.1| hypothetical protein RHE_CH00402 [Rhizobium etli CFN 42]
 gi|86280161|gb|ABC89224.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 174

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 72/154 (46%), Gaps = 21/154 (13%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN------ 87
           M+  K+  ++ I I++D LE+ D    A F GNV + Q   ++Q+ KMT+ Y +      
Sbjct: 1   MSGMKLSNDQPIQIESDKLEIHDQEHTALFTGNVKVVQGTTTMQSGKMTVYYKDKAAKSG 60

Query: 88  ----------TNRDVSNKINRMDVER-----NIFIQSGEINVIASNGYVDFQKRILVLNG 132
                       +  S      D+++      +++ SG     A +G  D   +  +L  
Sbjct: 61  AGAPAQPEAKPEKSASLASGSADIDKILVTDKVYLVSGTQTATADDGNFDMASQTFILTA 120

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           D+ +KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 121 DQGNKVILSDGPNVFTGCKLTVHMQTGQAELESC 154


>gi|209547658|ref|YP_002279575.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533414|gb|ACI53349.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 211

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 76/171 (44%), Gaps = 20/171 (11%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           A   VL  +      A+ M+  K+  ++ I I++D LE+ D    A F G V + Q   +
Sbjct: 20  AFALVLTASGAGAQQAATMSGMKLSNDQPIQIESDKLEIHDQEHTALFTGKVKVVQGTTT 79

Query: 76  LQADKMTIDYNNTNRDV--------------------SNKINRMDVERNIFIQSGEINVI 115
           +Q+ KMT+ Y +                         S  I+++ V   + + SG     
Sbjct: 80  MQSGKMTVYYKDKAAKPAADGTQPAAQPQQSASLASGSADIDKILVTDKVLLTSGTQTAT 139

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           A +G  D   +  +L  D+ +KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 140 ADDGKFDMASQTFILTADQGNKVILSDGPNVFTGCKLTVHMQTGQAELESC 190


>gi|153007513|ref|YP_001368728.1| OstA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559401|gb|ABS12899.1| OstA family protein [Ochrobactrum anthropi ATCC 49188]
          Length = 216

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 74/147 (50%), Gaps = 21/147 (14%)

Query: 40  LGNEKIHIK--ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV----- 92
           L N K  +K  AD LE++D    A F GNV ++Q D  L+A +MT+ YN   +D      
Sbjct: 48  LSNSKAPVKIDADKLEMRDKEGIAIFTGNVAVSQGDALLKAGQMTVYYNKAKKDGEAPAP 107

Query: 93  -----------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                      S+ I+ +D+   ++++SG        G  D + +++VL G    KV+L 
Sbjct: 108 EPTSAGVGGLDSSSIDHIDISGKVYLKSGTQVATGDTGRYDAKNQVMVLQG---QKVVLT 164

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCES 168
           +  N   GCKL  ++DT  A+++ C+ 
Sbjct: 165 DGDNVVTGCKLTAHLDTGRANVESCKG 191


>gi|294851556|ref|ZP_06792229.1| hypothetical protein BAZG_00464 [Brucella sp. NVSL 07-0026]
 gi|294820145|gb|EFG37144.1| hypothetical protein BAZG_00464 [Brucella sp. NVSL 07-0026]
          Length = 218

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + I I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 57  DPIKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 116

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ IN +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 117 GGIGSSSINHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 173

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 174 GCKLTAHLDTGRANVESCKG 193


>gi|319781470|ref|YP_004140946.1| OstA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167358|gb|ADV10896.1| OstA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 193

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 16/159 (10%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI--- 83
           S A  +  +  K+ G++ I I++D LEV+ A   A F GNV + Q    ++A KMT+   
Sbjct: 24  SWAQTTSQSGLKLSGDKPIQIESDKLEVRQADSVAIFTGNVSVVQGPTLMKAGKMTVYYV 83

Query: 84  -DYNNTNRDV---------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
            D N   +           S  I+ +++   ++I+S         G  D + ++LVL+G 
Sbjct: 84  KDPNAAAKGTEAAGAAMTGSANIDHLEISDKVYIKSDAQIATGDQGSFDMKSQVLVLSG- 142

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
              KV+L +  N  +GCKL V + +  A +  C   +VQ
Sbjct: 143 --KKVVLSQNDNVLVGCKLTVQMKSGLAQVDPCAGQRVQ 179


>gi|23501067|ref|NP_697194.1| hypothetical protein BR0156 [Brucella suis 1330]
 gi|62289132|ref|YP_220925.1| hypothetical protein BruAb1_0152 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699071|ref|YP_413645.1| OstA-like protein [Brucella melitensis biovar Abortus 2308]
 gi|161618144|ref|YP_001592031.1| hypothetical protein BCAN_A0161 [Brucella canis ATCC 23365]
 gi|254690460|ref|ZP_05153714.1| OstA-like protein [Brucella abortus bv. 6 str. 870]
 gi|254694949|ref|ZP_05156777.1| OstA-like protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696580|ref|ZP_05158408.1| OstA-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254705335|ref|ZP_05167163.1| OstA-like protein [Brucella suis bv. 3 str. 686]
 gi|254707152|ref|ZP_05168980.1| OstA-like protein [Brucella pinnipedialis M163/99/10]
 gi|254709305|ref|ZP_05171116.1| OstA-like protein [Brucella pinnipedialis B2/94]
 gi|254713272|ref|ZP_05175083.1| OstA-like protein [Brucella ceti M644/93/1]
 gi|254716375|ref|ZP_05178186.1| OstA-like protein [Brucella ceti M13/05/1]
 gi|254731493|ref|ZP_05190071.1| OstA-like protein [Brucella abortus bv. 4 str. 292]
 gi|256030828|ref|ZP_05444442.1| OstA-like protein [Brucella pinnipedialis M292/94/1]
 gi|256060298|ref|ZP_05450471.1| OstA-like protein [Brucella neotomae 5K33]
 gi|256158853|ref|ZP_05456710.1| OstA-like protein [Brucella ceti M490/95/1]
 gi|256254234|ref|ZP_05459770.1| OstA-like protein [Brucella ceti B1/94]
 gi|256258716|ref|ZP_05464252.1| OstA-like protein [Brucella abortus bv. 9 str. C68]
 gi|256368620|ref|YP_003106126.1| hypothetical protein BMI_I159 [Brucella microti CCM 4915]
 gi|260169732|ref|ZP_05756543.1| OstA-like protein [Brucella sp. F5/99]
 gi|260885032|ref|ZP_05896646.1| OstA family protein [Brucella abortus bv. 9 str. C68]
 gi|261221383|ref|ZP_05935664.1| OstA family protein [Brucella ceti B1/94]
 gi|261324270|ref|ZP_05963467.1| OstA family protein [Brucella neotomae 5K33]
 gi|265987883|ref|ZP_06100440.1| OstA family protein [Brucella pinnipedialis M292/94/1]
 gi|265997344|ref|ZP_06109901.1| OstA family protein [Brucella ceti M490/95/1]
 gi|23346935|gb|AAN29109.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195264|gb|AAX73564.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615172|emb|CAJ10111.1| OstA-like protein [Brucella melitensis biovar Abortus 2308]
 gi|161334955|gb|ABX61260.1| hypothetical protein BCAN_A0161 [Brucella canis ATCC 23365]
 gi|255998778|gb|ACU47177.1| hypothetical protein BMI_I159 [Brucella microti CCM 4915]
 gi|260874560|gb|EEX81629.1| OstA family protein [Brucella abortus bv. 9 str. C68]
 gi|260919967|gb|EEX86620.1| OstA family protein [Brucella ceti B1/94]
 gi|261300250|gb|EEY03747.1| OstA family protein [Brucella neotomae 5K33]
 gi|262551812|gb|EEZ07802.1| OstA family protein [Brucella ceti M490/95/1]
 gi|264660080|gb|EEZ30341.1| OstA family protein [Brucella pinnipedialis M292/94/1]
          Length = 204

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 43  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 102

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 103 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 159

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 160 GCKLTAHLDTGRANVESCKG 179


>gi|163842426|ref|YP_001626830.1| hypothetical protein BSUIS_A0157 [Brucella suis ATCC 23445]
 gi|163673149|gb|ABY37260.1| hypothetical protein BSUIS_A0157 [Brucella suis ATCC 23445]
          Length = 204

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 43  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 102

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 103 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 159

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A ++ C+ 
Sbjct: 160 GCKLTAHLDTGRAKVESCKG 179


>gi|189023408|ref|YP_001934176.1| OstA-like protein [Brucella abortus S19]
 gi|225626695|ref|ZP_03784734.1| OstA-like protein [Brucella ceti str. Cudo]
 gi|237814626|ref|ZP_04593624.1| OstA-like protein [Brucella abortus str. 2308 A]
 gi|260756012|ref|ZP_05868360.1| OstA family protein [Brucella abortus bv. 6 str. 870]
 gi|261320995|ref|ZP_05960192.1| OstA family protein [Brucella ceti M644/93/1]
 gi|297247548|ref|ZP_06931266.1| hypothetical protein BAYG_00459 [Brucella abortus bv. 5 str. B3196]
 gi|189018980|gb|ACD71702.1| OstA-like protein [Brucella abortus S19]
 gi|225618352|gb|EEH15395.1| OstA-like protein [Brucella ceti str. Cudo]
 gi|237789463|gb|EEP63673.1| OstA-like protein [Brucella abortus str. 2308 A]
 gi|260676120|gb|EEX62941.1| OstA family protein [Brucella abortus bv. 6 str. 870]
 gi|261293685|gb|EEX97181.1| OstA family protein [Brucella ceti M644/93/1]
 gi|297174717|gb|EFH34064.1| hypothetical protein BAYG_00459 [Brucella abortus bv. 5 str. B3196]
          Length = 218

 Score = 70.5 bits (171), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 57  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 116

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 117 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 173

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 174 GCKLTAHLDTGRANVESCKG 193


>gi|260567206|ref|ZP_05837676.1| OstA family protein [Brucella suis bv. 4 str. 40]
 gi|261756046|ref|ZP_05999755.1| OstA family protein [Brucella suis bv. 3 str. 686]
 gi|260156724|gb|EEW91804.1| OstA family protein [Brucella suis bv. 4 str. 40]
 gi|261745799|gb|EEY33725.1| OstA family protein [Brucella suis bv. 3 str. 686]
          Length = 216

 Score = 70.5 bits (171), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 114

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|260546430|ref|ZP_05822170.1| OstA family protein [Brucella abortus NCTC 8038]
 gi|260759236|ref|ZP_05871584.1| OstA family protein [Brucella abortus bv. 4 str. 292]
 gi|260760958|ref|ZP_05873301.1| OstA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261215288|ref|ZP_05929569.1| OstA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218157|ref|ZP_05932438.1| OstA family protein [Brucella ceti M13/05/1]
 gi|261314630|ref|ZP_05953827.1| OstA family protein [Brucella pinnipedialis M163/99/10]
 gi|261316814|ref|ZP_05956011.1| OstA family protein [Brucella pinnipedialis B2/94]
 gi|261759270|ref|ZP_06002979.1| OstA family protein [Brucella sp. F5/99]
 gi|260096537|gb|EEW80413.1| OstA family protein [Brucella abortus NCTC 8038]
 gi|260669554|gb|EEX56494.1| OstA family protein [Brucella abortus bv. 4 str. 292]
 gi|260671390|gb|EEX58211.1| OstA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260916895|gb|EEX83756.1| OstA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|260923246|gb|EEX89814.1| OstA family protein [Brucella ceti M13/05/1]
 gi|261296037|gb|EEX99533.1| OstA family protein [Brucella pinnipedialis B2/94]
 gi|261303656|gb|EEY07153.1| OstA family protein [Brucella pinnipedialis M163/99/10]
 gi|261739254|gb|EEY27250.1| OstA family protein [Brucella sp. F5/99]
          Length = 216

 Score = 70.5 bits (171), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 114

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|148559284|ref|YP_001258189.1| hypothetical protein BOV_0151 [Brucella ovis ATCC 25840]
 gi|148370541|gb|ABQ60520.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 216

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 114

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|225851689|ref|YP_002731922.1| OstA-like protein [Brucella melitensis ATCC 23457]
 gi|256045948|ref|ZP_05448820.1| OstA-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112661|ref|ZP_05453582.1| OstA-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|265992358|ref|ZP_06104915.1| OstA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994101|ref|ZP_06106658.1| OstA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|225640054|gb|ACN99967.1| OstA-like protein [Brucella melitensis ATCC 23457]
 gi|262765082|gb|EEZ11003.1| OstA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|263003424|gb|EEZ15717.1| OstA family protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 204

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 43  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 102

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I  +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 103 GGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 159

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 160 GCKLTAHLDTGRANVESCKG 179


>gi|326408178|gb|ADZ65243.1| OstA-like protein [Brucella melitensis M28]
 gi|326537891|gb|ADZ86106.1| OstA-like protein [Brucella melitensis M5-90]
          Length = 218

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 57  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 116

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I  +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 117 GGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 173

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 174 GCKLTAHLDTGRANVESCKG 193


>gi|260563229|ref|ZP_05833715.1| OstA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|265999666|ref|ZP_05467330.2| OstA family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260153245|gb|EEW88337.1| OstA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|263095209|gb|EEZ18878.1| OstA family protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 216

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 114

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I  +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|17988074|ref|NP_540708.1| periplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|17983824|gb|AAL52972.1| hypothetical periplasmic protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 172

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 11  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV 70

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I  +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 71  GGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 127

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 128 GCKLTAHLDTGRANVESCKG 147


>gi|254718372|ref|ZP_05180183.1| OstA-like protein [Brucella sp. 83/13]
          Length = 204

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----------- 91
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 43  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGDEAPEPANAGV 102

Query: 92  ---VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 103 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 159

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 160 GCKLTAHLDTGRANVESCKG 179


>gi|265983333|ref|ZP_06096068.1| OstA family protein [Brucella sp. 83/13]
 gi|264661925|gb|EEZ32186.1| OstA family protein [Brucella sp. 83/13]
          Length = 218

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----------- 91
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 57  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGDEAPEPANAGV 116

Query: 92  ---VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 117 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 173

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 174 GCKLTAHLDTGRANVESCKG 193


>gi|306842557|ref|ZP_07475208.1| OstA-like protein [Brucella sp. BO2]
 gi|306287413|gb|EFM58893.1| OstA-like protein [Brucella sp. BO2]
          Length = 218

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----------- 91
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 57  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGDEAPEPANAGV 116

Query: 92  ---VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 117 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 173

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 174 GCKLTAHLDTGRANVESCKG 193


>gi|511886|gb|AAA26347.1| ORF0 [Sinorhizobium meliloti]
          Length = 127

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 6/114 (5%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEI 112
           D   KA F GNV + Q   +LQA  MT+ Y      V++    I+R++V   +F+ SG  
Sbjct: 1   DPESKAIFTGNVKVVQGTTTLQAGNMTVFYKAGGGSVTSGNADIDRIEVSNKVFLSSGAQ 60

Query: 113 NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
                +G V+   + +VL G    KV+L E  N F+GC+L V +DT  A L  C
Sbjct: 61  QATGESGIVNLTNQTIVLKGK---KVVLSEGKNVFVGCQLNVQMDTGEAQLDAC 111


>gi|306839603|ref|ZP_07472407.1| OstA-like protein [Brucella sp. NF 2653]
 gi|306405301|gb|EFM61576.1| OstA-like protein [Brucella sp. NF 2653]
          Length = 216

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----------- 91
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGDEAPEPANAGV 114

Query: 92  ---VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|306844424|ref|ZP_07477014.1| OstA-like protein [Brucella sp. BO1]
 gi|306275237|gb|EFM56987.1| OstA-like protein [Brucella sp. BO1]
          Length = 216

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----------- 91
           + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGDEAPEPANAGV 114

Query: 92  ---VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|254700965|ref|ZP_05162793.1| OstA-like protein [Brucella suis bv. 5 str. 513]
          Length = 204

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A ++T+ Y+   +            
Sbjct: 43  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQITVYYSKAKKGAEAPEPANAGV 102

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 103 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQGQ---KVVLTDGDNIVT 159

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 160 GCKLTAHLDTGRANVESCKG 179


>gi|261751483|ref|ZP_05995192.1| OstA family protein [Brucella suis bv. 5 str. 513]
 gi|261741236|gb|EEY29162.1| OstA family protein [Brucella suis bv. 5 str. 513]
          Length = 216

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           + + I AD LE++D    A F GNV ++Q D  L+A ++T+ Y+   +            
Sbjct: 55  DPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQITVYYSKAKKGAEAPEPANAGV 114

Query: 93  ----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               S+ I+ +D+   ++++SG        G  D + +I+VL G    KV+L +  N   
Sbjct: 115 GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQGQ---KVVLTDGDNIVT 171

Query: 149 GCKLIVNIDTSFASLQGCES 168
           GCKL  ++DT  A+++ C+ 
Sbjct: 172 GCKLTAHLDTGRANVESCKG 191


>gi|222084665|ref|YP_002543194.1| cell envelope biogenesis protein YhbN [Agrobacterium radiobacter
           K84]
 gi|221722113|gb|ACM25269.1| cell envelope biogenesis protein YhbN [Agrobacterium radiobacter
           K84]
          Length = 222

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 73/169 (43%), Gaps = 29/169 (17%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           AD      S M    +  ++ I I++D LE+ DA  +A F GNV + Q   ++QA KMT+
Sbjct: 34  ADAQTTTTSKMPGLALSSDQPIQIESDKLEIHDAESQAVFTGNVKVVQGTTTMQAGKMTV 93

Query: 84  DY--------NNTNRDVSNKINRMDVERNIFIQSGEINV------------------IAS 117
            Y                N + +   E+N  + SG+ N+                   A 
Sbjct: 94  FYKKKQPAADAAAKPATDNPVAKAAKEQNQSLVSGDANIDHILVTNKVYLVSGTQTATAD 153

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           +G  D   ++ VL G    KV+L +  N F GC+L V++ T  A L  C
Sbjct: 154 DGSFDMANQLAVLKG---QKVVLTDGPNVFTGCQLTVHMATGEAQLDAC 199


>gi|328545551|ref|YP_004305660.1| OstA-like protein [polymorphum gilvum SL003B-26A1]
 gi|326415292|gb|ADZ72355.1| OstA-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 178

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 78/154 (50%), Gaps = 7/154 (4%)

Query: 29  AAASYMTRFKVLGN---EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           A  ++   F   G+   E I I+A  L+V+D    A F G+V ++Q D  L+  ++ + Y
Sbjct: 23  AGQTFSNAFAGFGSNDKEPIQIEARELQVEDKTNSATFVGDVVVSQGDTRLKTQRLRVFY 82

Query: 86  NN-TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
           +      V  +I R++    ++I S +      +   D  ++++V+ G    +V+L +  
Sbjct: 83  DGKAAGGVQQRITRLEASGRVYISSKDQTATGDDASFDMNRKVMVMTG---QEVVLSQGP 139

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           N  +G +L +N+DT  A L+   S +V+ +I+ +
Sbjct: 140 NVVVGNRLTINLDTGKADLEAPRSGRVKVLIQPN 173


>gi|319898207|ref|YP_004158300.1| hypothetical protein BARCL_0016 [Bartonella clarridgeiae 73]
 gi|319402171|emb|CBI75697.1| conserved exported protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 215

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 85/174 (48%), Gaps = 19/174 (10%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++ +L L   +L +    A  ++     + G E + I AD LE++D    A   GNV + 
Sbjct: 26  WVSILVLSMAILGSVNGYARVTHFGIDGLNGKEPMEIHADSLEIRDKEGIAILNGNVSVM 85

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF---IQSGEINVIASNGYVDFQKRI 127
           Q +  L+  K+ I YN  +  V+N IN++ + +++F   I S +I  + ++G V  +   
Sbjct: 86  QSERLLRTSKLVIYYNKAH--VTNDINQL-ITKSVFSGKIGSTDIKKVEASGEVYIKMAT 142

Query: 128 LVLNGDRA-------------DKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
             + GD+A             + V+L +  N   GC L  N+ T  ASL+GC++
Sbjct: 143 QTVTGDKAIFDGQSNMIILTGNNVVLTDGDNVATGCTLTANMKTGKASLEGCKT 196


>gi|254470648|ref|ZP_05084051.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
 gi|211959790|gb|EEA94987.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
          Length = 169

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 71/128 (55%), Gaps = 10/128 (7%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN----NTNRD---VSNK 95
           E I I+A  L+V+D  + A F GNV +TQ +  L+A ++ + Y+    N N D   V   
Sbjct: 20  EPIEIEATNLQVRDKDKSAIFSGNVVVTQGEAKLEAQRLIVFYSGSMANGNADGQPVQQS 79

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
           I+R++ + ++ + S +      +   D +K+I+V+ G R   V L +  N  +G +L++N
Sbjct: 80  ISRLEAKGDVLVSSKDQVATGDDASFDMEKQIVVMTGKR---VTLSQGPNVIVGKRLVIN 136

Query: 156 IDTSFASL 163
           ++T  A+L
Sbjct: 137 LETGKANL 144


>gi|319407890|emb|CBI81542.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 199

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV-SNK------ 95
           E I + AD LE++D  + A F GNV + Q +  +Q  ++ + Y+ T++ +  NK      
Sbjct: 45  EPIELHADSLEIRDKEEIAVFSGNVSIVQGERLMQTSQLIVYYDKTHKTIDENKKNIEST 104

Query: 96  ---------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                    I +M+    ++I+          G  D Q   ++L G   +KV+LK+  N 
Sbjct: 105 SPVGFDVTGIKKMEALGKVYIKIATQIATGDKGIFDRQSNRMILTG---NKVVLKDNNNV 161

Query: 147 FLGCKLIVNIDTSFASLQGCES 168
             GCKL V++++  A L+GC++
Sbjct: 162 ATGCKLTVHMESGKAFLEGCQA 183


>gi|114706452|ref|ZP_01439354.1| hypothetical protein FP2506_01670 [Fulvimarina pelagi HTCC2506]
 gi|114538313|gb|EAU41435.1| hypothetical protein FP2506_01670 [Fulvimarina pelagi HTCC2506]
          Length = 202

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 78/185 (42%), Gaps = 20/185 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVL---GNEKIHIKADMLEVKDA 57
           M+  L +  L   L+A   V+L   +          F  L   G++ I I++  L+V D 
Sbjct: 1   MNMRLPTAALSASLIAGTAVMLSFPVYAQQGGLGNNFNGLQLDGDQPISIESSTLDVDDK 60

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV-------------SNKINRMDVERN 104
              A F GNV + Q    L+  K+ + YNN+                 S+ I R++    
Sbjct: 61  AAIATFTGNVSVAQGPTQLRTGKLVVHYNNSGSGQSGASSGSSALPGGSSSIERLEASEK 120

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           ++++S +    A     D    ++V+ GD    V+L +  N   GC+L + +DT  A L+
Sbjct: 121 VYVKSEDQVATAERASFDMASNVVVMTGD----VVLSQGENVAEGCRLTIQMDTGQARLE 176

Query: 165 GCESD 169
               D
Sbjct: 177 STNCD 181


>gi|121602088|ref|YP_989616.1| OstA family protein [Bartonella bacilliformis KC583]
 gi|120614265|gb|ABM44866.1| OstA family protein [Bartonella bacilliformis KC583]
          Length = 200

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 79/176 (44%), Gaps = 21/176 (11%)

Query: 15  LALVFVLLK-ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L L   LLK   L  A  ++M      G + I + +D LE+ +    A F  NV + Q +
Sbjct: 15  LILSIGLLKWGGLGHAEVAHMGIDLSNGEKPIELYSDSLEIHEKKGIAIFNDNVSIVQGE 74

Query: 74  FSLQADKMTIDYNNTNRDVS----------------NKINRMDVERNIFIQSGEINVIAS 117
             LQ  K+ + Y+  ++ V                   + +M+   N++I+     +   
Sbjct: 75  RLLQTSKLVVYYDQDHQTVGINEVRKKSRLFVGSGLTGVKKMEALGNVYIKIATQIITGD 134

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
            G  D +  ++ L G+    V+LK+  N   GCKL +N+ T  A L+GCE+ + +S
Sbjct: 135 KGIFDGKSNVVTLTGN----VVLKDGRNVATGCKLTINMKTGKALLEGCEASEKKS 186


>gi|163867321|ref|YP_001608515.1| hypothetical protein Btr_0016 [Bartonella tribocorum CIP 105476]
 gi|161016962|emb|CAK00520.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 215

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 68/142 (47%), Gaps = 19/142 (13%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           E + + AD LE++D    A FKG+V + Q +  L+  K+ + Y+  +++           
Sbjct: 58  EPVELHADSLEIRDKEGIALFKGDVSVMQGERLLRTAKLVVYYDKAHKETDKNKEDTKAS 117

Query: 93  ------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 S+ I +M+    ++I+          G  D + +++ L G     V+LK+  N 
Sbjct: 118 SVALLGSSGIKKMEAVGKVYIKIATQIATGDKGVFDGKSKMMSLTGKH---VVLKDGDNV 174

Query: 147 FLGCKLIVNIDTSFASLQGCES 168
             GCKL  N+++  A L+GCE+
Sbjct: 175 ATGCKLTANMESGKAFLEGCET 196


>gi|307943002|ref|ZP_07658347.1| OstA family protein [Roseibium sp. TrichSKD4]
 gi|307773798|gb|EFO33014.1| OstA family protein [Roseibium sp. TrichSKD4]
          Length = 183

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (48%), Gaps = 21/183 (11%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---NEKIHIKADMLEVKDAVQKAF 62
           N+++  + ++  +  L  A +S  A ++   F+  G   ++ I I+A  L+V+D    A 
Sbjct: 3   NTLYRLMGIVVTLGALAIAPVS--AQTFSNAFEGFGSNDDDPIQIEASELQVEDKNNLAI 60

Query: 63  FKGNVFMTQEDFSLQADKMTIDYN---------NTNRDVSNKINRMDVERNIFIQSGEIN 113
           F GNV +TQ +  L+  ++ + Y+            RD+S    R++    +FI S    
Sbjct: 61  FTGNVVVTQGEAQLKTHRLKVFYDGQGGGAGTGTGQRDIS----RLEASGRVFISSEGQT 116

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
                   D ++ I+V+ G    +V+L +  N  +G KL VN+ T  A LQ  +S +V+ 
Sbjct: 117 ATGDEASFDMKRDIMVMTG---KEVVLSQGPNVVVGNKLTVNLVTGQADLQAPKSGRVKV 173

Query: 174 IIR 176
           +I+
Sbjct: 174 LIK 176


>gi|240849697|ref|YP_002971085.1| OstA family protein [Bartonella grahamii as4aup]
 gi|240266820|gb|ACS50408.1| OstA family protein [Bartonella grahamii as4aup]
          Length = 199

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           E + + AD LE++D    A FKG+V + Q +  L+  K+ + Y+   +++          
Sbjct: 42  EPVELHADSLEIRDKEGIALFKGDVSVVQGERLLRTAKLVVYYDKAYKEIDKNKEDTKAS 101

Query: 93  ------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 S+ I +M+    ++I+          G  D + +++ L G     V+L +  N 
Sbjct: 102 SVSLFGSSGIQKMEALGKVYIKIATQIATGDKGVFDGKSKMMSLTGSH---VVLTDGDNV 158

Query: 147 FLGCKLIVNIDTSFASLQGCESDQ 170
             GCKL  N+++  A L+GCE+ +
Sbjct: 159 ATGCKLTANMESGKAFLEGCETPK 182


>gi|119385333|ref|YP_916389.1| OstA family protein [Paracoccus denitrificans PD1222]
 gi|119375100|gb|ABL70693.1| OstA family protein [Paracoccus denitrificans PD1222]
          Length = 161

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 74/155 (47%), Gaps = 16/155 (10%)

Query: 29  AAASYMTRFKVLGN-----EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           AA + + +    GN     + + + AD L V     +A F GNV + Q    L AD +T+
Sbjct: 17  AAGAALGQTAGFGNAQDIKQPVEVTADALTVDQKTGRATFSGNVLIGQGAMRLSADSVTV 76

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            Y   ++    +I+ +  E N+ + SGE    A     D +   +VL GD    V+L + 
Sbjct: 77  TYAQGDQ---RRISALHAEGNVTLASGEDAAEAQAADYDVETGTIVLTGD----VLLTQG 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            N   G K+ VN+++  A+  G    +V+S+++ +
Sbjct: 130 GNLLAGDKVTVNLESGTANASG----RVRSVLQPE 160


>gi|319404928|emb|CBI78528.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 199

 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 81/172 (47%), Gaps = 19/172 (11%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + +LAL   +L +    AA ++     + G E + + AD LE++D    A   GNV + Q
Sbjct: 11  VSILALSLAILGSINGYAAVTHFGFDGLNGKEPMELYADSLEIRDKEGIAILNGNVSVMQ 70

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF---IQSGEINVIASNGYVDFQKRIL 128
            +  LQ  K+ I YN  +  ++  IN++  + +IF   I S +I  + + G V  +    
Sbjct: 71  GERLLQTSKLAIYYNKAH--ITGGINQLRTQ-SIFPEKIGSTDIKKVEALGEVYIKVATQ 127

Query: 129 VLNGDRA-------------DKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
              GD+A             + V+L +  N   GC L  N+ T  ASL+GC+
Sbjct: 128 TAKGDKAIFDGQSNMIILTGNNVVLTDGDNVAEGCILTANMKTGKASLEGCK 179


>gi|90420563|ref|ZP_01228470.1| possible OstA family protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90335291|gb|EAS49044.1| possible OstA family protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 205

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 66/140 (47%), Gaps = 16/140 (11%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN--------- 87
            +V G++ I I+++ L V DA   A F GNV + Q +  L+  ++ + Y           
Sbjct: 44  LQVDGDQPISIESNQLVVDDAKAVATFTGNVQVEQGETELRTGRLVVTYKKDETGGSQPA 103

Query: 88  ---TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                   SN+I R++    ++++S +    A     D   +++V+ G+    V+L +  
Sbjct: 104 GGGGLPGGSNQIERLEASEKVYVKSADQVATADQADFDMGTQVVVMRGN----VVLTQGQ 159

Query: 145 NTFLGCKLIVNIDTSFASLQ 164
           N   GC+L + +DT  A L+
Sbjct: 160 NVAEGCRLTIQMDTGLARLE 179


>gi|319406418|emb|CBI80058.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 199

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 19/175 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL L   +L +    AA ++     + G E + + AD LE++D    A F G+V + Q
Sbjct: 11  VSLLTLSLAILGSINGYAAVTHFGIDGLNGQEPMELYADSLEIRDKEGIAVFNGDVSVMQ 70

Query: 72  EDFSLQADKMTIDYN--------NTNRDVS---NKINRMDVER-----NIFIQSGEINVI 115
            +  L+  K+ I YN        N  R  S    KI   D+++      ++I+  +    
Sbjct: 71  GERLLRTSKLVIYYNKAHITGGINQLRRQSIFPEKIGSTDIQKVEALGEVYIKMAKQTAT 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC++ +
Sbjct: 131 GDKAIFDGQSNMIILTGNN---VVLTDGDNVAQGCILTANMKTGKASLEGCKTPR 182


>gi|218672973|ref|ZP_03522642.1| hypothetical protein RetlG_15785 [Rhizobium etli GR56]
          Length = 154

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 20/127 (15%)

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNN---------------TNRDVSNKINRMDVER- 103
              F GNV + Q   ++Q+ KMT+ Y +                 +  S      D+++ 
Sbjct: 6   PPLFTGNVKVVQGTTTMQSGKMTVYYKDKAAKPGADGAQPAAQPEKSASLASGSADIDKI 65

Query: 104 ----NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
                + + SG     A +G  D   +   L  D+ +KVIL +  N F GCKL V++ T 
Sbjct: 66  LVTDKVLLTSGTQTATADDGNFDMASQTFTLTADQGNKVILSDGPNVFTGCKLTVHMQTG 125

Query: 160 FASLQGC 166
            A L+ C
Sbjct: 126 QAELESC 132


>gi|319403504|emb|CBI77083.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 199

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 79/173 (45%), Gaps = 19/173 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL L   +L +    AA ++     + G E + + AD LE++D    A F G+V + Q
Sbjct: 11  VSLLTLSLAILGSINGYAAVTHFGIDGLNGQEPMELYADSLEIRDKEGIAVFNGDVSVMQ 70

Query: 72  EDFSLQADKMTIDYN--------NTNRDVS---NKINRMDVER-----NIFIQSGEINVI 115
            +  L+  K+ I YN        N  R  S    KI   D+++      ++I+  +    
Sbjct: 71  GERLLRTSKLVIYYNKAHITGGINQLRKQSIFPEKIGSTDIQKVEALGEVYIKMAKQTAT 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC++
Sbjct: 131 GDKAIFDGQSNMIILTGNN---VVLTDGDNVAQGCILTANMKTGKASLEGCKT 180


>gi|304392224|ref|ZP_07374166.1| OstA family protein [Ahrensia sp. R2A130]
 gi|303296453|gb|EFL90811.1| OstA family protein [Ahrensia sp. R2A130]
          Length = 174

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 7/141 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q + +    F+  G + I I+AD LEV D   KA F GNV + Q   ++   K+ + Y  
Sbjct: 22  QVSGAAFDGFRSNGKDPIQIEADSLEVLDEQNKAVFNGNVVVVQGKSTMTTSKLIVTYGA 81

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNG-YVDFQKRILVLNGDRADKVILKEKL-N 145
             +     + ++++   +   S E  V A  G Y+   ++I  L G    KV++ +   N
Sbjct: 82  GGQGTQRDVQKLEMFEGLVATSEENTVTADKGIYITATEQI-TLTG----KVVVSQGADN 136

Query: 146 TFLGCKLIVNIDTSFASLQGC 166
              GCKL+ N++ + A +  C
Sbjct: 137 VATGCKLVANLNNNQARMTAC 157


>gi|118589457|ref|ZP_01546863.1| hypothetical protein SIAM614_07928 [Stappia aggregata IAM 12614]
 gi|118438157|gb|EAV44792.1| hypothetical protein SIAM614_07928 [Stappia aggregata IAM 12614]
          Length = 192

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD------VSNKI 96
           E I I+A  L V+D    A F G+V +TQ + SL+  ++ + Y  +  +      V  +I
Sbjct: 38  EPIEIEASELRVEDNNNTATFVGDVLVTQGETSLKTQRLKVYYVGSGAEKTEDSAVQQRI 97

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
           ++++ E  +FI S +          D  K ++V+ G    +V+L +  N  +G KL VN+
Sbjct: 98  SKLEAEGGVFITSKDQTAKGDEASFDMNKEVMVMTG---REVVLSQGPNVVVGNKLTVNL 154

Query: 157 DTSFASL 163
            T  A+L
Sbjct: 155 KTGKANL 161


>gi|332187941|ref|ZP_08389674.1| ostA-like family protein [Sphingomonas sp. S17]
 gi|332012102|gb|EGI54174.1| ostA-like family protein [Sphingomonas sp. S17]
          Length = 172

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 11/147 (7%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +A V ++L A     +A   TR        I   AD +E++D   +A   GNV + Q + 
Sbjct: 1   MAPVLIVLAA-----SAPAQTRHN--SRAPIDFGADHIELQDKANRAVLSGNVAVRQAEM 53

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           +L A +MT+ Y       + +++R+D    + ++  +    +     D  +R++ + G+ 
Sbjct: 54  TLNAARMTVAYTGQVIGGNPQVSRLDASGGVVVKRPDQTARSQYAIYDLNRRVITMLGN- 112

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFA 161
              V L +  NT  G +L +N+DT  A
Sbjct: 113 ---VSLTQGGNTVNGGRLTINLDTGRA 136


>gi|158425551|ref|YP_001526843.1| hypothetical protein AZC_3927 [Azorhizobium caulinodans ORS 571]
 gi|158332440|dbj|BAF89925.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 17/139 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--------- 92
           +E I I +D LEVKD  ++A F G V + Q D +L   ++ + Y+    DV         
Sbjct: 44  DEPIRINSDTLEVKDKEKQATFSGKVVVVQGDTTLHCPQLVVYYDG---DVAAGVQGGAP 100

Query: 93  --SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
             S+KI +++    + +Q+ +       G  + +   + L G     V+L +  N   G 
Sbjct: 101 SDSSKIRKLEALGGVVVQTKDQTATGDTGVFEMKTNTVTLTG---KPVVLTQGPNVVRGQ 157

Query: 151 KLIVNIDTSFASLQGCESD 169
           KL+V++ T  +  +G   D
Sbjct: 158 KLVVDLTTGVSKFEGGRVD 176


>gi|110635994|ref|YP_676202.1| OstA-like protein [Mesorhizobium sp. BNC1]
 gi|110286978|gb|ABG65037.1| OstA-like protein [Chelativorans sp. BNC1]
          Length = 186

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 74/169 (43%), Gaps = 8/169 (4%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKA 61
            +  +H     + L+ +     L+Q + S  ++  +    +E I I    +EV      A
Sbjct: 1   MMGRVHGLAFAMGLLMLWPAGGLAQTSESRPSQLGLNLSSDEPIQIDGARVEVDQTQNLA 60

Query: 62  FFKGNVFMTQEDFSLQADKMTIDY-NNTNRDVSNKIN--RMDVERNIFIQSGEINVIASN 118
              G+V + Q    L+  ++ I Y   +    S   N  R++ +  ++++S         
Sbjct: 61  TLTGDVQVVQGPTLLKTARLKIFYAEGSGLPTSGAANIKRLEADGGVYVKSETQVATGDQ 120

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
           G  D    +LVL+G    +V+L E  N  +GCKL V + T  A+L+ C+
Sbjct: 121 GTFDMGTEVLVLSGK---EVVLTEGENVIVGCKLTVQMKTGQATLESCK 166


>gi|87201261|ref|YP_498518.1| OstA-like protein [Novosphingobium aromaticivorans DSM 12444]
 gi|87136942|gb|ABD27684.1| OstA-like protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 184

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  ++  AD +EV+D  ++    GNV ++Q D  ++A + T+ Y++T    +  I R+D 
Sbjct: 44  NAPVNYAADRIEVQDKAKRVVLSGNVDISQSDLRMRAARTTVAYSDTG---NIDIERIDA 100

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + +  G  +        DF + I+ + G+    V L+   +T  G +L++++D+  +
Sbjct: 101 TGGVQVTRGSESARGDVAVYDFNRNIITMTGN----VALRRGGDTLNGGRLVIDLDSGLS 156

Query: 162 SL 163
           S+
Sbjct: 157 SV 158


>gi|148555813|ref|YP_001263395.1| OstA family protein [Sphingomonas wittichii RW1]
 gi|148501003|gb|ABQ69257.1| OstA family protein [Sphingomonas wittichii RW1]
          Length = 173

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           +  +   AD +E++D V +A   GNV + Q D  L++ ++TI Y +       ++ RMD 
Sbjct: 36  SAPVDFAADRIELQDRVDRAVLTGNVDVKQGDMRLRSARLTIAYTSA---AQTEVTRMDA 92

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + + +   N  +     D + R++ + G   D VI++       G +L++N+++  A
Sbjct: 93  SGGVVLTTSTENARSQYAIYDLRTRLVTMIG---DVVIVRAGKGETRGNRLVLNLNSGAA 149

Query: 162 SLQ 164
           SL+
Sbjct: 150 SLE 152


>gi|163745217|ref|ZP_02152577.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
 gi|161382035|gb|EDQ06444.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
          Length = 164

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 74/160 (46%), Gaps = 13/160 (8%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---KIHIKADMLEVKDAVQKAFFKG 65
           HL+I +L L+F L  A ++  A S    F  L  +    + + AD L V +A   A F G
Sbjct: 3   HLFILMLPLLFALQAAPVT--AQSANVAFGALEQDTSLPVEVTADNLSVDNASGTAIFTG 60

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
           NV ++Q + +L A K+ + Y    R     I +++    + + +GE    +     D   
Sbjct: 61  NVLISQGEMTLSAGKVQVIY----RAEDQGIAKLEATGGVVLVAGEDAAESQRADYDIDA 116

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
             LV++GD    V++ +  +     ++ VN++   A + G
Sbjct: 117 GTLVMSGD----VLMTQGPSALSAQEMTVNLNDGTAQMSG 152


>gi|103487822|ref|YP_617383.1| OstA-like protein [Sphingopyxis alaskensis RB2256]
 gi|98977899|gb|ABF54050.1| OstA-like protein [Sphingopyxis alaskensis RB2256]
          Length = 191

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 61/124 (49%), Gaps = 7/124 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  +   A  +EV+D   +    GNV +TQ    + A +MT+ Y    R     +NR+D 
Sbjct: 44  NAPVDFAAGSIEVQDRADRVVLAGNVRVTQAGLVVTAPRMTVAY---TRAGGTDVNRLDA 100

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + +  G+ +   +    D  +R++ + G+    V L+++ N   G +L++++++  A
Sbjct: 101 TGGVTVVKGDESARGNVAIYDLDRRLITMVGN----VELRQRGNNLRGGRLVIDLNSGRA 156

Query: 162 SLQG 165
           ++ G
Sbjct: 157 TVDG 160


>gi|49473702|ref|YP_031744.1| hypothetical protein BQ00150 [Bartonella quintana str. Toulouse]
 gi|49239205|emb|CAF25522.1| hypothetical protein BQ00150 [Bartonella quintana str. Toulouse]
          Length = 192

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 19/142 (13%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT----NRD------- 91
           E + + AD LE++D    A F G+V + Q +  L+  K+ + Y+ T    +RD       
Sbjct: 35  EPVELYADSLEIRDKEGIALFNGDVSVVQGECLLRTAKLVVYYDKTQKVADRDRVDTKAE 94

Query: 92  -----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 S  I +M+    ++I+          G  D + +++ L G     V+L +  N 
Sbjct: 95  SHARFGSTGIKKMEALGKVYIKIATQIATGDKGVFDGESKMMSLTGRN---VVLTDGDNV 151

Query: 147 FLGCKLIVNIDTSFASLQGCES 168
             GCKL  ++++  A L+GCE+
Sbjct: 152 ATGCKLTADMESGKAFLEGCET 173


>gi|114764078|ref|ZP_01443317.1| hypothetical protein 1100011001333_R2601_15507 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543436|gb|EAU46451.1| hypothetical protein R2601_15507 [Roseovarius sp. HTCC2601]
          Length = 165

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 72/155 (46%), Gaps = 8/155 (5%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++ + A++F L    L+Q A       +   +  + + AD L+V  +   A + GNV + 
Sbjct: 4   FLTIAAMLFALSGPALAQGAQVAFGGMQQDTSAPVEVSADQLQVNQSDGTALYTGNVVIG 63

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L A ++ + ++    +  N+I R++    + + SGE    +     D  +  +V+
Sbjct: 64  QGEMRLAAPRVLVVFD----EAGNRIARLEATGGVTLVSGEEAAESERADYDIDEGTVVM 119

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
            G+    V+L +  N     +++VN++   A + G
Sbjct: 120 TGN----VLLTQGPNALTSERMVVNLEGGTAQMTG 150


>gi|154250650|ref|YP_001411474.1| cell envelope biogenesis YhbN [Parvibaculum lavamentivorans DS-1]
 gi|154154600|gb|ABS61817.1| Cell envelope biogenesis YhbN [Parvibaculum lavamentivorans DS-1]
          Length = 197

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 4/125 (3%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
           F+   ++ I ++AD LEV+D    A F GNV + Q +  ++AD++ + Y   + + S  I
Sbjct: 49  FRTDPDKPIEVEADSLEVEDTKSTATFIGNVRVAQGEIRMKADRIVVFYAPRSSNGSG-I 107

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
            R+    N+F+ S +    AS  + ++   I     +  D V+L++  N   G KL V++
Sbjct: 108 ERLRATGNVFVSSPD-EQSASGEWANYL--IATREIEMGDAVVLRQGENVIRGAKLFVDL 164

Query: 157 DTSFA 161
           ++  A
Sbjct: 165 NSGRA 169


>gi|85709985|ref|ZP_01041050.1| hypothetical protein NAP1_13908 [Erythrobacter sp. NAP1]
 gi|85688695|gb|EAQ28699.1| hypothetical protein NAP1_13908 [Erythrobacter sp. NAP1]
          Length = 183

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 72/171 (42%), Gaps = 17/171 (9%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L + L+A   + L A   Q  AS+ TR        +   A  +   D   +    G V +
Sbjct: 20  LALGLVAAGGMTLSA---QGIASHNTR------APVSFDAGNIAFDDRANRVVLTGGVTV 70

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
            Q    +++ +M   Y +   D S  + R+    N+ +  G           DF +RI+ 
Sbjct: 71  DQAGLRVRSQRMLASYTD---DGSLDVQRITANGNVVVTRGNERASGDVAVYDFNRRIIT 127

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           + G+    V L+   +T  G +L++N+DT  +++ G  S   Q+    DGR
Sbjct: 128 MAGN----VSLRRGTDTLNGGRLVINLDTGLSTMDGRAS-GAQTTTNSDGR 173


>gi|308274285|emb|CBX30884.1| hypothetical protein N47_E43960 [uncultured Desulfobacterium sp.]
          Length = 543

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 79/170 (46%), Gaps = 10/170 (5%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
            Y  +++ + V L   LS A+A          +EKIHI AD L      + A F GNV  
Sbjct: 5   WYYSIISFLMVFL--ILSVASAEDTASLNAESSEKIHITADSLISDSNAKFAEFIGNVEA 62

Query: 70  TQEDFSLQADKMTIDYNNTNRD-----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
            Q +F + +DK+ I Y    +D      S+ I ++    N+FI+S +++ +      +  
Sbjct: 63  IQGEFVINSDKLKIFYKGDAKDKAASGTSDSIEKIIATGNVFIKSKDMSAVTQQAQYNTD 122

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSI 174
             I+ L G+   KV   ++ N   G K+I+        ++G +S +V ++
Sbjct: 123 TMIITLTGE-GSKVF--DQKNFVTGSKIILYRKEGVTKVEGDKSKRVTAV 169


>gi|298290363|ref|YP_003692302.1| OstA family protein [Starkeya novella DSM 506]
 gi|296926874|gb|ADH87683.1| OstA family protein [Starkeya novella DSM 506]
          Length = 228

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 80/189 (42%), Gaps = 26/189 (13%)

Query: 7   SIHLYIHLLALVFVLLKADLSQA--AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
            + L +   A +  L +  L+QA    + +  F    +E I I A+ LEV+D  ++A F 
Sbjct: 12  GLALLVTGAACLGPLARPALAQARNVPNALQGFAANRDEPIRINANSLEVRDQQKQAVFT 71

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDV------------------SNKINRMDVERNIF 106
           GNV + Q D +L+  ++ + Y+                        S+ I R+++  ++ 
Sbjct: 72  GNVVVIQGDTTLRCKELVVYYDGKESGGKAGAPASSEALASGSPINSSAIRRLEINGSVV 131

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           + + E       G  +     + LNG     V+L    N   G KL V++ +  +   G 
Sbjct: 132 VTTKEQTATGDYGTFETASNTITLNG---SPVVLTSGPNVIRGKKLTVDLASGMSRFDG- 187

Query: 167 ESDQVQSII 175
              +++S+I
Sbjct: 188 --GRIESLI 194


>gi|254503827|ref|ZP_05115978.1| OstA-like protein [Labrenzia alexandrii DFL-11]
 gi|222439898|gb|EEE46577.1| OstA-like protein [Labrenzia alexandrii DFL-11]
          Length = 193

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 74/156 (47%), Gaps = 18/156 (11%)

Query: 29  AAASYMTRFKVLGN---EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           +A ++   F   G+   + I I+++ L+V+D  + A F G+V + Q D  L+  ++ + Y
Sbjct: 24  SAQTFSDSFAGFGSSDGQPIEIESNELKVEDQTKVATFIGDVVVIQGDTRLETSQLKVFY 83

Query: 86  NNTNR-----DVSN-------KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           +   +     D SN       +I+R++    + I S +          D +  ++V+ G 
Sbjct: 84  DGDGQSSEGADTSNGAVPAQQEISRLEASGGVHISSEDQTATGDEANFDMKTEVMVMTG- 142

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
              +V+LK+  N  +G +L VN+ T  A+L     D
Sbjct: 143 --KEVVLKQGGNVVVGNRLTVNLKTGQANLNAPADD 176


>gi|326388614|ref|ZP_08210207.1| hypothetical protein Y88_3015 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206865|gb|EGD57689.1| hypothetical protein Y88_3015 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 210

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 63/122 (51%), Gaps = 6/122 (4%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            +   AD +E++D  ++    GNV +TQE+  L+AD+  + Y + ++     + R++   
Sbjct: 50  PVDFSADHMELQDKQKRVLLTGNVDITQEELRLKADRTLMTYTDNDKLT---LQRIEATG 106

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+ +   +          DF ++I+ + G  A   + + + +T  G +L+++++T  +S+
Sbjct: 107 NVVVTRQDERAAGDVAVYDFNRKIITMVGHVA---LRRAQGDTLNGGRLVIDLNTGISSI 163

Query: 164 QG 165
            G
Sbjct: 164 DG 165


>gi|159046126|ref|YP_001534920.1| OstA family protein [Dinoroseobacter shibae DFL 12]
 gi|157913886|gb|ABV95319.1| OstA family protein [Dinoroseobacter shibae DFL 12]
          Length = 170

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 4/122 (3%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I AD L V      A F GNV +TQ    L+AD++T+ Y+  +   +++I  +  E 
Sbjct: 44  PVEIDADSLSVNQQNGSAVFSGNVQVTQGALRLEADEVTVSYDPGSDTTASEIREVRAEG 103

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+ + SG     + +         + L+GD    V+L +      G  L+V++ T    +
Sbjct: 104 NVLMVSGPDAAESQSAVYTPASNEIRLSGD----VLLSQGPVVIAGDALVVDLLTGIGEM 159

Query: 164 QG 165
           +G
Sbjct: 160 EG 161


>gi|49474847|ref|YP_032888.1| hypothetical protein BH00160 [Bartonella henselae str. Houston-1]
 gi|49237652|emb|CAF26832.1| hypothetical protein BH00160 [Bartonella henselae str. Houston-1]
          Length = 192

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 64/144 (44%), Gaps = 19/144 (13%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV---------- 92
           E + + A+ LE++D    A F G+V + Q +  L+  K+ + Y+ T ++           
Sbjct: 35  EPVELYANSLEIRDKEGIALFNGDVSVIQGEHLLRTAKLVVYYDKTRKEADKNQGNTKTA 94

Query: 93  ------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 S  I +M+    ++I+          G  D + +++ L G     V+L    N 
Sbjct: 95  LSTWFGSTGIKKMEALGKVYIKIATQIATGDKGVYDGKSKMMSLTGKN---VVLTNGDNV 151

Query: 147 FLGCKLIVNIDTSFASLQGCESDQ 170
             GCKL  ++ +  A L+GC++ +
Sbjct: 152 ATGCKLTADMKSGKAFLEGCKTSE 175


>gi|294013114|ref|YP_003546574.1| OstA-like protein [Sphingobium japonicum UT26S]
 gi|292676444|dbj|BAI97962.1| OstA-like protein [Sphingobium japonicum UT26S]
          Length = 183

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 61/126 (48%), Gaps = 8/126 (6%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN----KIN 97
           N  ++  AD +EV+D   +    GNV +TQ   +L A +MT+ Y N     +     +I+
Sbjct: 31  NAPVNFTADRIEVQDRADRVVVSGNVEVTQAGMTLNAARMTVAYRNQPGGGTGPGGVEID 90

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R+D   N+ ++  +     +    D   R++ + G+    V L +  N   G +L++++ 
Sbjct: 91  RIDASGNVVVRKADQTAKGNVAIYDLNSRLITMLGN----VSLTQGANRLTGGRLVIDLT 146

Query: 158 TSFASL 163
           +  +++
Sbjct: 147 SGRSTV 152


>gi|126738423|ref|ZP_01754128.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
 gi|126720222|gb|EBA16928.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
          Length = 154

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 63/148 (42%), Gaps = 5/148 (3%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +F L  +  +Q A+      K   ++ + + +D L V  A   A F GNV + Q    L 
Sbjct: 1   MFWLTASAWAQNASVAFGSVKADPSQPVEVTSDALAVNQANGSAEFNGNVVIVQGVMRLS 60

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           ADK+ + Y  T+      I R++   N+ + SG     A           +VL G+    
Sbjct: 61  ADKVLVIY-KTDESGKRGIERLEATGNVLLVSGPDAAEAQKADYSIDSGTIVLTGN---- 115

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQG 165
           V+L +   T    +L VN+ T  A + G
Sbjct: 116 VLLNQGAGTLTSQRLEVNLTTGTAKMAG 143


>gi|94495609|ref|ZP_01302189.1| OstA-like protein [Sphingomonas sp. SKA58]
 gi|94424997|gb|EAT10018.1| OstA-like protein [Sphingomonas sp. SKA58]
          Length = 187

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 6/129 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRM 99
           N  ++  AD +EV+D   +    GNV +TQ   +L A +MT+ Y N     +N  +I+R+
Sbjct: 38  NAPVNFTADRIEVQDRADRVVVSGNVVVTQAGMTLNAARMTVAYRNQPGGGANGVEIDRI 97

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
           D   N+ +  G+     +    D   +++ + G+    V L +  N   G +L++++++ 
Sbjct: 98  DASGNVVVTKGDQTARGNVAIYDLNAKLITMLGN----VALTQGANRLTGGRLVMDLNSG 153

Query: 160 FASLQGCES 168
            +++ G  S
Sbjct: 154 RSTVDGRSS 162


>gi|307293722|ref|ZP_07573566.1| OstA family protein [Sphingobium chlorophenolicum L-1]
 gi|306879873|gb|EFN11090.1| OstA family protein [Sphingobium chlorophenolicum L-1]
          Length = 183

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 60/126 (47%), Gaps = 8/126 (6%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN----KIN 97
           N  ++  AD +EV+D   +    G+V +TQ   +L A +MT+ Y N     +     +I+
Sbjct: 31  NAPVNFTADRIEVQDRADRVIVSGHVEVTQAGMTLNAARMTVAYRNQPGGGTGTNGVEID 90

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R+D   N+ +   +     +    D   R++ + G+    V L +  N   G +L++++ 
Sbjct: 91  RIDASGNVVVTKADQTAKGNVAIYDLNSRLITMLGN----VSLTQGTNRLTGGRLVIDLT 146

Query: 158 TSFASL 163
           +  +++
Sbjct: 147 SGRSTV 152


>gi|255020585|ref|ZP_05292648.1| OstA-like protein [Acidithiobacillus caldus ATCC 51756]
 gi|254969970|gb|EET27469.1| OstA-like protein [Acidithiobacillus caldus ATCC 51756]
          Length = 178

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 74/183 (40%), Gaps = 41/183 (22%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFM 69
           ++ LLA VF      L+ A  +       LG   IHI AD L  ++   Q+A + G V M
Sbjct: 11  FLALLAGVF------LASAQGAVAPTDAGLGKGPIHISADSLAAQNKPQQQAVYTGKVVM 64

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRM------DVERNIF-------IQSGEINVIA 116
           TQ D  + A+K+TID      +V+  +           +R+ +         SGEI    
Sbjct: 65  TQGDIVIHAEKLTIDARQGKVEVATAVGSPVTFTMSSAQRHGYGNTLVYRPGSGEI---- 120

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
                       VL G+      L +  N   G ++I ++D    S+      +VQS+  
Sbjct: 121 ------------VLTGN----AHLWQGPNEVSGQQVIYHLDDQRTSVSAAPGGRVQSVF- 163

Query: 177 YDG 179
           Y G
Sbjct: 164 YPG 166


>gi|86136832|ref|ZP_01055410.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
 gi|85826156|gb|EAQ46353.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
          Length = 168

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 69/156 (44%), Gaps = 8/156 (5%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L+I L++ ++  L A     A       K   +  + + +D L V  A   A F G+V +
Sbjct: 7   LFIFLISTLWFTLPAAAQNVA---FGAVKADPSLPVEVTSDALSVNQADGSAEFTGSVLI 63

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
            Q    L AD++ + Y  T+      I+R++   ++ + SG     A        +  +V
Sbjct: 64  VQGVMKLSADRVLVIY-KTDDTGKRAIDRLEATGSVLLVSGPDAAEAQRADYTIDEGTIV 122

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
           L GD    V+L +   T    +++VN+ T  AS+ G
Sbjct: 123 LTGD----VLLNQSAGTLASQRMVVNLTTGTASMAG 154


>gi|154244024|ref|YP_001414982.1| OstA family protein [Xanthobacter autotrophicus Py2]
 gi|154158109|gb|ABS65325.1| OstA family protein [Xanthobacter autotrophicus Py2]
          Length = 230

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 69/151 (45%), Gaps = 23/151 (15%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY---------------- 85
           ++ + I AD LEV+D  + A F GNV +TQ D +L++  + + Y                
Sbjct: 63  DQPVRINADSLEVRDKDKVAVFSGNVLVTQGDTTLRSKDLMVYYEGSVAQQAGGQPAGEQ 122

Query: 86  -NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
            N  +     +I +++    + +++ E      +G  + +   + L G     V+L +  
Sbjct: 123 ANGVDPSQKGQIRKLEAVGGVVVKTKEQTATGDSGVFEMKTNTVTLVG---KPVVLTQGP 179

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           N   G KL+V++ +  +  +G    +V+S+I
Sbjct: 180 NVIRGQKLVVDLVSGVSKFEGG---RVESLI 207


>gi|149185093|ref|ZP_01863410.1| hypothetical protein ED21_18607 [Erythrobacter sp. SD-21]
 gi|148831204|gb|EDL49638.1| hypothetical protein ED21_18607 [Erythrobacter sp. SD-21]
          Length = 183

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  +   AD +E++D   +    GNV +TQ + +L A +  ++Y++     S +I R+  
Sbjct: 39  NAPVSYAADRIELQDRQNRVVLSGNVQITQAELNLNAARTIVNYSDAG---SLRIQRIIA 95

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + +  G           DF +R++ + G+    V L    +T  G +L++++ +  +
Sbjct: 96  TGGVDVSRGNERARGDTAVYDFNRRVITMAGN----VRLNRGGDTLNGGRLVIDLASGVS 151

Query: 162 SLQGCES 168
           S+ G  S
Sbjct: 152 SIDGQAS 158


>gi|332559629|ref|ZP_08413951.1| OstA family protein precursor [Rhodobacter sphaeroides WS8N]
 gi|332277341|gb|EGJ22656.1| OstA family protein precursor [Rhodobacter sphaeroides WS8N]
          Length = 158

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 12/138 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I +D L+V  A   A F GNV + Q    L A  + ++Y          I R+    
Sbjct: 33  PVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEYAPGG----GAIRRLHASG 88

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + + +G     A       +   +V+ GD    V+L +  NT  G KL++++      +
Sbjct: 89  GVTLANGSEAAEAKEAVYTIESGEVVMTGD----VLLTQGPNTLAGQKLVIDLSAGTGRM 144

Query: 164 QGCESDQVQSIIRYDGRP 181
           +G    +VQ++ +    P
Sbjct: 145 EG----RVQTVFQPGKAP 158


>gi|259417071|ref|ZP_05740990.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
 gi|259345977|gb|EEW57791.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
          Length = 165

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 69/165 (41%), Gaps = 23/165 (13%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           ++A +++  L      + F +L+ D SQ                + I +D + V      
Sbjct: 12  LTALVHTPALMAQGTGVSFGVLQTDTSQ---------------PVDITSDNMSVNQEDGS 56

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           A   G+V + Q +  L AD + +      R   N I R++   N+ + SGE    A    
Sbjct: 57  ALLTGSVLIIQGEMRLSADNVLV----VRRAEGNGIERLEARGNVLLVSGEDAAEAREAD 112

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
              +   +V+ G+    V+L ++ NT    ++ VNI T  A+L G
Sbjct: 113 YTIESGTVVMRGN----VLLTQQGNTLGAEQMTVNITTGNATLSG 153


>gi|39933128|ref|NP_945404.1| OstA-like protein [Rhodopseudomonas palustris CGA009]
 gi|39652753|emb|CAE25492.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 221

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 86/190 (45%), Gaps = 15/190 (7%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           AF ++  + +++   V    ++ + Q   + M  F    ++ I I++D LEV+D  ++A 
Sbjct: 15  AFASAALVALYVGGTVPATAQSAV-QGVPNAMQGFSQNRDKPIQIESDTLEVRDKNKEAT 73

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN-KINRMDVERNIFIQSGEINVIASNGYV 121
           F GNV + Q D ++ +  + + Y+         K   M         +  I  + + G+V
Sbjct: 74  FTGNVKVVQGDTTMTSQTLVVFYDQDQAPAKGAKGKPMPAAAPGPDGASSIRRLEAKGHV 133

Query: 122 DFQKRILVLNGDRA------------DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
              ++  V+ GD+A              V+L +  N   G +L+V++ T  + ++  +S 
Sbjct: 134 VVTQKDQVVTGDKAVFETKTNLVTMTGNVVLTQARNVVRGDRLLVDMTTGVSRVE-SDSG 192

Query: 170 QVQSIIRYDG 179
           +VQ + +  G
Sbjct: 193 RVQGLFQSSG 202


>gi|77464736|ref|YP_354240.1| OstA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463576|ref|YP_001044690.1| OstA family protein [Rhodobacter sphaeroides ATCC 17029]
 gi|77389154|gb|ABA80339.1| OstA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105240|gb|ABN77918.1| OstA family protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 163

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 12/138 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I +D L+V  A   A F GNV + Q    L A  + ++Y          I R+    
Sbjct: 38  PVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEYAPGG----GAIRRLHASG 93

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + + +G     A       +   +V+ GD    V+L +  NT  G KL++++      +
Sbjct: 94  GVTLANGSEAAEAKQAVYTIESGEVVMTGD----VLLTQGPNTLAGQKLVIDLTAGTGRM 149

Query: 164 QGCESDQVQSIIRYDGRP 181
           +G    +VQ++ +    P
Sbjct: 150 EG----RVQTVFQPGKAP 163


>gi|221640650|ref|YP_002526912.1| OstA family protein [Rhodobacter sphaeroides KD131]
 gi|221161431|gb|ACM02411.1| OstA family protein precursor [Rhodobacter sphaeroides KD131]
          Length = 163

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 12/138 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I +D L+V  A   A F GNV + Q    L A  + ++Y          I R+    
Sbjct: 38  PVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEYAPGG----GAIRRLHASG 93

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + + +G     A       +   +V+ GD    V+L +  NT  G KL++++      +
Sbjct: 94  GVTLANGSEAAEAKEAVYTIESGEVVMTGD----VLLTQGPNTLAGQKLVIDLTAGTGRM 149

Query: 164 QGCESDQVQSIIRYDGRP 181
           +G    +VQ++ +    P
Sbjct: 150 EG----RVQTVFQPGKAP 163


>gi|296282121|ref|ZP_06860119.1| OstA-like protein [Citromicrobium bathyomarinum JL354]
          Length = 179

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 56/122 (45%), Gaps = 7/122 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  +   A+ +E++D   +    GNV + Q D  + +    +DY++     S  I R+  
Sbjct: 44  NAPVDYAANRIELQDRQNRVVLSGNVVIEQADLRMTSASTIVDYSDAG---SLSIQRISA 100

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + +  G  +   +    DF +R++ + G+    V LK   +T  G +L +++ T  +
Sbjct: 101 TGGVTVTRGNESARGNVAVYDFNRRVITMTGN----VRLKRGSDTLNGGRLTIDLRTGLS 156

Query: 162 SL 163
           S+
Sbjct: 157 SV 158


>gi|316931444|ref|YP_004106426.1| OstA family protein [Rhodopseudomonas palustris DX-1]
 gi|315599158|gb|ADU41693.1| OstA family protein [Rhodopseudomonas palustris DX-1]
          Length = 221

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 14/165 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I++D LEV+D  ++A F GNV + Q D ++ +  + + Y+ 
Sbjct: 39  QGVPNAMQGFSQNRDKPIQIESDTLEVRDKKKEATFSGNVKVVQGDTTMTSQTLVVFYDQ 98

Query: 88  TNRDVSN-KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA----------- 135
                   K   M         +  I  + + G+V   ++  V+ GD+A           
Sbjct: 99  DQAPAKGAKGKPMAAAAPGPDGASSIRRLEAKGHVVVTQKDQVVTGDKAVFETKTNLVTM 158

Query: 136 -DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
              V+L +  N   G +L+V++ T  + ++  +S +VQ + +  G
Sbjct: 159 TGNVVLTQARNVVRGDRLMVDMTTGVSRVE-SDSGRVQGLFQSSG 202


>gi|322418291|ref|YP_004197514.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M18]
 gi|320124678|gb|ADW12238.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M18]
          Length = 165

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 10/164 (6%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L F++L   LS A A Y  +  V G E + +K+D L   +  + A F+G V   Q D  L
Sbjct: 6   LSFIVLVLSLSTAVA-YAAQ-GVSGKEPLKVKSDTLTTDNEKKTAIFEGKVVAHQGDMVL 63

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
             D++ + Y+       N+++R++   N+ I   E     ++G    ++  +VL+G+   
Sbjct: 64  YTDRLVVSYSGPG----NEVSRVEAFGNVRIVQQERQATGAHGVYQPKEGRVVLDGN--P 117

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           KV+  + + T       VN   S  +      ++V+++I   G+
Sbjct: 118 KVVSGDDVITGKVITYYVNEQKSVVT--SGPKERVEAVIHPGGK 159


>gi|192288482|ref|YP_001989087.1| OstA family protein [Rhodopseudomonas palustris TIE-1]
 gi|192282231|gb|ACE98611.1| OstA family protein [Rhodopseudomonas palustris TIE-1]
          Length = 221

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 14/165 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I++D LEV+D  ++A F GNV + Q D ++ +  + + Y+ 
Sbjct: 39  QGVPNAMQGFSQNRDKPIQIESDTLEVRDKNKEATFTGNVKVVQGDTTMTSQTLVVFYDQ 98

Query: 88  TNRDVSN-KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA----------- 135
                   K   M         +  I  + + G+V   ++  V+ GD+A           
Sbjct: 99  DQAPAKGAKGKPMPAAAPGPDGASSIRRLEAKGHVVVTQKDQVVTGDKAVFETKTNLVTM 158

Query: 136 -DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
              V+L +  N   G +L+V++ T  + ++  +S +VQ + +  G
Sbjct: 159 TGNVVLTQARNVVRGDRLLVDMTTGVSRVE-SDSGRVQGLFQSSG 202


>gi|260753181|ref|YP_003226074.1| OstA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552544|gb|ACV75490.1| OstA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 198

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 72/176 (40%), Gaps = 20/176 (11%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           LL   F L+   LS  +A          N  I I AD  EV     +A + G+V   Q D
Sbjct: 19  LLLCGFTLILTPLSALSAQGFRHHDT--NAPIDIDADHSEVLYNDNRAIYSGHVRARQAD 76

Query: 74  FSLQADKMTIDY----NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
            ++ A  + I Y    N+   + S ++ R+D    + IQ+ +          D  KR++ 
Sbjct: 77  MTITAAYVRIAYTMPKNSKTGEASPQMQRLDASGGVTIQTPDEMAKGEIAIYDVPKRLVT 136

Query: 130 LNGD----RADKVILKEKLNTFLGCKLIVNIDTSFASLQGC--ESDQVQSIIRYDG 179
           L G     R D V+         G +LI++++T   ++ G    SD  Q   R  G
Sbjct: 137 LVGHVEMVRGDSVV--------HGARLIIDLNTGKGTMDGSLVGSDGSQGKGRVTG 184


>gi|126726412|ref|ZP_01742253.1| gamma-glutamyl kinase [Rhodobacterales bacterium HTCC2150]
 gi|126704275|gb|EBA03367.1| gamma-glutamyl kinase [Rhodobacterales bacterium HTCC2150]
          Length = 368

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 3/89 (3%)

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD--RADKVILKEKLNTFLGCK 151
           N I  M     I + +G +  + S G       +  ++GD  R D V +     T LGC 
Sbjct: 270 NWIAAMKPRGTITVDAGAVGAL-SKGNSLLSAGVQAVSGDFMRGDPVEISGPEGTILGCG 328

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           L          ++GC+SDQ++ I+ Y+GR
Sbjct: 329 LCRYTAEEVDMIKGCQSDQIEKILGYEGR 357


>gi|56695007|ref|YP_165354.1| hypothetical protein SPO0080 [Ruegeria pomeroyi DSS-3]
 gi|56676744|gb|AAV93410.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 163

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + + AD L+V      A F+GNV ++Q +  L A ++ + YN      ++ I R++   
Sbjct: 39  PVEVTADSLDVSQEDGSAEFQGNVLVSQGEMRLSAKRVLVIYNQE----ASGIERLEATG 94

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           ++ + SG     A          ++V+ GD    V+L +  N     K+ VN+ +  A +
Sbjct: 95  DVVLVSGSDAAQAQRADYTIGTGVIVMTGD----VLLTQGKNALSSGKMTVNLTSGTAQM 150

Query: 164 QG 165
            G
Sbjct: 151 VG 152


>gi|56551172|ref|YP_162011.1| OstA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760849|ref|ZP_04758938.1| OstA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|56542746|gb|AAV88900.1| OstA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374468|gb|EER63929.1| OstA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 198

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 76/187 (40%), Gaps = 24/187 (12%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
            FL +  L +    L+   L A  +Q    + T      N  I I AD  EV     +A 
Sbjct: 12  PFLKAAALSLCGFTLILTPLSALSAQGFRHHDT------NAPIDIDADHSEVLYNDNRAI 65

Query: 63  FKGNVFMTQEDFSLQADKMTIDY----NNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
           + G+V   Q D ++ A  + I Y    N+   + S ++ R+D    + IQ+ +       
Sbjct: 66  YSGHVRARQADMTITAAYVRIAYTMPKNSKTGEASPQMQRLDASGGVTIQTPDEMAKGEI 125

Query: 119 GYVDFQKRILVLNGD----RADKVILKEKLNTFLGCKLIVNIDTSFASLQGC--ESDQVQ 172
              D  KR++ L G     R D V+         G +LI++++T   ++ G    SD  Q
Sbjct: 126 AIYDVPKRLVTLVGHVEMVRGDSVV--------HGARLIIDLNTGKGTMDGSLVGSDGSQ 177

Query: 173 SIIRYDG 179
              R  G
Sbjct: 178 GKGRVTG 184


>gi|86747783|ref|YP_484279.1| OstA-like protein [Rhodopseudomonas palustris HaA2]
 gi|86570811|gb|ABD05368.1| OstA-like protein [Rhodopseudomonas palustris HaA2]
          Length = 219

 Score = 44.7 bits (104), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 77/172 (44%), Gaps = 25/172 (14%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I++D LEV+D  ++A F G+V + Q D ++ +  + + Y+ 
Sbjct: 35  QGVPNAMQGFSQNKDQPIQIESDTLEVRDKKKEATFAGSVKVIQGDTTMTSKSLVVFYDQ 94

Query: 88  TNRDVSNK--------------------INRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
              D + K                    I R++ + N+ +   +  V   +   D +  +
Sbjct: 95  DQPDAAAKPQAKRKTMPAATPGPGGASAIRRLEAKGNVVVTQKDQVVTGDSAVFDTKTNL 154

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           + + G+    V+L +  N   G +LIV++ T  + ++   S +VQ + +  G
Sbjct: 155 VTMLGN----VVLTQAKNVVRGDRLIVDMTTGVSRVE-SNSGRVQGLFQSSG 201


>gi|300021931|ref|YP_003754542.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523752|gb|ADJ22221.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 640

 Score = 44.3 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 63/137 (45%), Gaps = 13/137 (9%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNK 95
           FK   N    + +D L+V D  + A F GNV   Q +F++Q+ +MT  Y   +   +S+ 
Sbjct: 450 FKTDPNAPYDVTSDRLDVDDNAKTALFTGNVVTVQGNFTIQSGEMTAYYTGRSGLGMSDD 509

Query: 96  INRMDVERNIFIQSGEINVIASNGY--------VDFQKRILVLNGDRADKVILKEKLNTF 147
             +            ++ V++ +G         VD +  +  L G+    V+L +  N  
Sbjct: 510 KAKSGASLTHIRAKKDVTVVSKDGQKASGDWAEVDVKTNLAKLGGN----VVLTQGKNVV 565

Query: 148 LGCKLIVNIDTSFASLQ 164
            G KL++++ T  A+++
Sbjct: 566 RGTKLLIDMTTGQATIK 582


>gi|92115809|ref|YP_575538.1| OstA-like protein [Nitrobacter hamburgensis X14]
 gi|91798703|gb|ABE61078.1| OstA-like protein [Nitrobacter hamburgensis X14]
          Length = 228

 Score = 44.3 bits (103), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 75/173 (43%), Gaps = 25/173 (14%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ +  + + Y +
Sbjct: 43  QGVPNAMQGFSQNRDQPIQIEAAALEMRDKKKEATFSGNVKVVQGDTTMTSKTLVVYYES 102

Query: 88  TN--------------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            N                       ++ I R++   N+ +   +  V       D +  +
Sbjct: 103 GNSANAKGKSPSKPAMASATPGPSGASSIKRLEARGNVVVTQKDQVVTGDTAQFDTRTNL 162

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           + + G    KV+L +  N   G +LIV++ T  + ++   S +VQ + +  G+
Sbjct: 163 VTMLG----KVVLTQGKNVLRGDRLIVDMTTGVSRVE-SNSGRVQGLFQSSGQ 210


>gi|294675673|ref|YP_003576288.1| OstA family protein [Rhodobacter capsulatus SB 1003]
 gi|294474493|gb|ADE83881.1| OstA family protein [Rhodobacter capsulatus SB 1003]
          Length = 161

 Score = 44.3 bits (103), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 12/140 (8%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           + ++ + AD L V  A   A F GNV + Q    L+A+K+ ++Y        ++I ++  
Sbjct: 34  DAQVEVTADSLSVHQADGSAVFTGNVLIVQGPMRLKAEKVEVEYGADR----SRIAKLHA 89

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + + SG+    A     +     + L GD    V+L +  N   G  + +++ T   
Sbjct: 90  SGGVTLVSGKDAAEAREAVYEVAAGAVELTGD----VLLTQGPNVLSGQHMTIDLKTGTG 145

Query: 162 SLQGCESDQVQSIIRYDGRP 181
            + G    +V++I++    P
Sbjct: 146 RMDG----RVRTILQPGETP 161


>gi|260431733|ref|ZP_05785704.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415561|gb|EEX08820.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 137

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 65/136 (47%), Gaps = 12/136 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + + ++ L+V      A F GNV + Q D  L A+K+ + Y   N+D S  I RM+   
Sbjct: 13  PVEVTSETLKVNQEDGSAEFLGNVIVVQGDMRLSAEKVVVIY---NQDRSG-IERMEASE 68

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+ + +      A          ++V+ G+    V+L +  +T  G +++ N+    A++
Sbjct: 69  NVVLVAPPDAAQADRAEYSIATGVIVMTGN----VLLNQGPSTISGDRMVANLTDGTATM 124

Query: 164 QGCESDQVQSIIRYDG 179
            G    +V++I++  G
Sbjct: 125 TG----RVKTILQQGG 136


>gi|315497168|ref|YP_004085972.1| lipopolysaccharide transport periplasmic protein lpta
           [Asticcacaulis excentricus CB 48]
 gi|315415180|gb|ADU11821.1| lipopolysaccharide transport periplasmic protein LptA
           [Asticcacaulis excentricus CB 48]
          Length = 176

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 5/134 (3%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINRMDVE 102
            I   AD  E  +    A F G+V   QE   L+ADK+T+ Y  N      + ++  +  
Sbjct: 32  PIGYAADTFEADEGNHTATFTGSVEFLQETSRLRADKVTVTYGQNQATGKWDVLSTAEAT 91

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
            N++    +  +  S          LV+ G+    V+LK+  N   G +L+ N+    +S
Sbjct: 92  GNVYYVVDDQVMTGSRAVYTKSTDTLVMTGN----VVLKQGQNVMEGSRLVYNVGAKKSS 147

Query: 163 LQGCESDQVQSIIR 176
           + G  +   +S +R
Sbjct: 148 MDGVPTSGSKSRVR 161


>gi|91974658|ref|YP_567317.1| OstA-like protein [Rhodopseudomonas palustris BisB5]
 gi|91681114|gb|ABE37416.1| OstA-like protein [Rhodopseudomonas palustris BisB5]
          Length = 221

 Score = 43.9 bits (102), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 76/171 (44%), Gaps = 24/171 (14%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I++D LEV+D  ++A F G+V + Q D ++ +  + + Y+ 
Sbjct: 38  QGVPNAMQGFSQNRDQPIQIESDTLEVRDKKKEATFTGSVKVVQGDTTMTSKTLVVFYDQ 97

Query: 88  TNRDVSNK-------------------INRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
              + S K                   I R++ + N+ +   +  V   +   D +  ++
Sbjct: 98  DQSETSAKQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQKDQVVTGDSAVFDTKTNLV 157

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            + G     V+L +  N   G +L+V++ T  + ++   S +VQ + +  G
Sbjct: 158 TMLGS----VVLTQGKNVVRGDRLLVDMTTGVSRVE-SNSGRVQGLFQSSG 203


>gi|163738081|ref|ZP_02145497.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
 gi|161388697|gb|EDQ13050.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
          Length = 165

 Score = 43.1 bits (100), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 72/161 (44%), Gaps = 10/161 (6%)

Query: 8   IHLYIHLLALVFVLLKADLS-QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           ++L + +  L   L    LS Q+A+      K   ++ + + A+ L+V  A   A F G+
Sbjct: 1   MYLRVLMFCLPVTLFSTGLSAQSASIAFGAVKADPSQPVEVTAETLDVNQADGSARFIGD 60

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNK--INRMDVERNIFIQSGEINVIASNGYVDFQ 124
           V + Q    L A+ + + Y    +D + K  + R++   N+ + +G     A        
Sbjct: 61  VVIIQGVMRLSANDVLVIYK---QDETGKTGVERLEASGNVILVNGPDAAEADKAEYTID 117

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
              +V+ G+    V+L +   T    +L+V++ T  ASL G
Sbjct: 118 SGTVVMTGN----VLLSQSTGTLTSNRLVVDLTTGTASLSG 154


>gi|220925753|ref|YP_002501055.1| OstA family protein [Methylobacterium nodulans ORS 2060]
 gi|219950360|gb|ACL60752.1| OstA family protein [Methylobacterium nodulans ORS 2060]
          Length = 239

 Score = 43.1 bits (100), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 67/172 (38%), Gaps = 29/172 (16%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK- 95
           F   G E I I AD L+V D   KA F GNV   Q + +++   MT+ Y   NRD   K 
Sbjct: 39  FGSSGKEPIKIDADRLDVFDHENKAIFAGNVVAVQGESTIRCSSMTVHYQR-NRDKDAKD 97

Query: 96  ---------------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA--DK- 137
                              D +      SG I  +   G V    +  V  GD A  DK 
Sbjct: 98  GAKSADKPADGKAPDAKTSDAKPADPTDSGAIKQVVCAGPVTVVNKDQVATGDNAVFDKA 157

Query: 138 ---------VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
                    V+L +  N   G +L+ +++T  A++      +V ++    G+
Sbjct: 158 ANRVILTGNVVLSQCQNVTRGNRLVYDMNTGRANMDPTAGGRVSAMFVPGGK 209


>gi|116749502|ref|YP_846189.1| OstA family protein [Syntrophobacter fumaroxidans MPOB]
 gi|116698566|gb|ABK17754.1| OstA family protein [Syntrophobacter fumaroxidans MPOB]
          Length = 199

 Score = 43.1 bits (100), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 67/138 (48%), Gaps = 11/138 (7%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN-------KIN 97
           +HI +D +EV+   +   F+G+V + Q+D ++  +++ +     +  + N       KI+
Sbjct: 59  LHIASDRMEVRQRDRTIVFQGHVVVRQDDLTITGNQLKVTAARVDPSIRNDQSAIVEKID 118

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R++VE  + I   E    A       Q++ +VL G+     ++ + L+   G  + + I 
Sbjct: 119 RIEVEGGVKITQREKQATADKAVYYHQEQKIVLLGN----PVVSQGLDKVQGRLITLYIA 174

Query: 158 TSFASLQGCESDQVQSII 175
              + ++G E   VQ+++
Sbjct: 175 EGKSVVEGGEQTPVQALL 192


>gi|114568661|ref|YP_755341.1| OstA family protein [Maricaulis maris MCS10]
 gi|114339123|gb|ABI64403.1| OstA family protein [Maricaulis maris MCS10]
          Length = 180

 Score = 43.1 bits (100), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 7/123 (5%)

Query: 40  LGNEKIH--IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK-I 96
           +GN  +   I+A+  EV DA +   + GNV + Q D SLQAD+M + Y           I
Sbjct: 25  IGNSSLPLDIEAETFEVLDAERHIVWLGNVHVVQGDSSLQADRMDVYYTGEGPGGGWGDI 84

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
           +R+    N+F  +         G  +  + ++ L GD    V++ +  N     + + N+
Sbjct: 85  DRIVATDNVFYITPAQRARGDRGVYELAEEVITLTGD----VVITQGDNVITTTRFVNNL 140

Query: 157 DTS 159
            T 
Sbjct: 141 TTG 143


>gi|85375261|ref|YP_459323.1| hypothetical protein ELI_12170 [Erythrobacter litoralis HTCC2594]
 gi|84788344|gb|ABC64526.1| hypothetical protein ELI_12170 [Erythrobacter litoralis HTCC2594]
          Length = 183

 Score = 43.1 bits (100), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  ++  A  LEV+D   +    G V +TQ   ++++++M ++Y++     +  I R+  
Sbjct: 40  NAPVNFDAGRLEVQDRQNRVVLSGAVTVTQAGLTVRSNRMVVNYSDAG---TLDIGRITA 96

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + +  G           D  +RI+ + G+    V L    +   G +L++++++  +
Sbjct: 97  TGGVTVTRGNERAQGDVAIYDLNRRIITMAGN----VRLNRGGDNLSGGRLVIDLNSGVS 152

Query: 162 SLQGCESDQV-QSIIR-YDGR 180
           S+ G  +    ++ +R  DGR
Sbjct: 153 SVDGSAAPGAGETGVRGSDGR 173


>gi|170751837|ref|YP_001758097.1| OstA family protein [Methylobacterium radiotolerans JCM 2831]
 gi|170658359|gb|ACB27414.1| OstA family protein [Methylobacterium radiotolerans JCM 2831]
          Length = 223

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 59/145 (40%), Gaps = 23/145 (15%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I I AD L+V D   KA F GNV   Q D +++   MT+ Y    RD   K  R D
Sbjct: 40  GKDPIKIDADRLDVFDRENKAVFAGNVVAVQGDSTIRCSTMTVTYKR-GRDAPGKGARGD 98

Query: 101 VERNIFIQSGE----------INVIASNGYVDFQKRILVLNGDRA------------DKV 138
            +     +  +          I  +   G V   ++  V  GD A              V
Sbjct: 99  AKTEARDEGADAAPRNPAENGIQKVDCAGPVTVVQKDQVATGDHAVFDQDAKRIVLTGNV 158

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASL 163
           +L +  N   G +L+ +++T  A++
Sbjct: 159 VLSQCQNVTRGQRLVYDMNTGRANM 183


>gi|198284715|ref|YP_002221036.1| lipopolysaccharide transport periplasmic protein LptA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667648|ref|YP_002427394.1| hypothetical protein AFE_3027 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198249236|gb|ACH84829.1| lipopolysaccharide transport periplasmic protein LptA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519861|gb|ACK80447.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 182

 Score = 42.7 bits (99), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 18/141 (12%)

Query: 40  LGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
           LG   I I AD L  ++   Q+A + GNV MTQ D  + ADK+T+D       ++ K+++
Sbjct: 39  LGKGPIQISADALHGENKPQQQAVYTGNVVMTQGDVVVHADKLTVD------AIAGKVHQ 92

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI-----LKEKLNTFLGCKLI 153
                +    +  ++    +GY D     LV    + + V+     L +K N   G ++ 
Sbjct: 93  ATAVGSPVTFT--MSAAQRHGYGD----TLVYKPGKGEIVLTGNAHLWQKKNEISGQQVT 146

Query: 154 VNIDTSFASLQGCESDQVQSI 174
             + T   ++      +VQSI
Sbjct: 147 YFLQTQQTAVTAAPGKRVQSI 167


>gi|163742523|ref|ZP_02149909.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
 gi|161384108|gb|EDQ08491.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
          Length = 165

 Score = 42.4 bits (98), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 72/161 (44%), Gaps = 10/161 (6%)

Query: 8   IHLYIHLLALVFVLLKADLS-QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           ++L + +  L   L    LS Q+A+      K   ++ + + A+ L+V  A   A F G+
Sbjct: 1   MYLRVLMFCLPVTLFYTGLSAQSASIAFGAVKADPSQPVEVTAETLDVNQADGSARFIGD 60

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNK--INRMDVERNIFIQSGEINVIASNGYVDFQ 124
           V + Q    L A+ + + Y    +D + K  + R++   N+ + +G     A        
Sbjct: 61  VVIIQGVMRLSANDVLVIYK---QDETGKTGVERLEASGNVILVNGPDAAEADKAEYTID 117

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
              +V+ G+    V+L +   T    +L+V++ T  ASL G
Sbjct: 118 SGTVVMTGN----VLLSQSTGTLTSNRLVVDLTTGTASLSG 154


>gi|312114052|ref|YP_004011648.1| OstA family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219181|gb|ADP70549.1| OstA family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 250

 Score = 42.4 bits (98), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 84/203 (41%), Gaps = 43/203 (21%)

Query: 14  LLALVFVLLKADLS--QAAASYMTRFKVLGN-----EKIHIKADMLEVKDAVQKAFFKGN 66
           LLA   +L  A +S    A +  + F+ +G+     + I I++D LEV D    A F GN
Sbjct: 7   LLAFALMLSAAVMSIPSYAQTPGSGFRGIGSGDNAKKPIDIESDRLEVDDKRHVAIFIGN 66

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDV-------------------SNKINRMDVERNIFI 107
           V   Q D++L+A ++ + Y     D                    S K           I
Sbjct: 67  VSANQGDYNLRAPRLEVTYERQGGDSAGGKAQKLVSAPGGDSPAKSPKTATDAAAAADPI 126

Query: 108 QSGEINVIASNG---YVDFQKRILVLNGDRA-------------DKVILKEKLNTFLGCK 151
            SG+I  I + G    V  +K    + GD A              +VIL +K N   G +
Sbjct: 127 SSGQIRYIRALGGHVVVTNKKDEQEVTGDEALYDVKGQKITMTGKEVILSQKANVVKGRQ 186

Query: 152 LIVNIDTSFASLQGCESDQVQSI 174
           L ++++T  A++   E  +VQ+I
Sbjct: 187 LSIDLETGRATVI-PEKGRVQAI 208


>gi|95928725|ref|ZP_01311471.1| OstA-like protein [Desulfuromonas acetoxidans DSM 684]
 gi|95135070|gb|EAT16723.1| OstA-like protein [Desulfuromonas acetoxidans DSM 684]
          Length = 162

 Score = 42.0 bits (97), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 72/135 (53%), Gaps = 11/135 (8%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           ++ IH+ +  LE  DA     F G V   Q D ++ A KMTI Y++  +    +++R+  
Sbjct: 29  SQPIHVTSQRLEANDAKGFFIFTGEVQAQQGDVTMYAHKMTIYYSDGEQ---RQVDRVVA 85

Query: 102 ERNIFIQSGEINVIASNGYVDFQKR--ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
           E+++ I   ++N +A+     F ++   + L GD   +V+  E  N   G K+IV ++ S
Sbjct: 86  EKDVRIV--QLNRVATGQNAVFWQKDGRVELTGD--PRVVQGE--NVVEGEKIIVYLNES 139

Query: 160 FASLQGCESDQVQSI 174
            + ++G +  +V+++
Sbjct: 140 RSIVEGGKQGRVKAV 154


>gi|209883611|ref|YP_002287468.1| hypothetical protein OCAR_4457 [Oligotropha carboxidovorans OM5]
 gi|209871807|gb|ACI91603.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 59/142 (41%), Gaps = 23/142 (16%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK------ 95
            + I I A  LEV+D  + A F GNV + Q D ++++  + + Y    +  +NK      
Sbjct: 52  GQPIQIDALSLEVRDKDKVATFSGNVKVVQGDTTMRSKTLVVFYEQQGKSGANKSGSKAG 111

Query: 96  -------------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                        + R++    + +   +  V    G  D +   + L G     V+L +
Sbjct: 112 MTTAQPGPGGSSSVKRLEARGGVVVTQNDQTVTGETGIFDMKTNTVTLTGG----VVLTK 167

Query: 143 KLNTFLGCKLIVNIDTSFASLQ 164
             N   G +L+V++ T  + ++
Sbjct: 168 DKNVLKGDRLVVDMTTGVSRVE 189


>gi|126724657|ref|ZP_01740500.1| OstA-like protein [Rhodobacterales bacterium HTCC2150]
 gi|126705821|gb|EBA04911.1| OstA-like protein [Rhodobacterales bacterium HTCC2150]
          Length = 162

 Score = 41.2 bits (95), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 12/138 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I++D   V  +   A F GNV + Q    L AD++ ++Y +   D SN I+ +    
Sbjct: 37  PVEIESDKFSVDQSTNLAVFLGNVLVVQGLLRLSADQVNVEYAS---DESNDISAVIAVG 93

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+   +G     A           +V+ GD    V++ +  +   G K++VN++T    +
Sbjct: 94  NVTFVNGAEAAEAQRAEYTLATNEIVMTGD----VLVTQGRSALSGQKMVVNLETGKGEM 149

Query: 164 QGCESDQVQSIIRYDGRP 181
            G    +V++I+R  G P
Sbjct: 150 IG----RVKTILR-SGNP 162


>gi|292490480|ref|YP_003525919.1| lipopolysaccharide transport periplasmic protein LptA
          [Nitrosococcus halophilus Nc4]
 gi|291579075|gb|ADE13532.1| lipopolysaccharide transport periplasmic protein LptA
          [Nitrosococcus halophilus Nc4]
          Length = 275

 Score = 41.2 bits (95), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 7  SIHLYIHL--LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
          S HL + L  L L+F  L  + + A +S          + IHI+AD  E+ D  Q A ++
Sbjct: 2  SRHLGLKLATLWLIFGGLNGETAWALSSDQ-------EQPIHIEADRGELDDRKQIAVYR 54

Query: 65 GNVFMTQEDFSLQADKMTIDY 85
          GNV +TQ    + +D +TI Y
Sbjct: 55 GNVHLTQGTLRIDSDILTIYY 75


>gi|78222495|ref|YP_384242.1| OstA-like protein [Geobacter metallireducens GS-15]
 gi|78193750|gb|ABB31517.1| OstA-like protein [Geobacter metallireducens GS-15]
          Length = 169

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 8/134 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            + I IK++ L        A F G V   Q D ++ ADK+ + Y     D    ++R++ 
Sbjct: 31  GQPITIKSNELSTDSRHNTATFTGKVIARQGDLTIYADKLVVHYKADGGD----LDRVEA 86

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
             N+ I  G+    A +G     ++ +VL GD   KV   E  NT  G  +   +D   +
Sbjct: 87  SGNVRIVQGDRLATARDGVYQSAEQKIVLTGD--PKVFQGE--NTVSGKVITYFVDEEKS 142

Query: 162 SLQGCESDQVQSII 175
            + G    +V+++I
Sbjct: 143 IVTGGPDTRVEAVI 156


>gi|146278805|ref|YP_001168964.1| OstA family protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557046|gb|ABP71659.1| OstA family protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 168

 Score = 40.8 bits (94), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 58/138 (42%), Gaps = 12/138 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I++D L+V  A   A F GNV + Q    L A  + ++Y          I R+    
Sbjct: 43  PVEIESDELQVNQADGTAIFLGNVRVVQGPMRLAAQSVRVEYAPEG----GGIRRLHASG 98

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + + +      A       +   +V+ GD    V+L +  NT  G +L++++      +
Sbjct: 99  GVTLANEREAAEAQEAIYTIESGEVVMTGD----VLLTQGPNTLAGQRLVIDLTAGTGRM 154

Query: 164 QGCESDQVQSIIRYDGRP 181
           +G    +VQ++ R    P
Sbjct: 155 EG----RVQTVFRPGTSP 168


>gi|158520525|ref|YP_001528395.1| OstA family protein [Desulfococcus oleovorans Hxd3]
 gi|158509351|gb|ABW66318.1| OstA family protein [Desulfococcus oleovorans Hxd3]
          Length = 198

 Score = 40.8 bits (94), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 78/192 (40%), Gaps = 22/192 (11%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +   N++ +   LL + F++  A  + A      +      + IHI AD L  +     A
Sbjct: 6   TGIWNTMKIQTGLLTICFLVFPALFASADTPPPPQDDA---KAIHISADRLVSESRADYA 62

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNN-TNRDVSNKINRMDVE-----RNIFIQSGEINVI 115
            F GNV    E F +QAD + + Y+   +       NR+D       R I I +G + ++
Sbjct: 63  EFTGNVRAVGEKFDIQADTLQVFYSPAPDTQAPGTANRLDTGTGKTVREI-IATGNVTIL 121

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT--------SFASLQGCE 167
             +      + +      R   V+L    +T  G    ++ DT        S   + G E
Sbjct: 122 FDDKVAKTDQAVYSRESGR---VVLMGPGSTVTGKSGRISGDTITLHTETESVTVISGGE 178

Query: 168 SDQVQSIIRYDG 179
           + +VQ++I  DG
Sbjct: 179 T-RVQAVIHPDG 189


>gi|189425227|ref|YP_001952404.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           lovleyi SZ]
 gi|189421486|gb|ACD95884.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           lovleyi SZ]
          Length = 182

 Score = 40.8 bits (94), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 81/169 (47%), Gaps = 16/169 (9%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEK----IHIKADMLEVKDAVQKAFFKGNVF 68
            +L LV V L   L   AAS          ++    I IKAD L+  +  + A F G V 
Sbjct: 6   RILVLVSVWLLGVLPAVAASQPASGGAAARDRSSRPITIKADELKADNKGKIATFTGRVV 65

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR-- 126
             QED ++ +DK+ I Y     D  +++++++   ++ I   + N I + G+  ++ R  
Sbjct: 66  ARQEDVTIYSDKLVIYYG----DKQDQVDKIEAIGSVRIL--QTNRIGTGGHALYESREG 119

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + L+G+      + +  ++  G  ++  +D   + + G E+ +V+++I
Sbjct: 120 KITLSGNPK----VTQDKDSITGKVIVYYLDDDRSVVIGGENARVEAVI 164


>gi|170743376|ref|YP_001772031.1| OstA family protein [Methylobacterium sp. 4-46]
 gi|168197650|gb|ACA19597.1| OstA family protein [Methylobacterium sp. 4-46]
          Length = 285

 Score = 40.8 bits (94), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 37 FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
          F   G E I I AD L+V D   KA F GNV   Q + +++   MT+ Y   NRD   K
Sbjct: 36 FGSSGKEPIKIDADRLDVFDHENKAVFAGNVVAVQGESTIRCSSMTVHYQR-NRDKGAK 93


>gi|117926611|ref|YP_867228.1| OstA family protein [Magnetococcus sp. MC-1]
 gi|117610367|gb|ABK45822.1| OstA family protein [Magnetococcus sp. MC-1]
          Length = 179

 Score = 40.8 bits (94), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 7/139 (5%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERN 104
           I AD LE+ D  Q A FKGNV   +    L +D+M + Y  +    +  ++I  +    N
Sbjct: 34  ITADALEMNDLKQIAVFKGNVQAEEGAMQLFSDRMVVTYRPSQAGGTKQDRIREIVANGN 93

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF---- 160
           + ++ G+    A         R L L G+    V+   K +   G K+++ +D +     
Sbjct: 94  VVLRQGDHIGRADKAVYSVSSRALSLEGNNRTAVVQHNK-DRLEGQKIVLQMDENRQIQN 152

Query: 161 ASLQGCESDQVQSIIRYDG 179
             ++G    +V ++I  DG
Sbjct: 153 VKVEGGRKGRVSAVITPDG 171


>gi|84514853|ref|ZP_01002216.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
 gi|84511012|gb|EAQ07466.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
          Length = 153

 Score = 40.8 bits (94), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 63/155 (40%), Gaps = 18/155 (11%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVL---GNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           LLAL F       S A+A        L    +  I + +D L V      A F+G+V + 
Sbjct: 2   LLALAF-------STASAQTQINLGALVVDPSAAIEVTSDALSVDQDTGIAVFEGDVLVI 54

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q D  L A ++ + Y N     + +I R+       + + +    A     D    +L L
Sbjct: 55  QGDLRLSAQRVEVVYGND----TAEIARLIASGGALLANTQDAAEADTADYDITTGLLTL 110

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
            GD    V++ +  N      +IVN+    A++QG
Sbjct: 111 TGD----VLVTQGGNVISAQSMIVNVTDGTATMQG 141


>gi|83944935|ref|ZP_00957301.1| hypothetical protein OA2633_09909 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851717|gb|EAP89572.1| hypothetical protein OA2633_09909 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 193

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 9/137 (6%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G   + I AD  +  DA     + G+V + + D  L+AD++   Y       S ++NR+ 
Sbjct: 29  GEGPVDISADDFQAFDAQGMGVYTGDVNVVRGDVRLRADRLEAYYVRRGGG-SPELNRIV 87

Query: 101 VERNIF-IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
            E  +F I   EI      G  D    ++ L G     V+L +  N   G  L   + T 
Sbjct: 88  AEGEVFYITPNEI-ARGDRGTYDLVNEVIELTG----SVVLTQGCNVSTGEHLHAELATG 142

Query: 160 FASLQGCE--SDQVQSI 174
            A L+G +  S +V+S+
Sbjct: 143 VARLEGGQNSSGRVRSV 159


>gi|332704275|ref|ZP_08424363.1| OstA family protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554424|gb|EGJ51468.1| OstA family protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 184

 Score = 39.7 bits (91), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 79/186 (42%), Gaps = 30/186 (16%)

Query: 5   LNSIHLYIHLL-ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           ++  HL + L+ A+ ++L     +QAA   +   KV         AD L       +A F
Sbjct: 1   MHPSHLIVFLICAMAWIL--PITAQAAEENLVPTKVT--------ADRLTYSQEGNRAVF 50

Query: 64  KGNVFMTQEDFSLQADKMTIDYNN---------------TNRDVSNKINRMDVERNIFIQ 108
           +G V + ++D  L AD++ ID                     + +++INR+    N+ ++
Sbjct: 51  EGKVHVVRQDMELWADRIEIDLRPNGDGKSGASGPDMAFATTEGASRINRIIALGNVRMR 110

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
            G+             K +++L GD     +LKE  NT  G ++ + I+ + + + G   
Sbjct: 111 RGQSEGKCRKATYLADKSMIILEGD----PVLKEGENTLQGKEIRIYINENRSEVIGNTK 166

Query: 169 DQVQSI 174
             V+ I
Sbjct: 167 RPVEMI 172


>gi|220933908|ref|YP_002512807.1| OstA-like protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995218|gb|ACL71820.1| OstA-like protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 180

 Score = 39.7 bits (91), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  I L   L+A +F  L   L  A AS   R     +  I I++D  E+ D    + ++
Sbjct: 4   MPRISLKRPLVATLFAGLMLALITALASASER-----DLPIRIQSDSAELDDQRGVSVYR 58

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI-----FIQSG-EINVIASN 118
           GNV +TQ D  + AD +T+         S  + RM+ E N+       + G E+   A +
Sbjct: 59  GNVEVTQGDLVIHADTLTVHSP------SRVLQRMEAEGNLARLRTLTEDGREVRAEARH 112

Query: 119 -GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
             Y+  ++R+++    R     + +  + F G +++ ++D         +S +V+ I+
Sbjct: 113 MEYLAAERRMVLTRDAR-----IWQAQDEFRGARIVYDMDRETLDAASGDSGRVEVIL 165


>gi|300113013|ref|YP_003759588.1| lipopolysaccharide transport periplasmic protein lptA
          [Nitrosococcus watsonii C-113]
 gi|299538950|gb|ADJ27267.1| lipopolysaccharide transport periplasmic protein LptA
          [Nitrosococcus watsonii C-113]
          Length = 272

 Score = 39.7 bits (91), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 42 NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           + IHI+AD  E+ D  Q A + GNV +TQ    + +D +TI Y 
Sbjct: 32 EQPIHIEADRGELDDREQVAVYSGNVHLTQGTLRIDSDTLTIYYT 76


>gi|260577295|ref|ZP_05845268.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
 gi|259020476|gb|EEW23799.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
          Length = 169

 Score = 39.3 bits (90), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/145 (19%), Positives = 66/145 (45%), Gaps = 12/145 (8%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
            KV  +  + I++D L+V  A   A F GNV + Q +  L A  + ++Y+   +     I
Sbjct: 33  LKVDSSLPVEIESDQLDVDQATGVAVFTGNVLVGQGELRLSAATVRVEYDAEGK----AI 88

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
           +++     + + +      +S          +V+ G+    V+L +  +   G +L++++
Sbjct: 89  SKLHASGGVTLANATEAAESSEAVYTIASGSVVMTGN----VLLTQGESAITGQRLVIDV 144

Query: 157 DTSFASLQGCESDQVQSIIRYDGRP 181
           +    +++G    +VQ++     +P
Sbjct: 145 NAGTGTMEG----RVQTVFVPAKKP 165


>gi|254436871|ref|ZP_05050365.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
          307]
 gi|198252317|gb|EDY76631.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
          307]
          Length = 161

 Score = 38.5 bits (88), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 42 NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
          N  + I AD L +  A   A F GNV   Q D  L A ++ + Y++ + D+S
Sbjct: 35 NAPVEITADSLSIDQATGTAIFIGNVVFGQGDLRLNAARVQVIYSDASGDIS 86


>gi|197103639|ref|YP_002129016.1| hypothetical protein PHZ_c0173 [Phenylobacterium zucineum HLK1]
 gi|196477059|gb|ACG76587.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 175

 Score = 38.5 bits (88), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 9/127 (7%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI-----DYNNTNRDVSNKINR 98
            I + AD LEV+ +   + ++GN    Q D  L+A  M +          +     ++ R
Sbjct: 31  PIDVTADELEVQQSECVSIWRGNAEALQGDTRLRASVMRMYMAKSSSRPGSGSSCGELLR 90

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           ++ E  ++  + +  V    G  D  K  +VL GD    V+  +  N   G +++ N  T
Sbjct: 91  LEAEGGVYYVTPQQRVRGDRGVYDAVKETVVLTGD----VVAVQGQNVLRGSRMVFNTRT 146

Query: 159 SFASLQG 165
               ++G
Sbjct: 147 GEGKMEG 153


>gi|118579408|ref|YP_900658.1| OstA family protein [Pelobacter propionicus DSM 2379]
 gi|118502118|gb|ABK98600.1| OstA family protein [Pelobacter propionicus DSM 2379]
          Length = 174

 Score = 38.1 bits (87), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  I IKA  L   +  +KA F G V   Q D ++ +DK+TI Y  TN+   N++ +++ 
Sbjct: 36  NLPITIKASQLTADNKGKKAVFTGKVVAKQGDITIFSDKLTIHY-GTNK---NEVEKIEA 91

Query: 102 ERNI-FIQSGEINVIASNGYVDFQKRILVLNG 132
           + N+  +Q   +   A   Y   + +I +  G
Sbjct: 92  DGNVRIVQENRVGSAAHAVYDSKEGKITLSGG 123


>gi|85859056|ref|YP_461258.1| organic solvent tolerance protein [Syntrophus aciditrophicus SB]
 gi|85722147|gb|ABC77090.1| organic solvent tolerance protein [Syntrophus aciditrophicus SB]
          Length = 197

 Score = 38.1 bits (87), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 76/149 (51%), Gaps = 16/149 (10%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY----NNTNRDVS 93
           +V G+E I I +D L+  +  +   F GN    Q D +++++K+ + Y    + T +  S
Sbjct: 44  QVTGSEPIRIDSDRLDAYNDQRLVVFSGNAVAVQGDKTIKSEKILLYYKKGESGTQKVAS 103

Query: 94  NKINRM-DVER-----NIFIQSGEINVIASNGYVDFQ-KRILVLNGDRADKVILKEKLNT 146
            ++ +  D+ER     N+ +  GE  V+  +  V +Q  + +V++G+     +++E  N 
Sbjct: 104 KEVGKTGDLERIEAKGNVILTQGE-RVVTGDEAVYYQGSQKIVMSGN----AVMRENRNI 158

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSII 175
             G +++V I+ +   ++  +  +V + I
Sbjct: 159 IRGDRIVVFINENRGMVESTQRKRVTATI 187


>gi|299133326|ref|ZP_07026521.1| OstA family protein [Afipia sp. 1NLS2]
 gi|298593463|gb|EFI53663.1| OstA family protein [Afipia sp. 1NLS2]
          Length = 250

 Score = 37.7 bits (86), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/136 (19%), Positives = 58/136 (42%), Gaps = 17/136 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-------------NT 88
            + I I A  LEV+D  + A F GNV + Q D ++++  + + Y+               
Sbjct: 60  GQPIQIDALSLEVRDKDKIATFSGNVKVVQGDTTMRSKTLVVFYDQDKAGAKPGMKTAQP 119

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               ++ + R++    + +   +  V    G  D +   + + G     V+L +  N   
Sbjct: 120 GPGGNSSVRRLEARGGVVVTQNDQTVTGETGIFDMKTNTVTMTGG----VVLTKDKNVLK 175

Query: 149 GCKLIVNIDTSFASLQ 164
           G +L+V++ T  + ++
Sbjct: 176 GDRLVVDMTTGVSRVE 191


>gi|119480163|ref|XP_001260110.1| DNA repair protein Rad4, putative [Neosartorya fischeri NRRL 181]
 gi|119408264|gb|EAW18213.1| DNA repair protein Rad4, putative [Neosartorya fischeri NRRL 181]
          Length = 967

 Score = 37.7 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 26  LSQAAASYMTRFKVL--GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L+QA+ ++  RF+V   G ++ H   D  ++K  V+   F   VF+++EDF  QA  M
Sbjct: 221 LNQASDAFSRRFRVTRPGLKRAHWVDDPEKLKQKVETIMFDAEVFLSEEDFCKQARTM 278


>gi|82701221|ref|YP_410787.1| OstA-like protein [Nitrosospira multiformis ATCC 25196]
 gi|82409286|gb|ABB73395.1| OstA-like protein [Nitrosospira multiformis ATCC 25196]
          Length = 190

 Score = 37.7 bits (86), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 28/41 (68%)

Query: 43 EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
          + +H++AD   V+DA + A F GNV +TQ    ++ADKMT+
Sbjct: 39 KPVHLEADRATVQDANKLATFIGNVVLTQGTLIIRADKMTV 79


>gi|253701986|ref|YP_003023175.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M21]
 gi|251776836|gb|ACT19417.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M21]
          Length = 162

 Score = 37.4 bits (85), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
            + GNE + +K+D L   +  + A F+G V   Q + +L  D++ +    ++    N+++
Sbjct: 22  PISGNEPLKVKSDNLTADNEKKTATFEGKVVAHQGELTLYTDRLVV----SSAGDGNELS 77

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           +++   N+ I  G       +   D ++ +++L+G+
Sbjct: 78  KVEAFGNVRILQGNRQATGGHAVYDPKRGVILLDGN 113


>gi|16127831|ref|NP_422395.1| hypothetical protein CC_3601 [Caulobacter crescentus CB15]
 gi|13425347|gb|AAK25563.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 189

 Score = 37.4 bits (85), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 10/135 (7%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-----NTNRDVSNKINR 98
            + + AD  E  ++     F GNV + Q    L+A+K+TI YN       N +      R
Sbjct: 36  PVDVSADNQETINSKCLIIFTGNVEILQNRSRLRAEKVTI-YNAKRPTAENANACGNAQR 94

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           M+ E  +++ + + N         F     VL GD    VIL +  +   G +L VN  T
Sbjct: 95  MEAEGGVYLVNEQQNARGDRAVYTFSNNTAVLTGD----VILVKGNDVARGDRLTVNTKT 150

Query: 159 SFASLQGCESDQVQS 173
           + A L+   + +  +
Sbjct: 151 NDAKLESTSTGRTAT 165


>gi|254453115|ref|ZP_05066552.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
          238]
 gi|198267521|gb|EDY91791.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
          238]
          Length = 143

 Score = 37.4 bits (85), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 44 KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
           + I AD L +  A   A F GNV   Q D  L A ++ + YN+ + D+S
Sbjct: 19 PVEITADSLSIDQASGTAIFIGNVVFGQGDLRLNAARVQVIYNDASGDIS 68


>gi|240139045|ref|YP_002963520.1| hypothetical protein MexAM1_META1p2464 [Methylobacterium extorquens
           AM1]
 gi|240009017|gb|ACS40243.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 242

 Score = 37.4 bits (85), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 61/146 (41%), Gaps = 27/146 (18%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVS------ 93
           G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y  + ++D S      
Sbjct: 43  GKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPSKDAAKS 102

Query: 94  ----------------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
                           N I +++    + +   +      N   D + + +VL G+    
Sbjct: 103 EAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTGN---- 158

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASL 163
           V+L +  N   G +L+ ++ +  A++
Sbjct: 159 VVLSQCQNVTRGSRLVYDMASGRANM 184


>gi|221236651|ref|YP_002519088.1| protein yhbN [Caulobacter crescentus NA1000]
 gi|220965824|gb|ACL97180.1| protein yhbN precursor [Caulobacter crescentus NA1000]
          Length = 186

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 10/135 (7%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-----NTNRDVSNKINR 98
            + + AD  E  ++     F GNV + Q    L+A+K+TI YN       N +      R
Sbjct: 33  PVDVSADNQETINSKCLIIFTGNVEILQNRSRLRAEKVTI-YNAKRPTAENANACGNAQR 91

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           M+ E  +++ + + N         F     VL GD    VIL +  +   G +L VN  T
Sbjct: 92  MEAEGGVYLVNEQQNARGDRAVYTFSNNTAVLTGD----VILVKGNDVARGDRLTVNTKT 147

Query: 159 SFASLQGCESDQVQS 173
           + A L+   + +  +
Sbjct: 148 NDAKLESTSTGRTAT 162


>gi|254561640|ref|YP_003068735.1| hypothetical protein METDI3227 [Methylobacterium extorquens DM4]
 gi|254268918|emb|CAX24879.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 246

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINR 98
           G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y  + ++D S   N+
Sbjct: 43  GKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPSKDANK 101


>gi|218662089|ref|ZP_03518019.1| hypothetical protein RetlI_22725 [Rhizobium etli IE4771]
          Length = 54

 Score = 37.0 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           D+ +KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 1   DQGNKVILSDGPNVFTGCKLTVHMQTGRAELESC 34


>gi|323136909|ref|ZP_08071989.1| OstA family protein [Methylocystis sp. ATCC 49242]
 gi|322397670|gb|EFY00192.1| OstA family protein [Methylocystis sp. ATCC 49242]
          Length = 179

 Score = 36.6 bits (83), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 76/180 (42%), Gaps = 27/180 (15%)

Query: 9   HLYIHLLALVFVLLKADLSQAAA-SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           H    +LA  F+L     +QAA  S          + ++I A  L+  D  QK  + G+V
Sbjct: 3   HTAFAVLA-AFLLAGVAPAQAAGRSGGILPGATAKDPLNIDAGKLDFFDKEQKLVYSGSV 61

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            +T    +L+A K+TI   N     +   +   V+            I ++G V    + 
Sbjct: 62  IVTNGPSTLKASKITIFLENKGAAAAGATSNDRVKH-----------IDADGPVTLVSKD 110

Query: 128 LVLNGDRA--DK----------VILKEKLNTFLGCKLIVNIDTSFASLQ--GCESDQVQS 173
            +  GDRA  DK          V L +  N   G +L+ ++ T+ A++Q  G +  +V+S
Sbjct: 111 QIGTGDRASYDKAENKVYLTGNVTLTQGENVVKGERLVYDVTTAIATVQGGGAQGGRVRS 170


>gi|327398725|ref|YP_004339594.1| lipopolysaccharide transport periplasmic protein LptA [Hippea
          maritima DSM 10411]
 gi|327181354|gb|AEA33535.1| lipopolysaccharide transport periplasmic protein LptA [Hippea
          maritima DSM 10411]
          Length = 166

 Score = 36.6 bits (83), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 12 IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
          I  LA++ + L A L+    SY+ +    GN  IHI AD L   D      F+G V  T+
Sbjct: 6  IVFLAILLIGLNA-LAVNPKSYIKK----GNIPIHITADKLTAFDKKGLYIFEGGVVATR 60

Query: 72 EDFSLQADKMTIDYNNTNRDVS 93
           D  L +DKM +  +    D+ 
Sbjct: 61 GDVRLTSDKMEVYKDKKTGDIG 82


>gi|297570148|ref|YP_003691492.1| lipopolysaccharide transport periplasmic protein LptA
          [Desulfurivibrio alkaliphilus AHT2]
 gi|296926063|gb|ADH86873.1| lipopolysaccharide transport periplasmic protein LptA
          [Desulfurivibrio alkaliphilus AHT2]
          Length = 212

 Score = 36.6 bits (83), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 43 EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
          E + I+AD +E  D      F+G V   Q D  + AD MTI
Sbjct: 30 EPVRIEADRMETGDEPNSVLFRGQVVARQGDLVIHADTMTI 70


>gi|225851254|ref|YP_002731488.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
 gi|225646594|gb|ACO04780.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
          Length = 156

 Score = 36.2 bits (82), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 71/135 (52%), Gaps = 14/135 (10%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E I I+AD L        A +KGNV + + + ++ A+KM I Y +   D+S    R+  E
Sbjct: 24  EPILIEADELVYNKNENTAVYKGNVTVKKGNLTINAEKMII-YLSEEGDIS----RIYAE 78

Query: 103 RNIFIQSGEINVIASNGYVDF--QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
            ++  + G  N   S+   ++   K I+VL     DK  L ++ N   G ++I ++DT  
Sbjct: 79  GDVRFKKG--NRSGSSKKAEYIKDKDIIVL----IDKAKLIQEKNIIEGDEIIYHLDTEV 132

Query: 161 ASLQGCESDQVQSII 175
           A ++G + ++V+++I
Sbjct: 133 AEVKG-KDNKVRTVI 146


>gi|218530673|ref|YP_002421489.1| OstA family protein [Methylobacterium chloromethanicum CM4]
 gi|218522976|gb|ACK83561.1| OstA family protein [Methylobacterium chloromethanicum CM4]
          Length = 246

 Score = 36.2 bits (82), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINR 98
           G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y  + ++D +   N+
Sbjct: 43  GKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPAKDANK 101


>gi|197117259|ref|YP_002137686.1| cell envelope biogenesis ABC transporter periplasmic protein
           [Geobacter bemidjiensis Bem]
 gi|197086619|gb|ACH37890.1| cell envelope biogenesis ABC transporter, periplasmic protein
           [Geobacter bemidjiensis Bem]
          Length = 162

 Score = 36.2 bits (82), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
            + GNE + +K+D L   +  + A F+G V   Q + +L  D++ +    ++    N+++
Sbjct: 22  PISGNEPLKVKSDNLTADNEKKTATFEGKVVAHQGELTLYTDRLVV----SSAGDGNELS 77

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           +++   N+ I  G       +   D ++ +++L+G+
Sbjct: 78  KVEAFGNVRILQGIRQATGGHAVYDPKRGVILLDGN 113


>gi|114769795|ref|ZP_01447405.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|114549500|gb|EAU52382.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|161170291|gb|ABX59261.1| uncharacterized protein conserved in bacteria [uncultured marine
           bacterium EB000_55B11]
 gi|297183819|gb|ADI19942.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 160

 Score = 36.2 bits (82), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + I A+ L +  +   A F+G  ++ Q    L ADK+ + Y   N+D + K+  ++ 
Sbjct: 36  NLPVEITANNLSINQSSNSAIFEGTAYVGQGSLRLSADKIVVRY---NQD-TGKVTSVEA 91

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              +   +GE    A +        +L ++G+    V+L +  +T  G  L ++I  + A
Sbjct: 92  TGKVVFTNGEDIAEAESAIYKIDSGLLSMSGN----VLLVQGKSTISGNYLDMDILKNIA 147

Query: 162 SLQG 165
           +L G
Sbjct: 148 NLSG 151


>gi|163851922|ref|YP_001639965.1| OstA family protein [Methylobacterium extorquens PA1]
 gi|163663527|gb|ABY30894.1| OstA family protein [Methylobacterium extorquens PA1]
          Length = 242

 Score = 36.2 bits (82), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 61/146 (41%), Gaps = 27/146 (18%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVS------ 93
           G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y  + ++D +      
Sbjct: 43  GKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPAKDAAKS 102

Query: 94  ----------------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
                           N I +++    + +   +      N   D + + +VL G+    
Sbjct: 103 EAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTGN---- 158

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASL 163
           V+L +  N   G +L+ ++ +  A++
Sbjct: 159 VVLSQCQNVTRGSRLVYDMASGRANM 184


>gi|115522456|ref|YP_779367.1| OstA-like protein [Rhodopseudomonas palustris BisA53]
 gi|115516403|gb|ABJ04387.1| OstA family protein [Rhodopseudomonas palustris BisA53]
          Length = 229

 Score = 35.8 bits (81), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/201 (19%), Positives = 83/201 (41%), Gaps = 35/201 (17%)

Query: 4   FLNSIHLYIHLLALVFVLLKAD--LSQAAAS----YMTRFKVLGNEKIHIKADMLEVKDA 57
            + S+ +   +   V  LL     L+Q A S     M  F    ++ I I+A  LEV+D 
Sbjct: 12  LMKSLLIAAAVTGCVAGLLGGTPALAQGAVSGVPNAMQGFSQNRDQPIQIEAASLEVRDK 71

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDYN------------------------NTNRDVS 93
            ++A F G+V + Q D ++ +  + + Y+                        +      
Sbjct: 72  KKEATFTGDVKVVQGDTTMTSKVLVVFYDQDPASGSAAPAAKAKAGAKPQMAASPGPGGG 131

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           + I R++ + N+ +   +  V       D +  ++ + G    +V+L +  N   G +L+
Sbjct: 132 SSIRRLEAKGNVVVTQKDQVVTGDTAVFDTKTNLVTMLG----RVVLTQGGNVLRGDRLL 187

Query: 154 VNIDTSFASLQGCESDQVQSI 174
           V++ T  + ++   S +VQ +
Sbjct: 188 VDMTTGVSRVE-SGSGRVQGL 207


>gi|270006501|gb|EFA02949.1| odorant receptor 165 [Tribolium castaneum]
          Length = 380

 Score = 35.8 bits (81), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 56/123 (45%), Gaps = 29/123 (23%)

Query: 74  FSLQADKMT-IDYNNTNRDVS-----------------NKI-NRMDVERNIFIQSGEINV 114
           F L  DK+T ID N+T  ++                  NK+ N +D    +FI  G ++ 
Sbjct: 204 FRLINDKITEIDQNSTQNEICGTLRLCISHHIALKRWMNKLANSVDTAMPVFILLGALST 263

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSI 174
           IA    V F     VLN  ++  VILK +L T   C LIV    +FA L    SDQ  S+
Sbjct: 264 IA----VSF----FVLNTLQSTSVILKIRLATITVCNLIV--VATFAELGQIFSDQNNSL 313

Query: 175 IRY 177
           + +
Sbjct: 314 LEH 316


>gi|253997531|ref|YP_003049595.1| lipopolysaccharide transport periplasmic protein LptA
          [Methylotenera mobilis JLW8]
 gi|253984210|gb|ACT49068.1| lipopolysaccharide transport periplasmic protein LptA
          [Methylotenera mobilis JLW8]
          Length = 226

 Score = 35.4 bits (80), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 28/42 (66%)

Query: 42 NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
          ++ I ++AD ++V DA Q + + GNV +TQ    ++ADK+ +
Sbjct: 38 DKPIDLEADTMKVDDAKQISTYSGNVILTQGTLEIRADKLIV 79


>gi|261884644|ref|ZP_06008683.1| OstA-like protein [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 90

 Score = 35.4 bits (80), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
           R   +Q G        G  D   +I+VL G    KV+L +  N   GCKL  ++DT  A+
Sbjct: 3   RAGCLQVGTQVATGDTGRYDAINQIMVLQGQ---KVVLTDGDNIVTGCKLTAHLDTGRAN 59

Query: 163 LQGCES 168
           ++ C+ 
Sbjct: 60  VESCKG 65


>gi|149191633|ref|ZP_01869877.1| organic solvent tolerance protein [Vibrio shilonii AK1]
 gi|148834533|gb|EDL51526.1| organic solvent tolerance protein [Vibrio shilonii AK1]
          Length = 772

 Score = 35.4 bits (80), Expect = 3.3,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E I+I+AD LE     Q+A +KG+V + Q + ++ AD +T+           K N +  E
Sbjct: 54  EPINIEADSLEAISG-QRATYKGDVVVVQGNKTITADNVTL---------HQKENIVVAE 103

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVL 130
            N+ +  GEI  ++     +  K  + L
Sbjct: 104 GNVVMNDGEIRAVSDKATNNLNKDEITL 131


>gi|77166243|ref|YP_344768.1| OstA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|254435695|ref|ZP_05049202.1| cell envelope biogenesis protein YhbN, putative [Nitrosococcus
          oceani AFC27]
 gi|76884557|gb|ABA59238.1| OstA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|207088806|gb|EDZ66078.1| cell envelope biogenesis protein YhbN, putative [Nitrosococcus
          oceani AFC27]
          Length = 275

 Score = 35.4 bits (80), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 43 EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
          + IHI+A+  E+ D    A + GNV +TQ    + +D +TI Y 
Sbjct: 35 QPIHIEANRGELDDREHVAVYSGNVHLTQGTLRIDSDTLTIYYT 78


>gi|46105148|ref|XP_380378.1| hypothetical protein FG00202.1 [Gibberella zeae PH-1]
          Length = 948

 Score = 35.0 bits (79), Expect = 4.6,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID-----YNNTNRDVSNKINRMDVERN 104
           + LE +D V+KAFFKGN + T  +  L  D + I      +N+T  ++   I  +++ER 
Sbjct: 332 ESLETRDEVEKAFFKGNPWATMPEEDLGIDNLRIKLSGFLFNHTRNNLPGVI--VEIERK 389

Query: 105 I 105
           +
Sbjct: 390 L 390


>gi|188581679|ref|YP_001925124.1| OstA family protein [Methylobacterium populi BJ001]
 gi|179345177|gb|ACB80589.1| OstA family protein [Methylobacterium populi BJ001]
          Length = 250

 Score = 35.0 bits (79), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 41 GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
          G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y
Sbjct: 51 GKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHY 95


>gi|74316553|ref|YP_314293.1| OstA-like family protein [Thiobacillus denitrificans ATCC 25259]
 gi|74056048|gb|AAZ96488.1| OstA-like family protein [Thiobacillus denitrificans ATCC 25259]
          Length = 177

 Score = 34.7 bits (78), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 63/145 (43%), Gaps = 10/145 (6%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           ++ I+++AD + + D  + + ++GNV +TQ   +L+AD+M +  N    D  +   R   
Sbjct: 29  DKPINLEADTVTLDDIKKVSVYQGNVILTQGTLTLRADRMQLTQNAAGLDKVSATGRPVA 88

Query: 102 ERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
            R       E I   A+    D     L L GD      L+   +   G ++  N D+ F
Sbjct: 89  FRQKVDGRDEFIEGFAARIEFDNTTSELDLIGD----ARLRRGEDELRGARISYNSDSGF 144

Query: 161 ASL-----QGCESDQVQSIIRYDGR 180
             +      G    +V+++IR   R
Sbjct: 145 YKVVGQNGAGSPGGRVRAVIRPKPR 169


>gi|254426833|ref|ZP_05040540.1| cell envelope biogenesis protein YhbN, putative [Alcanivorax sp.
           DG881]
 gi|196193002|gb|EDX87961.1| cell envelope biogenesis protein YhbN, putative [Alcanivorax sp.
           DG881]
          Length = 199

 Score = 34.7 bits (78), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            I + AD    +       ++GNV + Q    L AD+M +   N +      + R++   
Sbjct: 32  PIQVTADSGRFEQDAGSGLYRGNVELIQGKRKLFADEMRLFTKNGD------LVRVEATG 85

Query: 104 N-IFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           + + ++ GE +N  A N   D   R LVL GD      ++ + NTF G K+  ++D+
Sbjct: 86  SPVRMEEGEGLNAHAENLVYDINARTLVLTGD----AYIEHQGNTFEGAKVEYSLDS 138


>gi|225850091|ref|YP_002730325.1| putative organic solvent tolerance protein [Persephonella marina
           EX-H1]
 gi|225645734|gb|ACO03920.1| putative organic solvent tolerance protein [Persephonella marina
           EX-H1]
          Length = 682

 Score = 34.7 bits (78), Expect = 6.0,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 13/91 (14%)

Query: 33  YMTRFKVLG---NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           Y+  F V G   N  + I+AD +E +D   +   +GNV +   D++L AD++  D     
Sbjct: 13  YICFFSVYGQSQNIPVSIEADRIE-RDLSGRLIAEGNVVVHYRDYTLYADRIIYD---QE 68

Query: 90  RDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           +D+ N      +ERNI I++   +++   G+
Sbjct: 69  KDIIN------LERNIRIKAKNFDLMGEKGW 93


>gi|239787677|emb|CAX84185.1| OstA-like family protein [uncultured bacterium]
          Length = 277

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 10/135 (7%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS 109
           D LE  +A + A  +G+ F+  ED  L+AD +T D    +++   +I R D   N+ +++
Sbjct: 143 DSLEYWEAKRVAVARGDAFIQHEDKRLRADTITADLKE-DKNGKLEIKRADAFGNVLVRT 201

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS----FASLQG 165
                    G      ++  L G+    V +    N   G    VN+ T     F +  G
Sbjct: 202 PTDIATGDKGVYFTDTQLATLTGN----VKITRDKNQLNGGYAEVNLATGISRLFPAPPG 257

Query: 166 -CESDQVQSIIRYDG 179
             +  +VQ I+  DG
Sbjct: 258 NAQGTRVQGILMPDG 272


>gi|322388466|ref|ZP_08062069.1| peptidase M16 inactive domain protein [Streptococcus infantis ATCC
           700779]
 gi|321140779|gb|EFX36281.1| peptidase M16 inactive domain protein [Streptococcus infantis ATCC
           700779]
          Length = 416

 Score = 34.3 bits (77), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
           +   NR   NK+ ++  ++ + I++G       N   +  +R ++L+ D  D +I +E L
Sbjct: 312 FAGINRQNRNKVRKLMNDQLLAIKNGRFTDSEVNQTKEMIRRTMLLSQDNQDSIIDREYL 371

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQV 171
           + F G K ++++DT    L+  + D++
Sbjct: 372 SLFFG-KSVLDLDTLIERLEQVDKDEI 397


>gi|7388537|sp|Q52784|YNTX_RHIET RecName: Full=Uncharacterized protein in rpoN-linked probable
           transport protein 5'region
 gi|1046229|gb|AAA80298.1| unknown [Rhizobium leguminosarum bv. phaseoli]
          Length = 54

 Score = 34.3 bits (77), Expect = 8.0,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
            +KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 1   GNKVILSDGPNVFTGCKLTVHMQTGQAELESC 32


>gi|167648911|ref|YP_001686574.1| OstA family protein [Caulobacter sp. K31]
 gi|167351341|gb|ABZ74076.1| OstA family protein [Caulobacter sp. K31]
          Length = 196

 Score = 33.9 bits (76), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 24/124 (19%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN------------NTNRD 91
            + I AD  EV  +  K  F+G V + Q+   ++A  MT+ YN              N D
Sbjct: 41  PVDISADEQEVITSQCKTIFRGAVEVLQDKARMRAATMTV-YNRRKAPGKASSAPGGNND 99

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD----------RADKVILK 141
             + ++ ++ + N+F  + E  V   +   D+    +V+ GD          R D++ +K
Sbjct: 100 CGD-VDHVEADGNVFYVTPEQTVRGDHAVYDYATDTIVVTGDVVAVQGQDVARGDRMTIK 158

Query: 142 EKLN 145
            K N
Sbjct: 159 TKTN 162


>gi|119713541|gb|ABL97593.1| hypothetical protein MBMO_EB0-39F01.0004 [uncultured marine
           bacterium EB0_39F01]
          Length = 153

 Score = 33.9 bits (76), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 4/70 (5%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + I A+ L +  +   A F+G  ++ Q    L ADK+ + YN      + K+  ++ 
Sbjct: 36  NLPVEITANNLSINQSSNSAIFEGTAYVGQGSLRLSADKIVVRYNQD----TGKVTSVEA 91

Query: 102 ERNIFIQSGE 111
              +   +GE
Sbjct: 92  TGKVVFTNGE 101


>gi|163784675|ref|ZP_02179499.1| hypothetical protein HG1285_12282 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880057|gb|EDP73737.1| hypothetical protein HG1285_12282 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 164

 Score = 33.9 bits (76), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I I+AD  E  +  + A +K NV + + DF+L ++ M + +     D ++KI  +  E N
Sbjct: 30  IVIEADSFEYDNKQKIAVYKDNVIVRKGDFTLWSNLMRVYF-----DENSKIKEIIAEGN 84

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           +  + G     A+ G  +  K I+ L G+     ++K+K N   G ++I  +    A + 
Sbjct: 85  VKFEKGLYKGKANKGIYNANKEIIRLIGN----AMVKKKSNILEGDEIIYYMKEDKAVVI 140

Query: 165 GCESDQVQSII 175
           G ++ +V++II
Sbjct: 141 G-KNKKVRTII 150


Searching..................................................done


Results from round 2




>gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040422|gb|ACT57218.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 181

 Score =  223 bits (569), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 181/181 (100%), Positives = 181/181 (100%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK
Sbjct: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY
Sbjct: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR
Sbjct: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180

Query: 181 P 181
           P
Sbjct: 181 P 181


>gi|116250189|ref|YP_766027.1| outer membrane OstA family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254837|emb|CAK05911.1| putative outer membrane OstA family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 213

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 55/201 (27%), Positives = 88/201 (43%), Gaps = 22/201 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           +S     +       AL+     A   QA A+ M   K+  ++ I I++D LE++D    
Sbjct: 7   ISTCKTGMAFIAGAFALILTASGAGAQQATAT-MPGMKLSNDQPIQIESDKLEIRDQEHT 65

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR--------------------DVSNKINRMD 100
           A F GNV + Q   ++Q+ KMT+ Y +                         S  I+++ 
Sbjct: 66  ALFTGNVKVVQGTTTMQSGKMTVYYKDKAAKPAADGAQPAAQPDQSASLASGSADIDKIL 125

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
           V   +F+ SG     A +G  D   +  +L  D  +KVIL +  N F GCKL V++ T  
Sbjct: 126 VTDKVFLSSGTQTATADDGNFDMASQTFILTADEGNKVILSDGPNVFTGCKLTVHMQTGQ 185

Query: 161 ASLQGCESDQVQSIIRYDGRP 181
           A L+ C   +VQ  +    +P
Sbjct: 186 AELESC-GGRVQIQLDPKSQP 205


>gi|190890074|ref|YP_001976616.1| hypothetical protein RHECIAT_CH0000444 [Rhizobium etli CIAT 652]
 gi|190695353|gb|ACE89438.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327193442|gb|EGE60340.1| hypothetical protein RHECNPAF_159005 [Rhizobium etli CNPAF512]
          Length = 212

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 53/201 (26%), Positives = 86/201 (42%), Gaps = 23/201 (11%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           +SA    +       AL+  +  A   QA    M+  K+  ++ I I++D LE+ D    
Sbjct: 7   ISACKTGVAFIAGAFALILTVSGAAAQQATT--MSGMKLSNDQPIQIESDKLEIHDQEHT 64

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR--------------------DVSNKINRMD 100
           A F G V + Q   ++Q+ KMT+ Y +                         S  I+++ 
Sbjct: 65  ALFTGKVKVVQGTTTMQSGKMTVYYKDKAAKPAADGAQPAAQPEKSASLASGSADIDKIL 124

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
           V   + + SG     A +G  D   +   L  D+ +KVIL +  N F GCKL V++ T  
Sbjct: 125 VTDKVLLTSGTQTATADDGKFDMASQTFTLTADQGNKVILSDGPNVFTGCKLTVHMQTGQ 184

Query: 161 ASLQGCESDQVQSIIRYDGRP 181
           A L+ C   +VQ  +    +P
Sbjct: 185 AELESC-GGRVQIQLDPKSQP 204


>gi|241202816|ref|YP_002973912.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856706|gb|ACS54373.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 204

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 54/198 (27%), Positives = 84/198 (42%), Gaps = 26/198 (13%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +       AL+     A   QA A+ M   K+  ++ I I++D LE+ D    A F GNV
Sbjct: 1   MAFIAGAFALILTASGAGAQQATAT-MPGMKLSNDQPIQIESDKLEIHDQEHTALFTGNV 59

Query: 68  FMTQEDFSLQADKMTIDYNNTNR------------------------DVSNKINRMDVER 103
            + Q   ++Q+ KMT+ Y +                             S  I+++ V  
Sbjct: 60  KVVQGATTMQSGKMTVYYKDKAAKPATDGTQPAAQPAAQPQQSASLASGSADIDKILVTD 119

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            +F+ SG     A +G  D   +  +L  D   KVIL +  N F GCKL V++ T  A L
Sbjct: 120 KVFLTSGTQTATADDGNFDMASQTFILTADEGKKVILSDGPNVFTGCKLTVHMQTGQAEL 179

Query: 164 QGCESDQVQSIIRYDGRP 181
           + C   +VQ  +    +P
Sbjct: 180 ESC-GGRVQIQLDPKSKP 196


>gi|319406418|emb|CBI80058.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 199

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 19/177 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL L   +L +    AA ++     + G E + + AD LE++D    A F G+V + Q
Sbjct: 11  VSLLTLSLAILGSINGYAAVTHFGIDGLNGQEPMELYADSLEIRDKEGIAVFNGDVSVMQ 70

Query: 72  EDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQSGEINVI 115
            +  L+  K+ I YN  +                +  S  I +++    ++I+  +    
Sbjct: 71  GERLLRTSKLVIYYNKAHITGGINQLRRQSIFPEKIGSTDIQKVEALGEVYIKMAKQTAT 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC++ + +
Sbjct: 131 GDKAIFDGQSNMIILTGN---NVVLTDGDNVAQGCILTANMKTGKASLEGCKTPRKK 184


>gi|319898207|ref|YP_004158300.1| hypothetical protein BARCL_0016 [Bartonella clarridgeiae 73]
 gi|319402171|emb|CBI75697.1| conserved exported protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 215

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 43/178 (24%), Positives = 76/178 (42%), Gaps = 19/178 (10%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++ +L L   +L +    A  ++     + G E + I AD LE++D    A   GNV + 
Sbjct: 26  WVSILVLSMAILGSVNGYARVTHFGIDGLNGKEPMEIHADSLEIRDKEGIAILNGNVSVM 85

Query: 71  QEDFSLQADKMTIDYNNT----------------NRDVSNKINRMDVERNIFIQSGEINV 114
           Q +  L+  K+ I YN                   +  S  I +++    ++I+     V
Sbjct: 86  QSERLLRTSKLVIYYNKAHVTNDINQLITKSVFSGKIGSTDIKKVEASGEVYIKMATQTV 145

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
                  D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC++   +
Sbjct: 146 TGDKAIFDGQSNMIILTGN---NVVLTDGDNVATGCTLTANMKTGKASLEGCKTSGKK 200


>gi|209547658|ref|YP_002279575.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533414|gb|ACI53349.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 211

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 86/201 (42%), Gaps = 23/201 (11%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           +S     +       ALV     A   QAA   M+  K+  ++ I I++D LE+ D    
Sbjct: 7   ISTCKTGLAFIAGAFALVLTASGAGAQQAAT--MSGMKLSNDQPIQIESDKLEIHDQEHT 64

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR--------------------DVSNKINRMD 100
           A F G V + Q   ++Q+ KMT+ Y +                         S  I+++ 
Sbjct: 65  ALFTGKVKVVQGTTTMQSGKMTVYYKDKAAKPAADGTQPAAQPQQSASLASGSADIDKIL 124

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
           V   + + SG     A +G  D   +  +L  D+ +KVIL +  N F GCKL V++ T  
Sbjct: 125 VTDKVLLTSGTQTATADDGKFDMASQTFILTADQGNKVILSDGPNVFTGCKLTVHMQTGQ 184

Query: 161 ASLQGCESDQVQSIIRYDGRP 181
           A L+ C   +VQ  +    +P
Sbjct: 185 AELESC-GGRVQIQLDPKSQP 204


>gi|325291769|ref|YP_004277633.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
 gi|325059622|gb|ADY63313.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
          Length = 218

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 87/171 (50%), Gaps = 12/171 (7%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           SA + +       LA V        +Q   S MT  K+ G++ I I++D LE++D  +KA
Sbjct: 43  SAGVTAAAFAFSCLATV------AFAQNTTSNMTGVKLSGDQPIAIESDQLEIRDQERKA 96

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEINVIASN 118
           +F GNV + Q   +LQA KMT++Y      +++    I ++ V+ N+++ S      A +
Sbjct: 97  YFTGNVKVVQGTTTLQAGKMTVNYKGEGSSLTSGDANIEKIFVDNNVYLTSETQKATADH 156

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
           G  D   +  +L G +   V+L E  N F GCKL V +++  A L+ C   
Sbjct: 157 GEFDMAAQTFILTGKQ---VVLSEGANVFTGCKLTVLMNSGQAKLESCGGP 204


>gi|319403504|emb|CBI77083.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 199

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 23/189 (12%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL L   +L +    AA ++     + G E + + AD LE++D    A F G+V + Q
Sbjct: 11  VSLLTLSLAILGSINGYAAVTHFGIDGLNGQEPMELYADSLEIRDKEGIAVFNGDVSVMQ 70

Query: 72  EDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQSGEINVI 115
            +  L+  K+ I YN  +                +  S  I +++    ++I+  +    
Sbjct: 71  GERLLRTSKLVIYYNKAHITGGINQLRKQSIFPEKIGSTDIQKVEALGEVYIKMAKQTAT 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD----QV 171
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC++     +V
Sbjct: 131 GDKAIFDGQSNMIILTGN---NVVLTDGDNVAQGCILTANMKTGKASLEGCKTPGKKNRV 187

Query: 172 QSIIRYDGR 180
             I++   +
Sbjct: 188 SIILKSSSK 196


>gi|86356059|ref|YP_467951.1| hypothetical protein RHE_CH00402 [Rhizobium etli CFN 42]
 gi|86280161|gb|ABC89224.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 174

 Score =  177 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 78/169 (46%), Gaps = 22/169 (13%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--- 90
           M+  K+  ++ I I++D LE+ D    A F GNV + Q   ++Q+ KMT+ Y +      
Sbjct: 1   MSGMKLSNDQPIQIESDKLEIHDQEHTALFTGNVKVVQGTTTMQSGKMTVYYKDKAAKSG 60

Query: 91  ------------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
                               S  I+++ V   +++ SG     A +G  D   +  +L  
Sbjct: 61  AGAPAQPEAKPEKSASLASGSADIDKILVTDKVYLVSGTQTATADDGNFDMASQTFILTA 120

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           D+ +KVIL +  N F GCKL V++ T  A L+ C   +VQ  +    +P
Sbjct: 121 DQGNKVILSDGPNVFTGCKLTVHMQTGQAELESC-GGRVQIQLDPKSQP 168


>gi|319404928|emb|CBI78528.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 199

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 44/177 (24%), Positives = 76/177 (42%), Gaps = 19/177 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + +LAL   +L +    AA ++     + G E + + AD LE++D    A   GNV + Q
Sbjct: 11  VSILALSLAILGSINGYAAVTHFGFDGLNGKEPMELYADSLEIRDKEGIAILNGNVSVMQ 70

Query: 72  EDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQSGEINVI 115
            +  LQ  K+ I YN  +                +  S  I +++    ++I+       
Sbjct: 71  GERLLQTSKLAIYYNKAHITGGINQLRTQSIFPEKIGSTDIKKVEALGEVYIKVATQTAK 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC+    +
Sbjct: 131 GDKAIFDGQSNMIILTGN---NVVLTDGDNVAEGCILTANMKTGKASLEGCKEPGKK 184


>gi|159184263|ref|NP_353366.2| hypothetical protein Atu0334 [Agrobacterium tumefaciens str. C58]
 gi|159139590|gb|AAK86151.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 187

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 12/171 (7%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +A L +  L+   LA V        +Q   S M   K+ G++ I I++D LE++D  +KA
Sbjct: 13  TAGLTAAGLFFSCLATV------AFAQNTTSSMQGVKLSGDQPIAIESDQLEIRDQERKA 66

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEINVIASN 118
           +F GNV + Q   +LQA KMT++Y      +++    I ++ V+ N+++ S      A +
Sbjct: 67  YFTGNVKVVQGTTTLQAGKMTVNYKGQGSSLTSGDANIEKIFVDNNVYLTSETQKATADH 126

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
           G  D   +  +L G    +V+L E  N F GCKL V ++T  A L+ C   
Sbjct: 127 GEFDMAAQTFILTG---KQVVLSEGTNVFTGCKLTVLMNTGQAKLESCGGP 174


>gi|163867321|ref|YP_001608515.1| hypothetical protein Btr_0016 [Bartonella tribocorum CIP 105476]
 gi|161016962|emb|CAK00520.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 215

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 44/194 (22%), Positives = 83/194 (42%), Gaps = 25/194 (12%)

Query: 9   HLYIHLLALVFVLLKAD--LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
                 LA    +L     L  A  +++        E + + AD LE++D    A FKG+
Sbjct: 22  RWIGMTLAFSMGMLGGGTVLGYAEGTHLGISLSNDKEPVELHADSLEIRDKEGIALFKGD 81

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRD----------------VSNKINRMDVERNIFIQSG 110
           V + Q +  L+  K+ + Y+  +++                 S+ I +M+    ++I+  
Sbjct: 82  VSVMQGERLLRTAKLVVYYDKAHKETDKNKEDTKASSVALLGSSGIKKMEAVGKVYIKIA 141

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-- 168
                   G  D + +++ L G     V+LK+  N   GCKL  N+++  A L+GCE+  
Sbjct: 142 TQIATGDKGVFDGKSKMMSLTGKH---VVLKDGDNVATGCKLTANMESGKAFLEGCETTN 198

Query: 169 --DQVQSIIRYDGR 180
              +V  I + + +
Sbjct: 199 KKGRVSIIFKQNQK 212


>gi|307943002|ref|ZP_07658347.1| OstA family protein [Roseibium sp. TrichSKD4]
 gi|307773798|gb|EFO33014.1| OstA family protein [Roseibium sp. TrichSKD4]
          Length = 183

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 86/181 (47%), Gaps = 9/181 (4%)

Query: 4   FLNSIHLYIHLLALVFVLLKADL-SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
             N+++  + ++  +  L  A + +Q  ++    F    ++ I I+A  L+V+D    A 
Sbjct: 1   MYNTLYRLMGIVVTLGALAIAPVSAQTFSNAFEGFGSNDDDPIQIEASELQVEDKNNLAI 60

Query: 63  FKGNVFMTQEDFSLQADKMTIDYN-----NTNRDVSNKINRMDVERNIFIQSGEINVIAS 117
           F GNV +TQ +  L+  ++ + Y+              I+R++    +FI S        
Sbjct: 61  FTGNVVVTQGEAQLKTHRLKVFYDGQGGGAGTGTGQRDISRLEASGRVFISSEGQTATGD 120

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
               D ++ I+V+ G    +V+L +  N  +G KL VN+ T  A LQ  +S +V+ +I+ 
Sbjct: 121 EASFDMKRDIMVMTG---KEVVLSQGPNVVVGNKLTVNLVTGQADLQAPKSGRVKVLIKP 177

Query: 178 D 178
           +
Sbjct: 178 N 178


>gi|319407890|emb|CBI81542.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 199

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 24/181 (13%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L +  L L  V        A  ++         E I + AD LE++D  + A F GNV
Sbjct: 15  LALILGTLGLTMVW-----GHAEEAHFGINLSNSKEPIELHADSLEIRDKEEIAVFSGNV 69

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVS----------------NKINRMDVERNIFIQSGE 111
            + Q +  +Q  ++ + Y+ T++ +                   I +M+    ++I+   
Sbjct: 70  SIVQGERLMQTSQLIVYYDKTHKTIDENKKNIESTSPVGFDVTGIKKMEALGKVYIKIAT 129

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
                  G  D Q   ++L G+   KV+LK+  N   GCKL V++++  A L+GC++ + 
Sbjct: 130 QIATGDKGIFDRQSNRMILTGN---KVVLKDNNNVATGCKLTVHMESGKAFLEGCQAFEK 186

Query: 172 Q 172
           +
Sbjct: 187 K 187


>gi|240849697|ref|YP_002971085.1| OstA family protein [Bartonella grahamii as4aup]
 gi|240266820|gb|ACS50408.1| OstA family protein [Bartonella grahamii as4aup]
          Length = 199

 Score =  172 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 21/183 (11%)

Query: 9   HLYIHLLALVFVLLK--ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
                 LA    +L   A L  A  ++         E + + AD LE++D    A FKG+
Sbjct: 6   RWIGVTLAFSMGMLGGGAVLGYAEVAHFGISLSSDKEPVELHADSLEIRDKEGIALFKGD 65

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRD----------------VSNKINRMDVERNIFIQSG 110
           V + Q +  L+  K+ + Y+   ++                 S+ I +M+    ++I+  
Sbjct: 66  VSVVQGERLLRTAKLVVYYDKAYKEIDKNKEDTKASSVSLFGSSGIQKMEALGKVYIKIA 125

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
                   G  D + +++ L G     V+L +  N   GCKL  N+++  A L+GCE+ +
Sbjct: 126 TQIATGDKGVFDGKSKMMSLTGSH---VVLTDGDNVATGCKLTANMESGKAFLEGCETPK 182

Query: 171 VQS 173
            + 
Sbjct: 183 KKG 185


>gi|150395245|ref|YP_001325712.1| OstA family protein [Sinorhizobium medicae WSM419]
 gi|150026760|gb|ABR58877.1| OstA family protein [Sinorhizobium medicae WSM419]
          Length = 186

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 7/164 (4%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           ++  A  +QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA 
Sbjct: 24  LIASAAFAQATSSRMQGLQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAG 83

Query: 80  KMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            MT+ Y      V++    I+R++V   +F+ SG       +G V+   + +VL G+   
Sbjct: 84  NMTVFYKAGGGSVTSGNADIDRIEVNNKVFLSSGTQQATGESGIVNLTNQTIVLKGE--- 140

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           KV+L E  N F+GC+L V ++T  A L  C   +VQ  +    R
Sbjct: 141 KVVLSEGKNVFVGCQLNVQMNTGEAQLDAC-GGRVQIQLDPQSR 183


>gi|328545551|ref|YP_004305660.1| OstA-like protein [polymorphum gilvum SL003B-26A1]
 gi|326415292|gb|ADZ72355.1| OstA-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 178

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 85/176 (48%), Gaps = 4/176 (2%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
            +  +   +  LAL+ ++      Q  ++    F     E I I+A  L+V+D    A F
Sbjct: 1   MITRLQRMVAALALLVLVPATAAGQTFSNAFAGFGSNDKEPIQIEARELQVEDKTNSATF 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
            G+V ++Q D  L+  ++ + Y+      V  +I R++    ++I S +      +   D
Sbjct: 61  VGDVVVSQGDTRLKTQRLRVFYDGKAAGGVQQRITRLEASGRVYISSKDQTATGDDASFD 120

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             ++++V+ G    +V+L +  N  +G +L +N+DT  A L+   S +V+ +I+ +
Sbjct: 121 MNRKVMVMTG---QEVVLSQGPNVVVGNRLTINLDTGKADLEAPRSGRVKVLIQPN 173


>gi|121602088|ref|YP_989616.1| OstA family protein [Bartonella bacilliformis KC583]
 gi|120614265|gb|ABM44866.1| OstA family protein [Bartonella bacilliformis KC583]
          Length = 200

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 21/181 (11%)

Query: 10  LYIHLLALVFVLLK-ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
                L L   LLK   L  A  ++M      G + I + +D LE+ +    A F  NV 
Sbjct: 10  WVGGFLILSIGLLKWGGLGHAEVAHMGIDLSNGEKPIELYSDSLEIHEKKGIAIFNDNVS 69

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVS----------------NKINRMDVERNIFIQSGEI 112
           + Q +  LQ  K+ + Y+  ++ V                   + +M+   N++I+    
Sbjct: 70  IVQGERLLQTSKLVVYYDQDHQTVGINEVRKKSRLFVGSGLTGVKKMEALGNVYIKIATQ 129

Query: 113 NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
            +    G  D +  ++ L G+    V+LK+  N   GCKL +N+ T  A L+GCE+ + +
Sbjct: 130 IITGDKGIFDGKSNVVTLTGN----VVLKDGRNVATGCKLTINMKTGKALLEGCEASEKK 185

Query: 173 S 173
           S
Sbjct: 186 S 186


>gi|49474847|ref|YP_032888.1| hypothetical protein BH00160 [Bartonella henselae str. Houston-1]
 gi|49237652|emb|CAF26832.1| hypothetical protein BH00160 [Bartonella henselae str. Houston-1]
          Length = 192

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 77/187 (41%), Gaps = 23/187 (12%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
            L+L  + L A    A  ++         E + + A+ LE++D    A F G+V + Q +
Sbjct: 6   ALSLGMLGLGAVSGYAEVAHFGIHLSDDKEPVELYANSLEIRDKEGIALFNGDVSVIQGE 65

Query: 74  FSLQADKMTIDYNNTNRD----------------VSNKINRMDVERNIFIQSGEINVIAS 117
             L+  K+ + Y+ T ++                 S  I +M+    ++I+         
Sbjct: 66  HLLRTAKLVVYYDKTRKEADKNQGNTKTALSTWFGSTGIKKMEALGKVYIKIATQIATGD 125

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQS 173
            G  D + +++ L G     V+L    N   GCKL  ++ +  A L+GC++     +V  
Sbjct: 126 KGVYDGKSKMMSLTG---KNVVLTNGDNVATGCKLTADMKSGKAFLEGCKTSEKKGRVSI 182

Query: 174 IIRYDGR 180
           I +   +
Sbjct: 183 IFKQSQK 189


>gi|49473702|ref|YP_031744.1| hypothetical protein BQ00150 [Bartonella quintana str. Toulouse]
 gi|49239205|emb|CAF25522.1| hypothetical protein BQ00150 [Bartonella quintana str. Toulouse]
          Length = 192

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 41/190 (21%), Positives = 78/190 (41%), Gaps = 23/190 (12%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            I  L +  +    D+  A  +      +   E + + AD LE++D    A F G+V + 
Sbjct: 3   MIFALNVGILGFGEDVGYAEVARFGVHLLNDKEPVELYADSLEIRDKEGIALFNGDVSVV 62

Query: 71  QEDFSLQADKMTIDYNNTNRD----------------VSNKINRMDVERNIFIQSGEINV 114
           Q +  L+  K+ + Y+ T +                  S  I +M+    ++I+      
Sbjct: 63  QGECLLRTAKLVVYYDKTQKVADRDRVDTKAESHARFGSTGIKKMEALGKVYIKIATQIA 122

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQ 170
               G  D + +++ L G     V+L +  N   GCKL  ++++  A L+GCE+     +
Sbjct: 123 TGDKGVFDGESKMMSLTG---RNVVLTDGDNVATGCKLTADMESGKAFLEGCETFEKKGR 179

Query: 171 VQSIIRYDGR 180
           V  I +   +
Sbjct: 180 VSIIFKQSQK 189


>gi|260460503|ref|ZP_05808754.1| OstA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259033608|gb|EEW34868.1| OstA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 196

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 86/189 (45%), Gaps = 18/189 (9%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQ-AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +S  L     AL+ + L    +Q  AAS M+  K+ G++ I I++D LEV  A   A F 
Sbjct: 5   SSTRLVAATSALLLLGLAPSSAQSGAASQMSGLKLSGDQPIQIESDKLEVHQADSTAIFT 64

Query: 65  GNVFMTQEDFSLQADKMTIDYNN--------------TNRDVSNKINRMDVERNIFIQSG 110
           GNV + Q    ++A KMT+ Y                     S  I+ ++V   ++I+S 
Sbjct: 65  GNVTVVQGATMMKAGKMTVYYVKDPNAGAKGTEAAGAAAMTGSANIDHLEVSSKVYIKSN 124

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           +      NG  D + ++LVL+G    +V+L +  N   GCKL V + +  A +  C    
Sbjct: 125 DQVATGDNGTFDMKTQVLVLSG---KEVVLSQGDNVLKGCKLTVQMKSGLAQVDACGGRV 181

Query: 171 VQSIIRYDG 179
           + SI     
Sbjct: 182 IMSITPPPK 190


>gi|13472790|ref|NP_104357.1| hypothetical protein mll3198 [Mesorhizobium loti MAFF303099]
 gi|14023537|dbj|BAB50143.1| mll3198 [Mesorhizobium loti MAFF303099]
          Length = 199

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 79/168 (47%), Gaps = 16/168 (9%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
            +     A+S ++  K+ G++ I I++D LEV+ A   A F GNV + Q    L+A KM 
Sbjct: 23  PSLAQSGASSQVSGLKLSGDKPIQIESDKLEVRQAENLAVFTGNVTVVQGPTLLKAGKMM 82

Query: 83  IDY-------------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
           + Y                    S  I+ ++V   ++I+S +      NG  D + ++LV
Sbjct: 83  VYYVKDPNAAAKGTEAAGAAMTGSANIDHLEVSSKVYIKSDDQVATGDNGTFDMKTQVLV 142

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           L+G    +V+L +  N   GCKL V + T  A++ GC    + S+   
Sbjct: 143 LSG---KEVVLSQGPNVLKGCKLTVQMKTGLANVDGCGGRVIMSMTPP 187


>gi|227820606|ref|YP_002824576.1| putative OstA-like protein [Sinorhizobium fredii NGR234]
 gi|227339605|gb|ACP23823.1| putative OstA-like protein [Sinorhizobium fredii NGR234]
          Length = 187

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 8/174 (4%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
                    ++    L+QA +S M   ++  ++ I I++D LE+KD   KA F GNV + 
Sbjct: 15  LAAAGIGALIIASGALAQATSSRMKGMQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVV 74

Query: 71  QEDFSLQADKMTIDYNNTNR----DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           Q   +LQA  MT+ Y  T        +  I+R++V   +F+ SG        G V+   +
Sbjct: 75  QGTTTLQAGNMTVFYKATEGATITSGNADIDRIEVNNKVFLSSGAQQATGDTGLVNLTNQ 134

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +VL GD   KV+L E  N F+GC+L V +DT  A L+ C   +VQ  +    R
Sbjct: 135 TIVLKGD---KVVLSEGKNVFVGCQLNVQMDTGEAQLEAC-GGRVQIQLDPQSR 184


>gi|222084665|ref|YP_002543194.1| cell envelope biogenesis protein YhbN [Agrobacterium radiobacter
           K84]
 gi|221722113|gb|ACM25269.1| cell envelope biogenesis protein YhbN [Agrobacterium radiobacter
           K84]
          Length = 222

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 76/181 (41%), Gaps = 30/181 (16%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
            AD      S M    +  ++ I I++D LE+ DA  +A F GNV + Q   ++QA KMT
Sbjct: 33  GADAQTTTTSKMPGLALSSDQPIQIESDKLEIHDAESQAVFTGNVKVVQGTTTMQAGKMT 92

Query: 83  IDY--------------------------NNTNRDVSNKINRMDVERNIFIQSGEINVIA 116
           + Y                          N +       I+ + V   +++ SG     A
Sbjct: 93  VFYKKKQPAADAAAKPATDNPVAKAAKEQNQSLVSGDANIDHILVTNKVYLVSGTQTATA 152

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
            +G  D   ++ VL G    KV+L +  N F GC+L V++ T  A L  C   +VQ  + 
Sbjct: 153 DDGSFDMANQLAVLKG---QKVVLTDGPNVFTGCQLTVHMATGEAQLDAC-GGRVQIQLD 208

Query: 177 Y 177
            
Sbjct: 209 P 209


>gi|15964136|ref|NP_384489.1| hypothetical protein SMc01137 [Sinorhizobium meliloti 1021]
 gi|307301281|ref|ZP_07581043.1| OstA family protein [Sinorhizobium meliloti BL225C]
 gi|307317952|ref|ZP_07597389.1| OstA family protein [Sinorhizobium meliloti AK83]
 gi|7404503|sp|P25893|Y383_RHIME RecName: Full=Uncharacterized protein R00383; Flags: Precursor
 gi|15073312|emb|CAC41820.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896354|gb|EFN27103.1| OstA family protein [Sinorhizobium meliloti AK83]
 gi|306903737|gb|EFN34324.1| OstA family protein [Sinorhizobium meliloti BL225C]
          Length = 186

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/156 (34%), Positives = 82/156 (52%), Gaps = 7/156 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA  MT+ Y  
Sbjct: 32  QATSSRMQGLQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGNMTVFYKA 91

Query: 88  TNRDVSNK---INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
               V++    I+R++V   +F+ SG       +G V+   + +VL G    KV+L E  
Sbjct: 92  GGGSVTSGNADIDRIEVSNKVFLSSGAQQATGESGIVNLTNQTIVLKG---KKVVLSEGK 148

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           N F+GC+L V +DT  A L  C   +VQ  +    R
Sbjct: 149 NVFVGCQLNVQMDTGEAQLDAC-GGRVQIQLDPQSR 183


>gi|319781470|ref|YP_004140946.1| OstA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167358|gb|ADV10896.1| OstA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 193

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 76/165 (46%), Gaps = 16/165 (9%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY- 85
           S A  +  +  K+ G++ I I++D LEV+ A   A F GNV + Q    ++A KMT+ Y 
Sbjct: 24  SWAQTTSQSGLKLSGDKPIQIESDKLEVRQADSVAIFTGNVSVVQGPTLMKAGKMTVYYV 83

Query: 86  ------------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
                              S  I+ +++   ++I+S         G  D + ++LVL+G 
Sbjct: 84  KDPNAAAKGTEAAGAAMTGSANIDHLEISDKVYIKSDAQIATGDQGSFDMKSQVLVLSG- 142

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              KV+L +  N  +GCKL V + +  A +  C   +VQ  I   
Sbjct: 143 --KKVVLSQNDNVLVGCKLTVQMKSGLAQVDPCAGQRVQMSITPP 185


>gi|222147329|ref|YP_002548286.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4]
 gi|221734319|gb|ACM35282.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4]
          Length = 187

 Score =  165 bits (417), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 79/156 (50%), Gaps = 7/156 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q+A S M   K+ G++ I I++D LEV     KA F GNV + Q   ++++  M + Y  
Sbjct: 33  QSATSNMNSLKLSGDKPIQIESDALEVHQQENKANFNGNVKVVQGTTTMRSGTMVVKYKG 92

Query: 88  TNRDVSNK---INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
               V++    I+ +DV  N+ + +      A  G+ D   +I  L+GD   KV+L E  
Sbjct: 93  QGAAVTSGDAKIDTIDVADNVILNTETQQATADKGHFDMNTQIFTLDGD---KVVLSEGG 149

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           N F+GCKL V++ T  A L  C   +VQ  +    +
Sbjct: 150 NVFVGCKLTVHMTTGEAKLDSC-GKRVQIQLDPKSK 184


>gi|39933128|ref|NP_945404.1| OstA-like protein [Rhodopseudomonas palustris CGA009]
 gi|39652753|emb|CAE25492.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 221

 Score =  164 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 89/195 (45%), Gaps = 23/195 (11%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           AF ++  + +++   V    ++ + Q   + M  F    ++ I I++D LEV+D  ++A 
Sbjct: 15  AFASAALVALYVGGTVPATAQSAV-QGVPNAMQGFSQNRDKPIQIESDTLEVRDKNKEAT 73

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNT-----------------NRDVSNKINRMDVERNI 105
           F GNV + Q D ++ +  + + Y+                     D ++ I R++ + ++
Sbjct: 74  FTGNVKVVQGDTTMTSQTLVVFYDQDQAPAKGAKGKPMPAAAPGPDGASSIRRLEAKGHV 133

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
            +   +  V       + +  ++ + G+    V+L +  N   G +L+V++ T  + ++ 
Sbjct: 134 VVTQKDQVVTGDKAVFETKTNLVTMTGN----VVLTQARNVVRGDRLLVDMTTGVSRVES 189

Query: 166 CESDQVQSIIRYDGR 180
            +S +VQ + +  G 
Sbjct: 190 -DSGRVQGLFQSSGA 203


>gi|114706452|ref|ZP_01439354.1| hypothetical protein FP2506_01670 [Fulvimarina pelagi HTCC2506]
 gi|114538313|gb|EAU41435.1| hypothetical protein FP2506_01670 [Fulvimarina pelagi HTCC2506]
          Length = 202

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 44/185 (23%), Positives = 79/185 (42%), Gaps = 20/185 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAA---SYMTRFKVLGNEKIHIKADMLEVKDA 57
           M+  L +  L   L+A   V+L   +        +     ++ G++ I I++  L+V D 
Sbjct: 1   MNMRLPTAALSASLIAGTAVMLSFPVYAQQGGLGNNFNGLQLDGDQPISIESSTLDVDDK 60

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN-------------RDVSNKINRMDVERN 104
              A F GNV + Q    L+  K+ + YNN+                 S+ I R++    
Sbjct: 61  AAIATFTGNVSVAQGPTQLRTGKLVVHYNNSGSGQSGASSGSSALPGGSSSIERLEASEK 120

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           ++++S +    A     D    ++V+ GD    V+L +  N   GC+L + +DT  A L+
Sbjct: 121 VYVKSEDQVATAERASFDMASNVVVMTGD----VVLSQGENVAEGCRLTIQMDTGQARLE 176

Query: 165 GCESD 169
               D
Sbjct: 177 STNCD 181


>gi|153007513|ref|YP_001368728.1| OstA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559401|gb|ABS12899.1| OstA family protein [Ochrobactrum anthropi ATCC 49188]
          Length = 216

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 87/194 (44%), Gaps = 23/194 (11%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAF 62
              ++ +   +LAL  V           + +   K+      + I AD LE++D    A 
Sbjct: 13  MARTLRMGFAVLALGIVAAPTVSLAQEGAAVNGLKLSNSKAPVKIDADKLEMRDKEGIAI 72

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDV----------------SNKINRMDVERNIF 106
           F GNV ++Q D  L+A +MT+ YN   +D                 S+ I+ +D+   ++
Sbjct: 73  FTGNVAVSQGDALLKAGQMTVYYNKAKKDGEAPAPEPTSAGVGGLDSSSIDHIDISGKVY 132

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           ++SG        G  D + +++VL G    KV+L +  N   GCKL  ++DT  A+++ C
Sbjct: 133 LKSGTQVATGDTGRYDAKNQVMVLQG---QKVVLTDGDNVVTGCKLTAHLDTGRANVESC 189

Query: 167 ES---DQVQSIIRY 177
           +     +V  I+  
Sbjct: 190 KGQTKGRVSIIMAP 203


>gi|239831005|ref|ZP_04679334.1| OstA family protein [Ochrobactrum intermedium LMG 3301]
 gi|239823272|gb|EEQ94840.1| OstA family protein [Ochrobactrum intermedium LMG 3301]
          Length = 216

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 87/194 (44%), Gaps = 23/194 (11%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAF 62
              ++ +   +LAL  V           + +   K+      + I AD LE++D    A 
Sbjct: 13  MARTLRMGFAVLALGMVAAPTASLAQEGAAVNGLKLSNSKAPVKIDADKLEMRDKEGVAV 72

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDV----------------SNKINRMDVERNIF 106
           F GNV ++Q D  L+A +MT+ YN   +D                 S+ I+ +D+   ++
Sbjct: 73  FTGNVAVSQGDALLKAGQMTVYYNKAKKDGDAQAPEPASAGVGGLDSSSIDHIDISGKVY 132

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           ++SG        G  D + +++VL G    KV+L +  N   GCKL  ++DT  A+++ C
Sbjct: 133 LKSGTQVATGDTGRYDAKNQVMVLQG---QKVVLTDGDNVVTGCKLTAHLDTGRANVESC 189

Query: 167 ES---DQVQSIIRY 177
           +     +V  I+  
Sbjct: 190 KGQSKGRVSIIMAP 203


>gi|110635994|ref|YP_676202.1| OstA-like protein [Mesorhizobium sp. BNC1]
 gi|110286978|gb|ABG65037.1| OstA-like protein [Chelativorans sp. BNC1]
          Length = 186

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 78/184 (42%), Gaps = 12/184 (6%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMT--RFKVLGNEKIHIKADMLEVKDAVQKA 61
            +  +H     + L+ +     L+Q + S  +     +  +E I I    +EV      A
Sbjct: 1   MMGRVHGLAFAMGLLMLWPAGGLAQTSESRPSQLGLNLSSDEPIQIDGARVEVDQTQNLA 60

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNR---DVSNKINRMDVERNIFIQSGEINVIASN 118
              G+V + Q    L+  ++ I Y   +      +  I R++ +  ++++S         
Sbjct: 61  TLTGDVQVVQGPTLLKTARLKIFYAEGSGLPTSGAANIKRLEADGGVYVKSETQVATGDQ 120

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE----SDQVQSI 174
           G  D    +LVL+G    +V+L E  N  +GCKL V + T  A+L+ C+      +V+ +
Sbjct: 121 GTFDMGTEVLVLSG---KEVVLTEGENVIVGCKLTVQMKTGQATLESCKDGGSGGRVRML 177

Query: 175 IRYD 178
           +   
Sbjct: 178 LTPS 181


>gi|315121908|ref|YP_004062397.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495310|gb|ADR51909.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 155

 Score =  159 bits (402), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 73/158 (46%), Positives = 111/158 (70%), Gaps = 7/158 (4%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           +K DLS+A +SY + FK+  +++I+I +D L+V+D ++KA F+G V +TQ D ++QA+++
Sbjct: 1   MKTDLSRAESSYFSSFKIGRDQEIYIHSDTLDVQDDLKKASFRGGVTVTQGDTNMQAEEI 60

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y     D S++++RMD+  N+ I S +   +A NGY DFQK+ILVL GD   KVI +
Sbjct: 61  ILHYT----DSSDQLSRMDMRNNVIINSDKNKAMAKNGYCDFQKKILVLYGD---KVIFQ 113

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           E +NTFLGC+L V +D   A LQGC S QV+SII+Y+ 
Sbjct: 114 EGMNTFLGCRLTVKLDVGTAYLQGCGSQQVKSIIKYNK 151


>gi|298290363|ref|YP_003692302.1| OstA family protein [Starkeya novella DSM 506]
 gi|296926874|gb|ADH87683.1| OstA family protein [Starkeya novella DSM 506]
          Length = 228

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 82/196 (41%), Gaps = 26/196 (13%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQA--AASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           A    + L +   A +  L +  L+QA    + +  F    +E I I A+ LEV+D  ++
Sbjct: 8   AGAAGLALLVTGAACLGPLARPALAQARNVPNALQGFAANRDEPIRINANSLEVRDQQKQ 67

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV------------------SNKINRMDVE 102
           A F GNV + Q D +L+  ++ + Y+                        S+ I R+++ 
Sbjct: 68  AVFTGNVVVIQGDTTLRCKELVVYYDGKESGGKAGAPASSEALASGSPINSSAIRRLEIN 127

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
            ++ + + E       G  +     + LNG     V+L    N   G KL V++ +  + 
Sbjct: 128 GSVVVTTKEQTATGDYGTFETASNTITLNG---SPVVLTSGPNVIRGKKLTVDLASGMSR 184

Query: 163 LQGCESDQVQSIIRYD 178
             G    +++S+I  +
Sbjct: 185 FDG---GRIESLIVPN 197


>gi|192288482|ref|YP_001989087.1| OstA family protein [Rhodopseudomonas palustris TIE-1]
 gi|192282231|gb|ACE98611.1| OstA family protein [Rhodopseudomonas palustris TIE-1]
          Length = 221

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 83/185 (44%), Gaps = 23/185 (12%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
           ++   V    ++ + Q   + M  F    ++ I I++D LEV+D  ++A F GNV + Q 
Sbjct: 25  YVGGTVPATAQSAV-QGVPNAMQGFSQNRDKPIQIESDTLEVRDKNKEATFTGNVKVVQG 83

Query: 73  DFSLQADKMTIDYNNT-----------------NRDVSNKINRMDVERNIFIQSGEINVI 115
           D ++ +  + + Y+                     D ++ I R++ + ++ +   +  V 
Sbjct: 84  DTTMTSQTLVVFYDQDQAPAKGAKGKPMPAAAPGPDGASSIRRLEAKGHVVVTQKDQVVT 143

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                 + +  ++ + G+    V+L +  N   G +L+V++ T  + ++  +S +VQ + 
Sbjct: 144 GDKAVFETKTNLVTMTGN----VVLTQARNVVRGDRLLVDMTTGVSRVES-DSGRVQGLF 198

Query: 176 RYDGR 180
           +  G 
Sbjct: 199 QSSGA 203


>gi|163757835|ref|ZP_02164924.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43]
 gi|162285337|gb|EDQ35619.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43]
          Length = 183

 Score =  159 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 86/179 (48%), Gaps = 7/179 (3%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           L  + L   L   V    +   +Q + S MT   + G+E I I++D+L++ +   +A F 
Sbjct: 6   LPIVGLAALLGVAVLAGPQPVQAQTSESRMTGLALSGDEPIQIESDLLQINEETSQATFT 65

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEINVIASNGYV 121
           GNV + Q D  LQA +M + Y      V++    I  +D+ + + I+SG     A  G  
Sbjct: 66  GNVRVLQGDTVLQAGEMIVHYAKNGGSVASGAADIREIDLFKKVLIRSGTQTATADTGNF 125

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           +    +LVL+G+   KV+L +  N F+GCKL V +    A L  C   +V   +    R
Sbjct: 126 NMANEVLVLSGE---KVVLTDAENVFIGCKLTVQMQNGQAKLDSC-GRRVMIQLDPKSR 180


>gi|158425551|ref|YP_001526843.1| hypothetical protein AZC_3927 [Azorhizobium caulinodans ORS 571]
 gi|158332440|dbj|BAF89925.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 78/188 (41%), Gaps = 20/188 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQ------AAASYMTRFKVLGNEKIHIKADMLEVKDAV 58
           +  + L +   A V  L    L+Q         + +  F    +E I I +D LEVKD  
Sbjct: 1   MTFLSLRLAAAACVLSLAVPALAQQPAANSGPPNALQGFARNRDEPIRINSDTLEVKDKE 60

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--------SNKINRMDVERNIFIQSG 110
           ++A F G V + Q D +L   ++ + Y+              S+KI +++    + +Q+ 
Sbjct: 61  KQATFSGKVVVVQGDTTLHCPQLVVYYDGDVAAGVQGGAPSDSSKIRKLEALGGVVVQTK 120

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           +       G  + +   + L G     V+L +  N   G KL+V++ T  +  +G    +
Sbjct: 121 DQTATGDTGVFEMKTNTVTLTG---KPVVLTQGPNVVRGQKLVVDLTTGVSKFEG---GR 174

Query: 171 VQSIIRYD 178
           V  ++   
Sbjct: 175 VDMLLTPG 182


>gi|294851556|ref|ZP_06792229.1| hypothetical protein BAZG_00464 [Brucella sp. NVSL 07-0026]
 gi|294820145|gb|EFG37144.1| hypothetical protein BAZG_00464 [Brucella sp. NVSL 07-0026]
          Length = 218

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + I I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPIKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ IN +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGAEAPEPANAGVGGIGSSSINHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 205


>gi|265983333|ref|ZP_06096068.1| OstA family protein [Brucella sp. 83/13]
 gi|264661925|gb|EEZ32186.1| OstA family protein [Brucella sp. 83/13]
          Length = 218

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTRGRVSIIMAP 205


>gi|306842557|ref|ZP_07475208.1| OstA-like protein [Brucella sp. BO2]
 gi|306287413|gb|EFM58893.1| OstA-like protein [Brucella sp. BO2]
          Length = 218

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 205


>gi|316931444|ref|YP_004106426.1| OstA family protein [Rhodopseudomonas palustris DX-1]
 gi|315599158|gb|ADU41693.1| OstA family protein [Rhodopseudomonas palustris DX-1]
          Length = 221

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 83/194 (42%), Gaps = 23/194 (11%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           A + +  + +  L       ++ + Q   + M  F    ++ I I++D LEV+D  ++A 
Sbjct: 15  AAVCAALIAVSTLGPRPAAAQSAV-QGVPNAMQGFSQNRDKPIQIESDTLEVRDKKKEAT 73

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK-----------------INRMDVERNI 105
           F GNV + Q D ++ +  + + Y+                          I R++ + ++
Sbjct: 74  FSGNVKVVQGDTTMTSQTLVVFYDQDQAPAKGAKGKPMAAAAPGPDGASSIRRLEAKGHV 133

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
            +   +  V       + +  ++ + G+    V+L +  N   G +L+V++ T  + ++ 
Sbjct: 134 VVTQKDQVVTGDKAVFETKTNLVTMTGN----VVLTQARNVVRGDRLMVDMTTGVSRVES 189

Query: 166 CESDQVQSIIRYDG 179
            +S +VQ + +  G
Sbjct: 190 -DSGRVQGLFQSSG 202


>gi|326408178|gb|ADZ65243.1| OstA-like protein [Brucella melitensis M28]
 gi|326537891|gb|ADZ86106.1| OstA-like protein [Brucella melitensis M5-90]
          Length = 218

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I  +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGAEAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 205


>gi|189023408|ref|YP_001934176.1| OstA-like protein [Brucella abortus S19]
 gi|225626695|ref|ZP_03784734.1| OstA-like protein [Brucella ceti str. Cudo]
 gi|237814626|ref|ZP_04593624.1| OstA-like protein [Brucella abortus str. 2308 A]
 gi|260756012|ref|ZP_05868360.1| OstA family protein [Brucella abortus bv. 6 str. 870]
 gi|261320995|ref|ZP_05960192.1| OstA family protein [Brucella ceti M644/93/1]
 gi|297247548|ref|ZP_06931266.1| hypothetical protein BAYG_00459 [Brucella abortus bv. 5 str. B3196]
 gi|189018980|gb|ACD71702.1| OstA-like protein [Brucella abortus S19]
 gi|225618352|gb|EEH15395.1| OstA-like protein [Brucella ceti str. Cudo]
 gi|237789463|gb|EEP63673.1| OstA-like protein [Brucella abortus str. 2308 A]
 gi|260676120|gb|EEX62941.1| OstA family protein [Brucella abortus bv. 6 str. 870]
 gi|261293685|gb|EEX97181.1| OstA family protein [Brucella ceti M644/93/1]
 gi|297174717|gb|EFH34064.1| hypothetical protein BAYG_00459 [Brucella abortus bv. 5 str. B3196]
          Length = 218

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 205


>gi|254718372|ref|ZP_05180183.1| OstA-like protein [Brucella sp. 83/13]
          Length = 204

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTRGRVSIIMAP 191


>gi|163842426|ref|YP_001626830.1| hypothetical protein BSUIS_A0157 [Brucella suis ATCC 23445]
 gi|163673149|gb|ABY37260.1| hypothetical protein BSUIS_A0157 [Brucella suis ATCC 23445]
          Length = 204

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A ++ C+     +V  I+  
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRAKVESCKGQTKGRVSIIMAP 191


>gi|306839603|ref|ZP_07472407.1| OstA-like protein [Brucella sp. NF 2653]
 gi|306405301|gb|EFM61576.1| OstA-like protein [Brucella sp. NF 2653]
          Length = 216

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTRGRVSIIMAP 203


>gi|306844424|ref|ZP_07477014.1| OstA-like protein [Brucella sp. BO1]
 gi|306275237|gb|EFM56987.1| OstA-like protein [Brucella sp. BO1]
          Length = 216

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 203


>gi|225851689|ref|YP_002731922.1| OstA-like protein [Brucella melitensis ATCC 23457]
 gi|256045948|ref|ZP_05448820.1| OstA-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112661|ref|ZP_05453582.1| OstA-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|265992358|ref|ZP_06104915.1| OstA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994101|ref|ZP_06106658.1| OstA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|225640054|gb|ACN99967.1| OstA-like protein [Brucella melitensis ATCC 23457]
 gi|262765082|gb|EEZ11003.1| OstA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|263003424|gb|EEZ15717.1| OstA family protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 204

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I  +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 191


>gi|254470648|ref|ZP_05084051.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
 gi|211959790|gb|EEA94987.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
          Length = 169

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 82/163 (50%), Gaps = 14/163 (8%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY- 85
           +Q  +     F     E I I+A  L+V+D  + A F GNV +TQ +  L+A ++ + Y 
Sbjct: 4   AQTFSDSFAGFGSDNKEPIEIEATNLQVRDKDKSAIFSGNVVVTQGEAKLEAQRLIVFYS 63

Query: 86  ------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
                 N   + V   I+R++ + ++ + S +      +   D +K+I+V+ G    +V 
Sbjct: 64  GSMANGNADGQPVQQSISRLEAKGDVLVSSKDQVATGDDASFDMEKQIVVMTG---KRVT 120

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQ----GCESDQVQSIIRYD 178
           L +  N  +G +L++N++T  A+L     G  + +V+ +++ +
Sbjct: 121 LSQGPNVIVGKRLVINLETGKANLDSSGTGGNTGRVRMLLQPN 163


>gi|23501067|ref|NP_697194.1| hypothetical protein BR0156 [Brucella suis 1330]
 gi|62289132|ref|YP_220925.1| hypothetical protein BruAb1_0152 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699071|ref|YP_413645.1| OstA-like protein [Brucella melitensis biovar Abortus 2308]
 gi|161618144|ref|YP_001592031.1| hypothetical protein BCAN_A0161 [Brucella canis ATCC 23365]
 gi|254690460|ref|ZP_05153714.1| OstA-like protein [Brucella abortus bv. 6 str. 870]
 gi|254694949|ref|ZP_05156777.1| OstA-like protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696580|ref|ZP_05158408.1| OstA-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254705335|ref|ZP_05167163.1| OstA-like protein [Brucella suis bv. 3 str. 686]
 gi|254707152|ref|ZP_05168980.1| OstA-like protein [Brucella pinnipedialis M163/99/10]
 gi|254709305|ref|ZP_05171116.1| OstA-like protein [Brucella pinnipedialis B2/94]
 gi|254713272|ref|ZP_05175083.1| OstA-like protein [Brucella ceti M644/93/1]
 gi|254716375|ref|ZP_05178186.1| OstA-like protein [Brucella ceti M13/05/1]
 gi|254731493|ref|ZP_05190071.1| OstA-like protein [Brucella abortus bv. 4 str. 292]
 gi|256030828|ref|ZP_05444442.1| OstA-like protein [Brucella pinnipedialis M292/94/1]
 gi|256060298|ref|ZP_05450471.1| OstA-like protein [Brucella neotomae 5K33]
 gi|256158853|ref|ZP_05456710.1| OstA-like protein [Brucella ceti M490/95/1]
 gi|256254234|ref|ZP_05459770.1| OstA-like protein [Brucella ceti B1/94]
 gi|256258716|ref|ZP_05464252.1| OstA-like protein [Brucella abortus bv. 9 str. C68]
 gi|256368620|ref|YP_003106126.1| hypothetical protein BMI_I159 [Brucella microti CCM 4915]
 gi|260169732|ref|ZP_05756543.1| OstA-like protein [Brucella sp. F5/99]
 gi|260885032|ref|ZP_05896646.1| OstA family protein [Brucella abortus bv. 9 str. C68]
 gi|261221383|ref|ZP_05935664.1| OstA family protein [Brucella ceti B1/94]
 gi|261324270|ref|ZP_05963467.1| OstA family protein [Brucella neotomae 5K33]
 gi|265987883|ref|ZP_06100440.1| OstA family protein [Brucella pinnipedialis M292/94/1]
 gi|265997344|ref|ZP_06109901.1| OstA family protein [Brucella ceti M490/95/1]
 gi|23346935|gb|AAN29109.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195264|gb|AAX73564.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615172|emb|CAJ10111.1| OstA-like protein [Brucella melitensis biovar Abortus 2308]
 gi|161334955|gb|ABX61260.1| hypothetical protein BCAN_A0161 [Brucella canis ATCC 23365]
 gi|255998778|gb|ACU47177.1| hypothetical protein BMI_I159 [Brucella microti CCM 4915]
 gi|260874560|gb|EEX81629.1| OstA family protein [Brucella abortus bv. 9 str. C68]
 gi|260919967|gb|EEX86620.1| OstA family protein [Brucella ceti B1/94]
 gi|261300250|gb|EEY03747.1| OstA family protein [Brucella neotomae 5K33]
 gi|262551812|gb|EEZ07802.1| OstA family protein [Brucella ceti M490/95/1]
 gi|264660080|gb|EEZ30341.1| OstA family protein [Brucella pinnipedialis M292/94/1]
          Length = 204

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 191


>gi|260563229|ref|ZP_05833715.1| OstA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|265999666|ref|ZP_05467330.2| OstA family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260153245|gb|EEW88337.1| OstA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|263095209|gb|EEZ18878.1| OstA family protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 216

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I  +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 203


>gi|260567206|ref|ZP_05837676.1| OstA family protein [Brucella suis bv. 4 str. 40]
 gi|261756046|ref|ZP_05999755.1| OstA family protein [Brucella suis bv. 3 str. 686]
 gi|260156724|gb|EEW91804.1| OstA family protein [Brucella suis bv. 4 str. 40]
 gi|261745799|gb|EEY33725.1| OstA family protein [Brucella suis bv. 3 str. 686]
          Length = 216

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 203


>gi|91974658|ref|YP_567317.1| OstA-like protein [Rhodopseudomonas palustris BisB5]
 gi|91681114|gb|ABE37416.1| OstA-like protein [Rhodopseudomonas palustris BisB5]
          Length = 221

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 81/190 (42%), Gaps = 24/190 (12%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             ++   A +   L     Q   + M  F    ++ I I++D LEV+D  ++A F G+V 
Sbjct: 19  AAFLAGSANLSGALAQSAVQGVPNAMQGFSQNRDQPIQIESDTLEVRDKKKEATFTGSVK 78

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVS-------------------NKINRMDVERNIFIQS 109
           + Q D ++ +  + + Y+    + S                   + I R++ + N+ +  
Sbjct: 79  VVQGDTTMTSKTLVVFYDQDQSETSAKQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQ 138

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
            +  V   +   D +  ++ + G     V+L +  N   G +L+V++ T  + ++   S 
Sbjct: 139 KDQVVTGDSAVFDTKTNLVTMLG----SVVLTQGKNVVRGDRLLVDMTTGVSRVES-NSG 193

Query: 170 QVQSIIRYDG 179
           +VQ + +  G
Sbjct: 194 RVQGLFQSSG 203


>gi|260546430|ref|ZP_05822170.1| OstA family protein [Brucella abortus NCTC 8038]
 gi|260759236|ref|ZP_05871584.1| OstA family protein [Brucella abortus bv. 4 str. 292]
 gi|260760958|ref|ZP_05873301.1| OstA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261215288|ref|ZP_05929569.1| OstA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218157|ref|ZP_05932438.1| OstA family protein [Brucella ceti M13/05/1]
 gi|261314630|ref|ZP_05953827.1| OstA family protein [Brucella pinnipedialis M163/99/10]
 gi|261316814|ref|ZP_05956011.1| OstA family protein [Brucella pinnipedialis B2/94]
 gi|261759270|ref|ZP_06002979.1| OstA family protein [Brucella sp. F5/99]
 gi|260096537|gb|EEW80413.1| OstA family protein [Brucella abortus NCTC 8038]
 gi|260669554|gb|EEX56494.1| OstA family protein [Brucella abortus bv. 4 str. 292]
 gi|260671390|gb|EEX58211.1| OstA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260916895|gb|EEX83756.1| OstA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|260923246|gb|EEX89814.1| OstA family protein [Brucella ceti M13/05/1]
 gi|261296037|gb|EEX99533.1| OstA family protein [Brucella pinnipedialis B2/94]
 gi|261303656|gb|EEY07153.1| OstA family protein [Brucella pinnipedialis M163/99/10]
 gi|261739254|gb|EEY27250.1| OstA family protein [Brucella sp. F5/99]
          Length = 216

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 203


>gi|148559284|ref|YP_001258189.1| hypothetical protein BOV_0151 [Brucella ovis ATCC 25840]
 gi|148370541|gb|ABQ60520.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 216

 Score =  154 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKFSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 203


>gi|17988074|ref|NP_540708.1| periplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|17983824|gb|AAL52972.1| hypothetical periplasmic protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 172

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 45/162 (27%), Positives = 77/162 (47%), Gaps = 21/162 (12%)

Query: 34  MTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD- 91
           M   K+    + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +  
Sbjct: 1   MPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGA 60

Query: 92  -------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
                         S+ I  +D+   ++++SG        G  D + +I+VL G    KV
Sbjct: 61  EAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKV 117

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
           +L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 118 VLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 159


>gi|254700965|ref|ZP_05162793.1| OstA-like protein [Brucella suis bv. 5 str. 513]
          Length = 204

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A ++T+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQITVY 84

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 191


>gi|261751483|ref|ZP_05995192.1| OstA family protein [Brucella suis bv. 5 str. 513]
 gi|261741236|gb|EEY29162.1| OstA family protein [Brucella suis bv. 5 str. 513]
          Length = 216

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 21/170 (12%)

Query: 26  LSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K+    + + I AD LE++D    A F GNV ++Q D  L+A ++T+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQITVY 96

Query: 85  YNNTNRD--------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRY 177
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+  
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAP 203


>gi|254503827|ref|ZP_05115978.1| OstA-like protein [Labrenzia alexandrii DFL-11]
 gi|222439898|gb|EEE46577.1| OstA-like protein [Labrenzia alexandrii DFL-11]
          Length = 193

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 79/192 (41%), Gaps = 16/192 (8%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
                    +   + + + +    +Q  +     F     + I I+++ L+V+D  + A 
Sbjct: 1   MMKPVFKRGLVAFSALMLAIAPLSAQTFSDSFAGFGSSDGQPIEIESNELKVEDQTKVAT 60

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRD------------VSNKINRMDVERNIFIQSG 110
           F G+V + Q D  L+  ++ + Y+   +                +I+R++    + I S 
Sbjct: 61  FIGDVVVIQGDTRLETSQLKVFYDGDGQSSEGADTSNGAVPAQQEISRLEASGGVHISSE 120

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC-ESD 169
           +          D +  ++V+ G    +V+LK+  N  +G +L VN+ T  A+L    +  
Sbjct: 121 DQTATGDEANFDMKTEVMVMTG---KEVVLKQGGNVVVGNRLTVNLKTGQANLNAPADDG 177

Query: 170 QVQSIIRYDGRP 181
           +V+  I  +  P
Sbjct: 178 RVRVRILPNSAP 189


>gi|86747783|ref|YP_484279.1| OstA-like protein [Rhodopseudomonas palustris HaA2]
 gi|86570811|gb|ABD05368.1| OstA-like protein [Rhodopseudomonas palustris HaA2]
          Length = 219

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 81/191 (42%), Gaps = 26/191 (13%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             ++          ++ + Q   + M  F    ++ I I++D LEV+D  ++A F G+V 
Sbjct: 17  AAFLAGATCGGAWAQSAV-QGVPNAMQGFSQNKDQPIQIESDTLEVRDKKKEATFAGSVK 75

Query: 69  MTQEDFSLQADKMTIDYNNT--------------------NRDVSNKINRMDVERNIFIQ 108
           + Q D ++ +  + + Y+                          ++ I R++ + N+ + 
Sbjct: 76  VIQGDTTMTSKSLVVFYDQDQPDAAAKPQAKRKTMPAATPGPGGASAIRRLEAKGNVVVT 135

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
             +  V   +   D +  ++ + G+    V+L +  N   G +LIV++ T  + ++   S
Sbjct: 136 QKDQVVTGDSAVFDTKTNLVTMLGN----VVLTQAKNVVRGDRLIVDMTTGVSRVES-NS 190

Query: 169 DQVQSIIRYDG 179
            +VQ + +  G
Sbjct: 191 GRVQGLFQSSG 201


>gi|92115809|ref|YP_575538.1| OstA-like protein [Nitrobacter hamburgensis X14]
 gi|91798703|gb|ABE61078.1| OstA-like protein [Nitrobacter hamburgensis X14]
          Length = 228

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 85/200 (42%), Gaps = 26/200 (13%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           ++  L    + I ++A      ++ + Q   + M  F    ++ I I+A  LE++D  ++
Sbjct: 17  IAGLLCGGLITIAVMAAGEAAGQSAV-QGVPNAMQGFSQNRDQPIQIEAAALEMRDKKKE 75

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNT--------------------NRDVSNKINRMD 100
           A F GNV + Q D ++ +  + + Y +                         ++ I R++
Sbjct: 76  ATFSGNVKVVQGDTTMTSKTLVVYYESGNSANAKGKSPSKPAMASATPGPSGASSIKRLE 135

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
              N+ +   +  V       D +  ++ + G    KV+L +  N   G +LIV++ T  
Sbjct: 136 ARGNVVVTQKDQVVTGDTAQFDTRTNLVTMLG----KVVLTQGKNVLRGDRLIVDMTTGV 191

Query: 161 ASLQGCESDQVQSIIRYDGR 180
           + ++   S +VQ + +  G+
Sbjct: 192 SRVES-NSGRVQGLFQSSGQ 210


>gi|90420563|ref|ZP_01228470.1| possible OstA family protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90335291|gb|EAS49044.1| possible OstA family protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 205

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 20/182 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAA----ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           I   + L+ L    L    +Q             +V G++ I I+++ L V DA   A F
Sbjct: 11  IAGAVFLVGLALGALAPAQAQQTEPGLGKSFGGLQVDGDQPISIESNQLVVDDAKAVATF 70

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTN------------RDVSNKINRMDVERNIFIQSGE 111
            GNV + Q +  L+  ++ + Y                   SN+I R++    ++++S +
Sbjct: 71  TGNVQVEQGETELRTGRLVVTYKKDETGGSQPAGGGGLPGGSNQIERLEASEKVYVKSAD 130

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
               A     D   +++V+ G+    V+L +  N   GC+L + +DT  A L+       
Sbjct: 131 QVATADQADFDMGTQVVVMRGN----VVLTQGQNVAEGCRLTIQMDTGLARLESACDGGA 186

Query: 172 QS 173
           ++
Sbjct: 187 ET 188


>gi|299133326|ref|ZP_07026521.1| OstA family protein [Afipia sp. 1NLS2]
 gi|298593463|gb|EFI53663.1| OstA family protein [Afipia sp. 1NLS2]
          Length = 250

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 70/188 (37%), Gaps = 17/188 (9%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           A L    L+   + +     +        + +  F     + I I A  LEV+D  + A 
Sbjct: 21  ATLGLSALFAFAVCVSAAQAQTSTVSGVPNAVQGFSKNRGQPIQIDALSLEVRDKDKIAT 80

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNT-------------NRDVSNKINRMDVERNIFIQS 109
           F GNV + Q D ++++  + + Y+                   ++ + R++    + +  
Sbjct: 81  FSGNVKVVQGDTTMRSKTLVVFYDQDKAGAKPGMKTAQPGPGGNSSVRRLEARGGVVVTQ 140

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
            +  V    G  D +   + + G     V+L +  N   G +L+V++ T  + ++     
Sbjct: 141 NDQTVTGETGIFDMKTNTVTMTG----GVVLTKDKNVLKGDRLVVDMTTGVSRVESSGGR 196

Query: 170 QVQSIIRY 177
            V  +   
Sbjct: 197 GVSGLFNS 204


>gi|118589457|ref|ZP_01546863.1| hypothetical protein SIAM614_07928 [Stappia aggregata IAM 12614]
 gi|118438157|gb|EAV44792.1| hypothetical protein SIAM614_07928 [Stappia aggregata IAM 12614]
          Length = 192

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/164 (25%), Positives = 75/164 (45%), Gaps = 16/164 (9%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q  +     F     E I I+A  L V+D    A F G+V +TQ + SL+  ++ + Y  
Sbjct: 23  QTFSDAFAGFGSNEGEPIEIEASELRVEDNNNTATFVGDVLVTQGETSLKTQRLKVYYVG 82

Query: 88  TNRD------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
           +  +      V  +I++++ E  +FI S +          D  K ++V+ G    +V+L 
Sbjct: 83  SGAEKTEDSAVQQRISKLEAEGGVFITSKDQTAKGDEASFDMNKEVMVMTG---REVVLS 139

Query: 142 EKLNTFLGCKLIVNIDTSFASL-------QGCESDQVQSIIRYD 178
           +  N  +G KL VN+ T  A+L        G  + +V+  I+ +
Sbjct: 140 QGPNVVVGNKLTVNLKTGKANLSAGGGKVSGQGNGRVKVRIQPN 183


>gi|27375832|ref|NP_767361.1| hypothetical protein blr0721 [Bradyrhizobium japonicum USDA 110]
 gi|27348970|dbj|BAC45986.1| blr0721 [Bradyrhizobium japonicum USDA 110]
          Length = 239

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 75/187 (40%), Gaps = 26/187 (13%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +   +     Q   + M  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ 
Sbjct: 33  MGAAIAQSTMQGVPNAMQGFSQNRDQPIQIEAASLEMRDKKKEATFAGNVKVIQGDTTMT 92

Query: 78  ADKMTIDYNNT------------------------NRDVSNKINRMDVERNIFIQSGEIN 113
           +  + + Y +                             S+ I R++   N+ +   +  
Sbjct: 93  SKTLVVFYESGGDKPATPQPAAKGAKAAPMQSATPGPGGSSSIKRLEARGNVVVTQKDQV 152

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
           V       D +  ++ + G     V+L +  N   G +L+V++ T  + ++  +S +V+ 
Sbjct: 153 VTGDTAVFDTKTNLITMLGGTGQ-VVLTQCKNVLQGDRLVVDMTTGVSRVES-DSGKVRG 210

Query: 174 IIRYDGR 180
           +   + +
Sbjct: 211 LFDQNSK 217


>gi|115522456|ref|YP_779367.1| OstA-like protein [Rhodopseudomonas palustris BisA53]
 gi|115516403|gb|ABJ04387.1| OstA family protein [Rhodopseudomonas palustris BisA53]
          Length = 229

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 77/191 (40%), Gaps = 30/191 (15%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             LL     L +  +S    + M  F    ++ I I+A  LEV+D  ++A F G+V + Q
Sbjct: 27  AGLLGGTPALAQGAVS-GVPNAMQGFSQNRDQPIQIEAASLEVRDKKKEATFTGDVKVVQ 85

Query: 72  EDFSLQADKMTIDYNNT------------------------NRDVSNKINRMDVERNIFI 107
            D ++ +  + + Y+                               + I R++ + N+ +
Sbjct: 86  GDTTMTSKVLVVFYDQDPASGSAAPAAKAKAGAKPQMAASPGPGGGSSIRRLEAKGNVVV 145

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
              +  V       D +  ++ + G    +V+L +  N   G +L+V++ T  + ++   
Sbjct: 146 TQKDQVVTGDTAVFDTKTNLVTMLG----RVVLTQGGNVLRGDRLLVDMTTGVSRVES-G 200

Query: 168 SDQVQSIIRYD 178
           S +VQ + +  
Sbjct: 201 SGRVQGLFQSG 211


>gi|75674372|ref|YP_316793.1| OstA-like protein [Nitrobacter winogradskyi Nb-255]
 gi|74419242|gb|ABA03441.1| OstA-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 227

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 72/167 (43%), Gaps = 24/167 (14%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ +  + + Y +
Sbjct: 44  QGVPNAMQGFSQNRDQPIQIEAATLEMRDKKKEATFSGNVKVVQGDTTMTSKTLVVYYQS 103

Query: 88  TN-------------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           ++                      ++ I R++   N+ +   +  V       D    ++
Sbjct: 104 SDTAKGGAPSKKKPAAVAAPAPSGASSIKRLEARGNVVVTQKDQVVTGDTAVFDTTTNLI 163

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + G    KV+L +  N   G +L+V++ T  + ++   S +VQ + 
Sbjct: 164 TMQG----KVVLTQCKNVLRGDRLLVDMTTGVSRVES-NSGRVQGLF 205


>gi|308274285|emb|CBX30884.1| hypothetical protein N47_E43960 [uncultured Desulfobacterium sp.]
          Length = 543

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 79/175 (45%), Gaps = 10/175 (5%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
              Y  +++ + V L   LS A+A          +EKIHI AD L      + A F GNV
Sbjct: 3   PAWYYSIISFLMVFL--ILSVASAEDTASLNAESSEKIHITADSLISDSNAKFAEFIGNV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRD-----VSNKINRMDVERNIFIQSGEINVIASNGYVD 122
              Q +F + +DK+ I Y    +D      S+ I ++    N+FI+S +++ +      +
Sbjct: 61  EAIQGEFVINSDKLKIFYKGDAKDKAASGTSDSIEKIIATGNVFIKSKDMSAVTQQAQYN 120

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
               I+ L G+   KV   ++ N   G K+I+        ++G +S +V ++   
Sbjct: 121 TDTMIITLTGE-GSKVF--DQKNFVTGSKIILYRKEGVTKVEGDKSKRVTAVFYP 172


>gi|154244024|ref|YP_001414982.1| OstA family protein [Xanthobacter autotrophicus Py2]
 gi|154158109|gb|ABS65325.1| OstA family protein [Xanthobacter autotrophicus Py2]
          Length = 230

 Score =  144 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 77/178 (43%), Gaps = 25/178 (14%)

Query: 20  VLLKADLSQAA--ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
               + ++Q +   + +  F    ++ + I AD LEV+D  + A F GNV +TQ D +L+
Sbjct: 39  ATSSSAVAQTSNVPNALQGFAKNRDQPVRINADSLEVRDKDKVAVFSGNVLVTQGDTTLR 98

Query: 78  ADKMTIDY-----------------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           +  + + Y                 N  +     +I +++    + +++ E      +G 
Sbjct: 99  SKDLMVYYEGSVAQQAGGQPAGEQANGVDPSQKGQIRKLEAVGGVVVKTKEQTATGDSGV 158

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +   + L G     V+L +  N   G KL+V++ +  +  +G    +V+S+I   
Sbjct: 159 FEMKTNTVTLVG---KPVVLTQGPNVIRGQKLVVDLVSGVSKFEG---GRVESLIVPG 210


>gi|148251744|ref|YP_001236329.1| hypothetical protein BBta_0123 [Bradyrhizobium sp. BTAi1]
 gi|146403917|gb|ABQ32423.1| hypothetical protein BBta_0123 [Bradyrhizobium sp. BTAi1]
          Length = 225

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 82/190 (43%), Gaps = 21/190 (11%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +A   +  + + ++A    +     +    + +  F    ++ I I+A  LE++D  ++A
Sbjct: 9   AAIRGAGLVALAMVACAGAVQAQTAATGVPNALQGFSQNRDQPIQIEAASLEMRDKKKEA 68

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNT----------------NRDVSNKINRMDVERNI 105
            F GNV + Q D ++ +  + + Y+                    D S+ I R++    +
Sbjct: 69  TFSGNVKVVQGDTTMTSKSLVVFYDGGAQGGAKPAKTMQAAAPGPDGSSSIRRLEARGGV 128

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
            +   E  V       D +   + + G+    V+L +  N   G +L+V++ T  + ++ 
Sbjct: 129 TVTQKEQVVTGETAVFDTKTNQITMQGN----VVLTQCKNVLRGDRLMVDMTTGVSRVES 184

Query: 166 CESDQVQSII 175
            +S +VQ+++
Sbjct: 185 -DSGRVQALL 193


>gi|154250650|ref|YP_001411474.1| cell envelope biogenesis YhbN [Parvibaculum lavamentivorans DS-1]
 gi|154154600|gb|ABS61817.1| Cell envelope biogenesis YhbN [Parvibaculum lavamentivorans DS-1]
          Length = 197

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 79/186 (42%), Gaps = 18/186 (9%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTR---FKVLGNEKIHIKADMLEVKDAVQKAFF 63
           S  ++   LA    +     +Q A         F+   ++ I ++AD LEV+D    A F
Sbjct: 16  STLVFAAFLAGGLAVAVPADAQTAGEGGGALGGFRTDPDKPIEVEADSLEVEDTKSTATF 75

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVD 122
            GNV + Q +  ++AD++ + Y   + + S  I R+    N+F+ S +  +         
Sbjct: 76  IGNVRVAQGEIRMKADRIVVFYAPRSSNGS-GIERLRATGNVFVSSPDEQSASGEWANYL 134

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS---------LQGCESDQVQS 173
              R + +     D V+L++  N   G KL V++++  A           +   + +V+ 
Sbjct: 135 IATREIEM----GDAVVLRQGENVIRGAKLFVDLNSGRARVVGGGTGVSGETGGTGRVKG 190

Query: 174 IIRYDG 179
           + +  G
Sbjct: 191 LFQPGG 196


>gi|126738423|ref|ZP_01754128.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
 gi|126720222|gb|EBA16928.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
          Length = 154

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +F L  +  +Q A+      K   ++ + + +D L V  A   A F GNV + Q    L 
Sbjct: 1   MFWLTASAWAQNASVAFGSVKADPSQPVEVTSDALAVNQANGSAEFNGNVVIVQGVMRLS 60

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           ADK+ + Y  T+      I R++   N+ + SG     A           +VL G+    
Sbjct: 61  ADKVLVIY-KTDESGKRGIERLEATGNVLLVSGPDAAEAQKADYSIDSGTIVLTGN---- 115

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           V+L +   T    +L VN+ T  A + G    +V++I+   
Sbjct: 116 VLLNQGAGTLTSQRLEVNLTTGTAKMAG----RVKTILAPS 152


>gi|260429201|ref|ZP_05783178.1| lipopolysaccharide transport periplasmic protein LptA [Citreicella
           sp. SE45]
 gi|260419824|gb|EEX13077.1| lipopolysaccharide transport periplasmic protein LptA [Citreicella
           sp. SE45]
          Length = 170

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 10/166 (6%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++   A +F+L    L+Q A           +  + + AD L+V      A ++GNV + 
Sbjct: 4   FLTAAATLFLLSGPALAQGAQVAFGGMSQDTSAPVEVSADSLQVNQTDGTALYEGNVVIG 63

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L A ++ I Y     +   +I RM+    + + SG+    A N        ++V+
Sbjct: 64  QGEMRLAAPRVLIVYAEG--EGQGRIERMEASGGVTLVSGDEAAEAENADYTIATGVVVM 121

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
            G+    V+L +  N     ++ VN++   A + G    +V+++I+
Sbjct: 122 TGN----VLLTQGPNALTSERMTVNLEDGTAQMTG----RVRTVIQ 159


>gi|146337288|ref|YP_001202336.1| putative OstA-like protein [Bradyrhizobium sp. ORS278]
 gi|146190094|emb|CAL74086.1| conserved hypothetical protein; putative OstA-like protein
           [Bradyrhizobium sp. ORS278]
          Length = 232

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 70/172 (40%), Gaps = 21/172 (12%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L     +    + +  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ +  
Sbjct: 27  LQAQSATTGVPNALQGFSQNRDQPIQIEAASLEMRDKKKEATFTGNVKVVQGDTTMTSKS 86

Query: 81  MTIDYNNT-----------------NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           + + Y+                     D S+ I R++   ++ +   +  V       D 
Sbjct: 87  LVVFYDGGAQQGGAKATKATPAATPGPDGSSAIRRLEARGDVKVTQKDQVVTGETAVYDT 146

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           +  ++ + G     V+L +  N   G +L V++ T  + ++      VQ ++
Sbjct: 147 KTNMITMQG----GVVLTQCKNVMRGDRLTVDMTTGVSRVESDGGRGVQVLL 194


>gi|85714033|ref|ZP_01045022.1| OstA-like protein [Nitrobacter sp. Nb-311A]
 gi|85699159|gb|EAQ37027.1| OstA-like protein [Nitrobacter sp. Nb-311A]
          Length = 225

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 71/165 (43%), Gaps = 22/165 (13%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ +  + + Y +
Sbjct: 43  QGVPNAMQGFSQNRDQPIQIEAAALEMRDKKKEATFSGNVKVVQGDTTMTSKTLVVYYQS 102

Query: 88  TNRD-----------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           +                     ++ I R++   N+ +   +  V       D    ++ +
Sbjct: 103 SATAKGGAPAKLKPAAAPAPAGASSIKRLEARGNVVVTQKDQVVTGDTAVFDTTTNLITM 162

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            G    KV+L +  N   G +L+V++ T  + ++   S +VQ + 
Sbjct: 163 RG----KVVLSQCKNVLRGDRLLVDMTTGVSRVES-NSGRVQGLF 202


>gi|209883611|ref|YP_002287468.1| hypothetical protein OCAR_4457 [Oligotropha carboxidovorans OM5]
 gi|209871807|gb|ACI91603.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 246

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 68/191 (35%), Gaps = 23/191 (12%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
            + L +    +     +        + +  F     + I I A  LEV+D  + A F GN
Sbjct: 17  GLALSVPCHVVPPARAQTSTVSGVPNAVQGFSKNRGQPIQIDALSLEVRDKDKVATFSGN 76

Query: 67  VFMTQEDFSLQADKMTIDYNNTNR-------------------DVSNKINRMDVERNIFI 107
           V + Q D ++++  + + Y    +                     S+ + R++    + +
Sbjct: 77  VKVVQGDTTMRSKTLVVFYEQQGKSGANKSGSKAGMTTAQPGPGGSSSVKRLEARGGVVV 136

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
              +  V    G  D +   + L G     V+L +  N   G +L+V++ T  + ++   
Sbjct: 137 TQNDQTVTGETGIFDMKTNTVTLTG----GVVLTKDKNVLKGDRLVVDMTTGVSRVESSG 192

Query: 168 SDQVQSIIRYD 178
              V  +    
Sbjct: 193 GRGVSGLFNSS 203


>gi|304392224|ref|ZP_07374166.1| OstA family protein [Ahrensia sp. R2A130]
 gi|303296453|gb|EFL90811.1| OstA family protein [Ahrensia sp. R2A130]
          Length = 174

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 37/152 (24%), Positives = 64/152 (42%), Gaps = 5/152 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q + +    F+  G + I I+AD LEV D   KA F GNV + Q   ++   K+ + Y  
Sbjct: 22  QVSGAAFDGFRSNGKDPIQIEADSLEVLDEQNKAVFNGNVVVVQGKSTMTTSKLIVTYGA 81

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK-LNT 146
             +     + ++++   +   S E  V A  G        + L G    KV++ +   N 
Sbjct: 82  GGQGTQRDVQKLEMFEGLVATSEENTVTADKGIYITATEQITLTG----KVVVSQGADNV 137

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             GCKL+ N++ + A +  C   +        
Sbjct: 138 ATGCKLVANLNNNQARMTACPKGRTTVTFTPG 169


>gi|114764078|ref|ZP_01443317.1| hypothetical protein 1100011001333_R2601_15507 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543436|gb|EAU46451.1| hypothetical protein R2601_15507 [Roseovarius sp. HTCC2601]
          Length = 165

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 77/165 (46%), Gaps = 12/165 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++ + A++F L    L+Q A       +   +  + + AD L+V  +   A + GNV + 
Sbjct: 4   FLTIAAMLFALSGPALAQGAQVAFGGMQQDTSAPVEVSADQLQVNQSDGTALYTGNVVIG 63

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L A ++ + ++       N+I R++    + + SGE    +     D  +  +V+
Sbjct: 64  QGEMRLAAPRVLVVFDEAG----NRIARLEATGGVTLVSGEEAAESERADYDIDEGTVVM 119

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            G+    V+L +  N     +++VN++   A + G    +V+++I
Sbjct: 120 TGN----VLLTQGPNALTSERMVVNLEGGTAQMTG----RVRTVI 156



 Score = 35.4 bits (80), Expect = 3.4,   Method: Composition-based stats.
 Identities = 7/56 (12%), Positives = 24/56 (42%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
           +++  +           GNV +TQ   +L +++M ++       ++ ++  +  + 
Sbjct: 104 ESERADYDIDEGTVVMTGNVLLTQGPNALTSERMVVNLEGGTAQMTGRVRTVISQG 159


>gi|90421941|ref|YP_530311.1| OstA-like protein [Rhodopseudomonas palustris BisB18]
 gi|90103955|gb|ABD85992.1| OstA-like protein [Rhodopseudomonas palustris BisB18]
          Length = 225

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 70/176 (39%), Gaps = 31/176 (17%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN- 87
              + M  F    ++ I I+A  LEV+D  ++A F G+V + Q D ++ +  + + Y+  
Sbjct: 37  GVPNAMQGFSQNRDKPIQIEAATLEVRDKKKEATFTGDVKVVQGDTTMTSRILVVFYDQE 96

Query: 88  -------------------------TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
                                          + I R++ + N+ +   +  V       D
Sbjct: 97  QPASAEPTPGRSAKAAAKPQMTAAAPGPGGGSSIRRLEAKGNVVVTQKDQVVTGDTAVFD 156

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +  ++ + G     V+L +  N   G +L+V++ T  + ++   S +VQ + +  
Sbjct: 157 TKTNLVTMLG----GVVLTQGKNVVRGDRLLVDMTTGVSRVES-GSGRVQGLFQSS 207


>gi|294675673|ref|YP_003576288.1| OstA family protein [Rhodobacter capsulatus SB 1003]
 gi|294474493|gb|ADE83881.1| OstA family protein [Rhodobacter capsulatus SB 1003]
          Length = 161

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 72/171 (42%), Gaps = 12/171 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++  LA + + L    + A        +   + ++ + AD L V  A   A F GNV + 
Sbjct: 3   FLPALAGLTLALGFGAALAQEVAFPGLRTDPDAQVEVTADSLSVHQADGSAVFTGNVLIV 62

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q    L+A+K+ ++Y        ++I ++     + + SG+    A     +     + L
Sbjct: 63  QGPMRLKAEKVEVEYGADR----SRIAKLHASGGVTLVSGKDAAEAREAVYEVAAGAVEL 118

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
            GD    V+L +  N   G  + +++ T    + G    +V++I++    P
Sbjct: 119 TGD----VLLTQGPNVLSGQHMTIDLKTGTGRMDG----RVRTILQPGETP 161


>gi|332559629|ref|ZP_08413951.1| OstA family protein precursor [Rhodobacter sphaeroides WS8N]
 gi|332277341|gb|EGJ22656.1| OstA family protein precursor [Rhodobacter sphaeroides WS8N]
          Length = 158

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 69/170 (40%), Gaps = 12/170 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +   A +++ + A    A  ++    K      + I +D L+V  A   A F GNV + Q
Sbjct: 1   MAAAAALWLPMAAHAQGAEVAFGGGLKQDTTLPVEIGSDQLQVNQADGTAVFSGNVRVAQ 60

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
               L A  + ++Y          I R+     + + +G     A       +   +V+ 
Sbjct: 61  GPMRLGAQSVRVEYAPGG----GAIRRLHASGGVTLANGSEAAEAKEAVYTIESGEVVMT 116

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           GD    V+L +  NT  G KL++++      ++G    +VQ++ +    P
Sbjct: 117 GD----VLLTQGPNTLAGQKLVIDLSAGTGRMEG----RVQTVFQPGKAP 158


>gi|332187941|ref|ZP_08389674.1| ostA-like family protein [Sphingomonas sp. S17]
 gi|332012102|gb|EGI54174.1| ostA-like family protein [Sphingomonas sp. S17]
          Length = 172

 Score =  137 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 34/143 (23%), Positives = 66/143 (46%), Gaps = 4/143 (2%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           +   L   AAS   + +      I   AD +E++D   +A   GNV + Q + +L A +M
Sbjct: 1   MAPVLIVLAASAPAQTRHNSRAPIDFGADHIELQDKANRAVLSGNVAVRQAEMTLNAARM 60

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
           T+ Y       + +++R+D    + ++  +    +     D  +R++ + G+    V L 
Sbjct: 61  TVAYTGQVIGGNPQVSRLDASGGVVVKRPDQTARSQYAIYDLNRRVITMLGN----VSLT 116

Query: 142 EKLNTFLGCKLIVNIDTSFASLQ 164
           +  NT  G +L +N+DT  A + 
Sbjct: 117 QGGNTVNGGRLTINLDTGRAVID 139


>gi|254466650|ref|ZP_05080061.1| cell envelope biogenesis protein YhbN [Rhodobacterales bacterium
           Y4I]
 gi|206687558|gb|EDZ48040.1| cell envelope biogenesis protein YhbN [Rhodobacterales bacterium
           Y4I]
          Length = 170

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 9/163 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           + V      +Q A+      K   ++ + + AD L V  A   A F GNV + Q    L 
Sbjct: 13  LAVFPGLAAAQTASVAFGAVKADPSQPVEVTADNLAVNQADGSAEFTGNVLIVQGIMRLS 72

Query: 78  ADKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
           AD + + Y    +      I R++   N+ + SG     A           +V+ G+   
Sbjct: 73  ADTVLVIYKTADDSGAKAGIERLEAAGNVVLVSGPDAAEAERAEYTIDTGTIVMTGN--- 129

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            V+L ++  T    +L VN+ +  A + G    +V++I+   G
Sbjct: 130 -VLLNQEGGTLASNRLEVNLTSGTAKMAG----RVKTILNPSG 167


>gi|159046126|ref|YP_001534920.1| OstA family protein [Dinoroseobacter shibae DFL 12]
 gi|157913886|gb|ABV95319.1| OstA family protein [Dinoroseobacter shibae DFL 12]
          Length = 170

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 72/153 (47%), Gaps = 8/153 (5%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
            +Q +   +   +V  +  + I AD L V      A F GNV +TQ    L+AD++T+ Y
Sbjct: 26  WAQGSQVALGTARVDRDAPVEIDADSLSVNQQNGSAVFSGNVQVTQGALRLEADEVTVSY 85

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           +  +   +++I  +  E N+ + SG     + +         + L+GD    V+L +   
Sbjct: 86  DPGSDTTASEIREVRAEGNVLMVSGPDAAESQSAVYTPASNEIRLSGD----VLLSQGPV 141

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G  L+V++ T    ++G    +V+++++ +
Sbjct: 142 VIAGDALVVDLLTGIGEMEG----RVRTVLQPE 170


>gi|218672973|ref|ZP_03522642.1| hypothetical protein RetlG_15785 [Rhizobium etli GR56]
          Length = 154

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 60/140 (42%), Gaps = 21/140 (15%)

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNR--------------------DVSNKINRMDV 101
            F GNV + Q   ++Q+ KMT+ Y +                         S  I+++ V
Sbjct: 8   LFTGNVKVVQGTTTMQSGKMTVYYKDKAAKPGADGAQPAAQPEKSASLASGSADIDKILV 67

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + + SG     A +G  D   +   L  D+ +KVIL +  N F GCKL V++ T  A
Sbjct: 68  TDKVLLTSGTQTATADDGNFDMASQTFTLTADQGNKVILSDGPNVFTGCKLTVHMQTGQA 127

Query: 162 SLQGCESDQVQSIIRYDGRP 181
            L+ C   +VQ  +    +P
Sbjct: 128 ELESC-GGRVQIQLDPKSQP 146


>gi|86136832|ref|ZP_01055410.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
 gi|85826156|gb|EAQ46353.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
          Length = 168

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 75/170 (44%), Gaps = 12/170 (7%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            L+I L++ ++  L A    A        K   +  + + +D L V  A   A F G+V 
Sbjct: 6   ALFIFLISTLWFTLPAA---AQNVAFGAVKADPSLPVEVTSDALSVNQADGSAEFTGSVL 62

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           + Q    L AD++ + Y  T+      I+R++   ++ + SG     A        +  +
Sbjct: 63  IVQGVMKLSADRVLVIYK-TDDTGKRAIDRLEATGSVLLVSGPDAAEAQRADYTIDEGTI 121

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           VL GD    V+L +   T    +++VN+ T  AS+ G    +V++I+   
Sbjct: 122 VLTGD----VLLNQSAGTLASQRMVVNLTTGTASMAG----RVKTILNPS 163


>gi|163745217|ref|ZP_02152577.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
 gi|161382035|gb|EDQ06444.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
          Length = 164

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 81/171 (47%), Gaps = 13/171 (7%)

Query: 9   HLYIHLLALVFVLLKADL-SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           HL+I +L L+F L  A + +Q+A       +   +  + + AD L V +A   A F GNV
Sbjct: 3   HLFILMLPLLFALQAAPVTAQSANVAFGALEQDTSLPVEVTADNLSVDNASGTAIFTGNV 62

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            ++Q + +L A K+ + Y   ++     I +++    + + +GE    +     D     
Sbjct: 63  LISQGEMTLSAGKVQVIYRAEDQ----GIAKLEATGGVVLVAGEDAAESQRADYDIDAGT 118

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           LV++GD    V++ +  +     ++ VN++   A + G     V++I++  
Sbjct: 119 LVMSGD----VLMTQGPSALSAQEMTVNLNDGTAQMSG----GVKTILQPG 161


>gi|221640650|ref|YP_002526912.1| OstA family protein [Rhodobacter sphaeroides KD131]
 gi|221161431|gb|ACM02411.1| OstA family protein precursor [Rhodobacter sphaeroides KD131]
          Length = 163

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 62/153 (40%), Gaps = 12/153 (7%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A  ++    K      + I +D L+V  A   A F GNV + Q    L A  + ++Y   
Sbjct: 23  AEVAFGGGLKQDTTLPVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEYAPG 82

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                  I R+     + + +G     A       +   +V+ GD    V+L +  NT  
Sbjct: 83  G----GAIRRLHASGGVTLANGSEAAEAKEAVYTIESGEVVMTGD----VLLTQGPNTLA 134

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           G KL++++      ++G    +VQ++ +    P
Sbjct: 135 GQKLVIDLTAGTGRMEG----RVQTVFQPGKAP 163


>gi|77464736|ref|YP_354240.1| OstA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463576|ref|YP_001044690.1| OstA family protein [Rhodobacter sphaeroides ATCC 17029]
 gi|77389154|gb|ABA80339.1| OstA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105240|gb|ABN77918.1| OstA family protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 163

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 62/153 (40%), Gaps = 12/153 (7%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A  ++    K      + I +D L+V  A   A F GNV + Q    L A  + ++Y   
Sbjct: 23  AEVAFGGGLKQDTTLPVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEYAPG 82

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                  I R+     + + +G     A       +   +V+ GD    V+L +  NT  
Sbjct: 83  G----GAIRRLHASGGVTLANGSEAAEAKQAVYTIESGEVVMTGD----VLLTQGPNTLA 134

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           G KL++++      ++G    +VQ++ +    P
Sbjct: 135 GQKLVIDLTAGTGRMEG----RVQTVFQPGKAP 163


>gi|254476217|ref|ZP_05089603.1| OstA family protein [Ruegeria sp. R11]
 gi|214030460|gb|EEB71295.1| OstA family protein [Ruegeria sp. R11]
          Length = 159

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 6/158 (3%)

Query: 8   IHLYIHLLALVFVLLKADL-SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           ++L + +  L F LL A + +Q A+      K   +  + + AD L+V      A F GN
Sbjct: 1   MYLRVLMFCLPFALLSAGVSAQNASIAFGAVKADPSLPVEVTADALDVNQQDGSARFVGN 60

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           V + Q    L AD + + Y   +      + R++   N+ + +G     A          
Sbjct: 61  VIIIQGVMRLSADDVLVIYKQDD-GGKTGVERLEAAGNVILVNGPDAAEADKAEYTIDSG 119

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
            +V+ G+    V+L +   T    +L+VN+ T  AS+ 
Sbjct: 120 TVVMTGN----VLLSQGTGTLTSNRLVVNLTTGTASMS 153



 Score = 39.2 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 24/57 (42%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
           N     +AD  E           GNV ++Q   +L ++++ ++       +S ++ R
Sbjct: 102 NGPDAAEADKAEYTIDSGTVVMTGNVLLSQGTGTLTSNRLVVNLTTGTASMSRRVRR 158


>gi|254486869|ref|ZP_05100074.1| lipopolysaccharide transport periplasmic protein LptA [Roseobacter
           sp. GAI101]
 gi|214043738|gb|EEB84376.1| lipopolysaccharide transport periplasmic protein LptA [Roseobacter
           sp. GAI101]
          Length = 164

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 67/169 (39%), Gaps = 12/169 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           YI L   + +   +  +Q         +   +  + + AD L V  A   A F GNV + 
Sbjct: 6   YILLPIFLILSAMSVAAQGTNVAFGTIRQDTSLPVEVTADNLSVDQATGTAIFTGNVVIG 65

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L A ++ + Y       +  I R++    + + SG     +     D     +V+
Sbjct: 66  QGEMRLSAARVLVVYRAD----AEGIARLEATGGVTLVSGADAAESQRADYDIDSGTIVM 121

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            G+    V+L +  N     K+ VN+    A + G    +V++ ++  G
Sbjct: 122 TGN----VLLAQGRNALSSDKMSVNLSDGTAQMSG----RVKTTLQPGG 162


>gi|170751837|ref|YP_001758097.1| OstA family protein [Methylobacterium radiotolerans JCM 2831]
 gi|170658359|gb|ACB27414.1| OstA family protein [Methylobacterium radiotolerans JCM 2831]
          Length = 223

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 62/172 (36%), Gaps = 29/172 (16%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR- 90
           S        G + I I AD L+V D   KA F GNV   Q D +++   MT+ Y      
Sbjct: 31  SPFGNIGGGGKDPIKIDADRLDVFDRENKAVFAGNVVAVQGDSTIRCSTMTVTYKRGRDA 90

Query: 91  ------------------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
                                      N I ++D    + +   +      +   D   +
Sbjct: 91  PGKGARGDAKTEARDEGADAAPRNPAENGIQKVDCAGPVTVVQKDQVATGDHAVFDQDAK 150

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +VL G+    V+L +  N   G +L+ +++T  A++      +V ++    
Sbjct: 151 RIVLTGN----VVLSQCQNVTRGQRLVYDMNTGRANMDPVAGGRVSALFVPG 198


>gi|511886|gb|AAA26347.1| ORF0 [Sinorhizobium meliloti]
          Length = 127

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 7/128 (5%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---INRMDVERNIFIQSGEI 112
           D   KA F GNV + Q   +LQA  MT+ Y      V++    I+R++V   +F+ SG  
Sbjct: 1   DPESKAIFTGNVKVVQGTTTLQAGNMTVFYKAGGGSVTSGNADIDRIEVSNKVFLSSGAQ 60

Query: 113 NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
                +G V+   + +VL G    KV+L E  N F+GC+L V +DT  A L  C   +VQ
Sbjct: 61  QATGESGIVNLTNQTIVLKG---KKVVLSEGKNVFVGCQLNVQMDTGEAQLDAC-GGRVQ 116

Query: 173 SIIRYDGR 180
             +    R
Sbjct: 117 IQLDPQSR 124


>gi|220925753|ref|YP_002501055.1| OstA family protein [Methylobacterium nodulans ORS 2060]
 gi|219950360|gb|ACL60752.1| OstA family protein [Methylobacterium nodulans ORS 2060]
          Length = 239

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 65/180 (36%), Gaps = 35/180 (19%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY------ 85
           S    F   G E I I AD L+V D   KA F GNV   Q + +++   MT+ Y      
Sbjct: 34  SGFGAFGSSGKEPIKIDADRLDVFDHENKAIFAGNVVAVQGESTIRCSSMTVHYQRNRDK 93

Query: 86  -------------------------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
                                       +   S  I ++     + + + +      N  
Sbjct: 94  DAKDGAKSADKPADGKAPDAKTSDAKPADPTDSGAIKQVVCAGPVTVVNKDQVATGDNAV 153

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            D     ++L G+    V+L +  N   G +L+ +++T  A++      +V ++    G+
Sbjct: 154 FDKAANRVILTGN----VVLSQCQNVTRGNRLVYDMNTGRANMDPTAGGRVSAMFVPGGK 209


>gi|87201261|ref|YP_498518.1| OstA-like protein [Novosphingobium aromaticivorans DSM 12444]
 gi|87136942|gb|ABD27684.1| OstA-like protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 184

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S         N  ++  AD +EV+D  ++    GNV ++Q D  ++A + T+ Y++T   
Sbjct: 34  SAQGIASHDSNAPVNYAADRIEVQDKAKRVVLSGNVDISQSDLRMRAARTTVAYSDTG-- 91

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
            +  I R+D    + +  G  +        DF + I+ + G+    V L+   +T  G +
Sbjct: 92  -NIDIERIDATGGVQVTRGSESARGDVAVYDFNRNIITMTGN----VALRRGGDTLNGGR 146

Query: 152 LIVNIDTSFASLQ 164
           L++++D+  +S+ 
Sbjct: 147 LVIDLDSGLSSVD 159


>gi|163742523|ref|ZP_02149909.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
 gi|161384108|gb|EDQ08491.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
          Length = 165

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 71/169 (42%), Gaps = 10/169 (5%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + + +  L +         +Q+A+      K   ++ + + A+ L+V  A   A F G+V
Sbjct: 3   LRVLMFCLPVTLFYTGLS-AQSASIAFGAVKADPSQPVEVTAETLDVNQADGSARFIGDV 61

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q    L A+ + + Y          + R++   N+ + +G     A           
Sbjct: 62  VIIQGVMRLSANDVLVIYKQDE-TGKTGVERLEASGNVILVNGPDAAEADKAEYTIDSGT 120

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +V+ G+    V+L +   T    +L+V++ T  ASL    S +V++I+ 
Sbjct: 121 VVMTGN----VLLSQSTGTLTSNRLVVDLTTGTASL----SGRVKTILN 161


>gi|84500655|ref|ZP_00998904.1| hypothetical protein OB2597_11871 [Oceanicola batsensis HTCC2597]
 gi|84391608|gb|EAQ03940.1| hypothetical protein OB2597_11871 [Oceanicola batsensis HTCC2597]
          Length = 162

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%), Gaps = 12/156 (7%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
                A  +     ++  +  + +++D L V  +   A F GNV + Q +  L A ++ +
Sbjct: 18  PVAGMAQQTAFGSAQLDPDTPVEVESDELRVNQSDGTAEFLGNVVIVQAEMRLAAPRVLV 77

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            Y+        +I  ++    + + SGE    A     D     +V+ GD    V+L + 
Sbjct: 78  TYDEEGE----RIRLLEATGGVTLVSGEDAAEAQRADYDIDAGTIVMEGD----VLLVQG 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            +T     + V++++  A + G    +V++++   G
Sbjct: 130 ESTLASQAMTVDLESGTAQMSG----RVRTLLNPGG 161


>gi|163738081|ref|ZP_02145497.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
 gi|161388697|gb|EDQ13050.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
          Length = 165

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 71/169 (42%), Gaps = 10/169 (5%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + + +  L +         +Q+A+      K   ++ + + A+ L+V  A   A F G+V
Sbjct: 3   LRVLMFCLPVTL-FSTGLSAQSASIAFGAVKADPSQPVEVTAETLDVNQADGSARFIGDV 61

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q    L A+ + + Y          + R++   N+ + +G     A           
Sbjct: 62  VIIQGVMRLSANDVLVIYKQDE-TGKTGVERLEASGNVILVNGPDAAEADKAEYTIDSGT 120

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +V+ G+    V+L +   T    +L+V++ T  ASL    S +V++I+ 
Sbjct: 121 VVMTGN----VLLSQSTGTLTSNRLVVDLTTGTASL----SGRVKTILN 161


>gi|307293722|ref|ZP_07573566.1| OstA family protein [Sphingobium chlorophenolicum L-1]
 gi|306879873|gb|EFN11090.1| OstA family protein [Sphingobium chlorophenolicum L-1]
          Length = 183

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 67/152 (44%), Gaps = 8/152 (5%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           ++  L  A L  A A          N  ++  AD +EV+D   +    G+V +TQ   +L
Sbjct: 6   ILLSLGAAGLVYAGAGAQVLKNHDSNAPVNFTADRIEVQDRADRVIVSGHVEVTQAGMTL 65

Query: 77  QADKMTIDYNNTNRDVSN----KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            A +MT+ Y N     +     +I+R+D   N+ +   +     +    D   R++ + G
Sbjct: 66  NAARMTVAYRNQPGGGTGTNGVEIDRIDASGNVVVTKADQTAKGNVAIYDLNSRLITMLG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           +    V L +  N   G +L++++ +  +++ 
Sbjct: 126 N----VSLTQGTNRLTGGRLVIDLTSGRSTVD 153


>gi|260577295|ref|ZP_05845268.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
 gi|259020476|gb|EEW23799.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
          Length = 169

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 79/177 (44%), Gaps = 12/177 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++     I + +++ +L  A  +Q A       KV  +  + I++D L+V  A   A F 
Sbjct: 1   MSRPLRAIIVASMLGLLPLAAAAQGANVAFGGLKVDSSLPVEIESDQLDVDQATGVAVFT 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV + Q +  L A  + ++Y+   +     I+++     + + +      +S       
Sbjct: 61  GNVLVGQGELRLSAATVRVEYDAEGK----AISKLHASGGVTLANATEAAESSEAVYTIA 116

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
              +V+ G+    V+L +  +   G +L+++++    +++G    +VQ++     +P
Sbjct: 117 SGSVVMTGN----VLLTQGESAITGQRLVIDVNAGTGTMEG----RVQTVFVPAKKP 165


>gi|254509814|ref|ZP_05121881.1| OstA family protein [Rhodobacteraceae bacterium KLH11]
 gi|221533525|gb|EEE36513.1| OstA family protein [Rhodobacteraceae bacterium KLH11]
          Length = 151

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 64/153 (41%), Gaps = 12/153 (7%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
              +Q A       +   +  + + ++ L V      A F GNV + Q +  L A+++ +
Sbjct: 7   PVSAQEAQVAFGSVEADPSLPVEVTSETLNVNQENGSAEFVGNVIVIQGEMRLTAERVLV 66

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            YN       + I RM+   N+ + S                 ++ + G+    V+L + 
Sbjct: 67  IYNEDR----SAIERMEATENVVLVSPPDAAEGDWAEYTIDSGVIRMRGN----VLLTQG 118

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
            +   G ++I N+ +  A++ G    +V++I++
Sbjct: 119 PSIISGDQMIANLTSGTATMSG----RVKTILQ 147


>gi|149185093|ref|ZP_01863410.1| hypothetical protein ED21_18607 [Erythrobacter sp. SD-21]
 gi|148831204|gb|EDL49638.1| hypothetical protein ED21_18607 [Erythrobacter sp. SD-21]
          Length = 183

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 65/153 (42%), Gaps = 7/153 (4%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
             F L  A L     S         N  +   AD +E++D   +    GNV +TQ + +L
Sbjct: 14  FGFALTAAALGGIQLSAQAIAAHNSNAPVSYAADRIELQDRQNRVVLSGNVQITQAELNL 73

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            A +  ++Y++     S +I R+     + +  G           DF +R++ + G+   
Sbjct: 74  NAARTIVNYSDAG---SLRIQRIIATGGVDVSRGNERARGDTAVYDFNRRVITMAGN--- 127

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
            V L    +T  G +L++++ +  +S+ G  S 
Sbjct: 128 -VRLNRGGDTLNGGRLVIDLASGVSSIDGQASG 159


>gi|56695007|ref|YP_165354.1| hypothetical protein SPO0080 [Ruegeria pomeroyi DSS-3]
 gi|56676744|gb|AAV93410.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 163

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 13  HLLALVFVLLKADLSQAAAS--YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            L+  + + L A  +QA  +       K      + + AD L+V      A F+GNV ++
Sbjct: 6   ALILGLVLALGAVAAQAEGTKVAFGAVKADPTLPVEVTADSLDVSQEDGSAEFQGNVLVS 65

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L A ++ + YN      ++ I R++   ++ + SG     A          ++V+
Sbjct: 66  QGEMRLSAKRVLVIYNQE----ASGIERLEATGDVVLVSGSDAAQAQRADYTIGTGVIVM 121

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            GD    V+L +  N     K+ VN+ +  A + G    +V++I+   
Sbjct: 122 TGD----VLLTQGKNALSSGKMTVNLTSGTAQMVG----RVKTILNSG 161


>gi|126732865|ref|ZP_01748656.1| hypothetical protein SSE37_18342 [Sagittula stellata E-37]
 gi|126706641|gb|EBA05715.1| hypothetical protein SSE37_18342 [Sagittula stellata E-37]
          Length = 164

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 71/169 (42%), Gaps = 12/169 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             L A+   +  A     +           +  + + AD L V  A   A + GNV + Q
Sbjct: 4   ALLAAICMAIFPAVTLAQSQVSFGGGGQDTSAPVEVTADSLSVNQADGTALYSGNVVIVQ 63

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            +  L A ++ + Y+    D  ++I RM+    + +  GE          +     +VL+
Sbjct: 64  GEMRLAAPRVLVIYS----DTRSEITRMEATGGVVMVRGEEAAEGERADYNIDDGQIVLS 119

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           G+    V++ +  +     +++VN+D   A + G    +V+++++  GR
Sbjct: 120 GN----VLVTQGESAMTSERMVVNLDDGTAQMSG----RVKTVLQQGGR 160


>gi|146278805|ref|YP_001168964.1| OstA family protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557046|gb|ABP71659.1| OstA family protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 168

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 62/153 (40%), Gaps = 12/153 (7%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A  ++        +  + I++D L+V  A   A F GNV + Q    L A  + ++Y   
Sbjct: 28  ANVAFGGGLTQDTSLPVEIESDELQVNQADGTAIFLGNVRVVQGPMRLAAQSVRVEYAPE 87

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                  I R+     + + +      A       +   +V+ GD    V+L +  NT  
Sbjct: 88  G----GGIRRLHASGGVTLANEREAAEAQEAIYTIESGEVVMTGD----VLLTQGPNTLA 139

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           G +L++++      ++G    +VQ++ R    P
Sbjct: 140 GQRLVIDLTAGTGRMEG----RVQTVFRPGTSP 168


>gi|326388614|ref|ZP_08210207.1| hypothetical protein Y88_3015 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206865|gb|EGD57689.1| hypothetical protein Y88_3015 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 210

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 63/126 (50%), Gaps = 6/126 (4%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
                +   AD +E++D  ++    GNV +TQE+  L+AD+  + Y + ++     + R+
Sbjct: 46  NSEAPVDFSADHMELQDKQKRVLLTGNVDITQEELRLKADRTLMTYTDNDKLT---LQRI 102

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
           +   N+ +   +          DF ++I+ + G  A   + + + +T  G +L+++++T 
Sbjct: 103 EATGNVVVTRQDERAAGDVAVYDFNRKIITMVGHVA---LRRAQGDTLNGGRLVIDLNTG 159

Query: 160 FASLQG 165
            +S+ G
Sbjct: 160 ISSIDG 165


>gi|294013114|ref|YP_003546574.1| OstA-like protein [Sphingobium japonicum UT26S]
 gi|292676444|dbj|BAI97962.1| OstA-like protein [Sphingobium japonicum UT26S]
          Length = 183

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN----K 95
             N  ++  AD +EV+D   +    GNV +TQ   +L A +MT+ Y N     +     +
Sbjct: 29  DSNAPVNFTADRIEVQDRADRVVVSGNVEVTQAGMTLNAARMTVAYRNQPGGGTGPGGVE 88

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
           I+R+D   N+ ++  +     +    D   R++ + G+    V L +  N   G +L+++
Sbjct: 89  IDRIDASGNVVVRKADQTAKGNVAIYDLNSRLITMLGN----VSLTQGANRLTGGRLVID 144

Query: 156 IDTSFASLQ 164
           + +  +++ 
Sbjct: 145 LTSGRSTVD 153


>gi|240139045|ref|YP_002963520.1| hypothetical protein MexAM1_META1p2464 [Methylobacterium extorquens
           AM1]
 gi|240009017|gb|ACS40243.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 242

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 60/168 (35%), Gaps = 27/168 (16%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
                G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y          
Sbjct: 38  GTVGGGKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPSK 97

Query: 92  -------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
                                N I +++    + +   +      N   D + + +VL G
Sbjct: 98  DAAKSEAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTG 157

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           +    V+L +  N   G +L+ ++ +  A++      +V ++      
Sbjct: 158 N----VVLSQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPGEA 201


>gi|260431733|ref|ZP_05785704.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415561|gb|EEX08820.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 137

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 64/147 (43%), Gaps = 12/147 (8%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                K      + + ++ L+V      A F GNV + Q D  L A+K+ + YN      
Sbjct: 2   AFGSIKTDPALPVEVTSETLKVNQEDGSAEFLGNVIVVQGDMRLSAEKVVVIYNQDR--- 58

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
            + I RM+   N+ + +      A          ++V+ G+    V+L +  +T  G ++
Sbjct: 59  -SGIERMEASENVVLVAPPDAAQADRAEYSIATGVIVMTGN----VLLNQGPSTISGDRM 113

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYDG 179
           + N+    A++ G    +V++I++  G
Sbjct: 114 VANLTDGTATMTG----RVKTILQQGG 136


>gi|163851922|ref|YP_001639965.1| OstA family protein [Methylobacterium extorquens PA1]
 gi|163663527|gb|ABY30894.1| OstA family protein [Methylobacterium extorquens PA1]
          Length = 242

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 60/168 (35%), Gaps = 27/168 (16%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
                G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y          
Sbjct: 38  GTVGGGKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPAK 97

Query: 92  -------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
                                N I +++    + +   +      N   D + + +VL G
Sbjct: 98  DAAKSEAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTG 157

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           +    V+L +  N   G +L+ ++ +  A++      +V ++      
Sbjct: 158 N----VVLSQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPGEA 201


>gi|148555813|ref|YP_001263395.1| OstA family protein [Sphingomonas wittichii RW1]
 gi|148501003|gb|ABQ69257.1| OstA family protein [Sphingomonas wittichii RW1]
          Length = 173

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/167 (23%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +L+  +L      A A  +   K    +  +   AD +E++D V +A   GNV + Q D 
Sbjct: 9   SLLIAVLAGTAGLAGAQTVNALKQHDSSAPVDFAADRIELQDRVDRAVLTGNVDVKQGDM 68

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            L++ ++TI Y +       ++ RMD    + + +   N  +     D + R++ + GD 
Sbjct: 69  RLRSARLTIAYTSA---AQTEVTRMDASGGVVLTTSTENARSQYAIYDLRTRLVTMIGDV 125

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQ-GCESDQVQSIIRYDGR 180
              VI++       G +L++N+++  ASL+ G    +V        R
Sbjct: 126 ---VIVRAGKGETRGNRLVLNLNSGAASLEGGGAGGRVTGRFTPPPR 169


>gi|296282121|ref|ZP_06860119.1| OstA-like protein [Citromicrobium bathyomarinum JL354]
          Length = 179

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 62/155 (40%), Gaps = 7/155 (4%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            L      + F L    L+              N  +   A+ +E++D   +    GNV 
Sbjct: 11  RLAARSGVVGFALAACTLTGIQLHAQAIAAHNSNAPVDYAANRIELQDRQNRVVLSGNVV 70

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           + Q D  + +    +DY++     S  I R+     + +  G  +   +    DF +R++
Sbjct: 71  IEQADLRMTSASTIVDYSDAG---SLSIQRISATGGVTVTRGNESARGNVAVYDFNRRVI 127

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + G+    V LK   +T  G +L +++ T  +S+
Sbjct: 128 TMTGN----VRLKRGSDTLNGGRLTIDLRTGLSSV 158


>gi|255262551|ref|ZP_05341893.1| lipopolysaccharide transport periplasmic protein LptA
           [Thalassiobium sp. R2A62]
 gi|255104886|gb|EET47560.1| lipopolysaccharide transport periplasmic protein LptA
           [Thalassiobium sp. R2A62]
          Length = 161

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 69/162 (42%), Gaps = 12/162 (7%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +AL+F L  A  +Q     +       +  + I AD L +     +A F GNV + Q D 
Sbjct: 8   IALLFCLPFAVSAQGTNITLGGINAQPDAPVEISADNLNIDQDSGRAVFSGNVVIGQGDL 67

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            L A  + + Y+    D   KI+ ++    +   +      A++   D     L L+G+ 
Sbjct: 68  RLAAGTVQVTYS----DEQGKISALNASGGVTFVTESEQAEAASAVYDLDGEQLTLSGN- 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
              V+L +  +     K+ +N+ T  A ++G    +V+++  
Sbjct: 123 ---VLLTQGASALTADKMTINLSTGNARMEG----RVRTVFE 157


>gi|188581679|ref|YP_001925124.1| OstA family protein [Methylobacterium populi BJ001]
 gi|179345177|gb|ACB80589.1| OstA family protein [Methylobacterium populi BJ001]
          Length = 250

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 61/174 (35%), Gaps = 31/174 (17%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S        G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y      
Sbjct: 42  SAPLGTVGGGKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDK 101

Query: 92  ---------------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
                                        + I +++    + +   +      N   D +
Sbjct: 102 DPGKDAAKGDPKTDAQAAEDAKAKAAMGGSGIRKVECAGPVTVAQKDQIATGDNAVFDQE 161

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +VL G+    V+L +  N   G +L+ ++ T  A++      +V ++    
Sbjct: 162 AKRIVLTGN----VVLSQCQNVTRGSRLVYDMATGRANMDPVAGGRVSAMFVPG 211


>gi|259417071|ref|ZP_05740990.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
 gi|259345977|gb|EEW57791.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
          Length = 165

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 71/175 (40%), Gaps = 12/175 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +   I       V   A ++Q         +   ++ + I +D + V      A   
Sbjct: 1   MRRLTFVILFGLTALVHTPALMAQGTGVSFGVLQTDTSQPVDITSDNMSVNQEDGSALLT 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           G+V + Q +  L AD + +      R   N I R++   N+ + SGE    A       +
Sbjct: 61  GSVLIIQGEMRLSADNVLV----VRRAEGNGIERLEARGNVLLVSGEDAAEAREADYTIE 116

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
              +V+ G+    V+L ++ NT    ++ VNI T  A+L G    +V++ +   G
Sbjct: 117 SGTVVMRGN----VLLTQQGNTLGAEQMTVNITTGNATLSG----RVRTTLPGSG 163


>gi|218530673|ref|YP_002421489.1| OstA family protein [Methylobacterium chloromethanicum CM4]
 gi|218522976|gb|ACK83561.1| OstA family protein [Methylobacterium chloromethanicum CM4]
          Length = 246

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 60/172 (34%), Gaps = 31/172 (18%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
                G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y          
Sbjct: 38  GTVGGGKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPAK 97

Query: 92  -----------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
                                    N I +++    + +   +      N   D + + +
Sbjct: 98  DANKDAAKSEAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRI 157

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           VL G+    V+L +  N   G +L+ ++ +  A++      +V ++      
Sbjct: 158 VLTGN----VVLSQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPGEA 205


>gi|103487822|ref|YP_617383.1| OstA-like protein [Sphingopyxis alaskensis RB2256]
 gi|98977899|gb|ABF54050.1| OstA-like protein [Sphingopyxis alaskensis RB2256]
          Length = 191

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 76/179 (42%), Gaps = 18/179 (10%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
               +  +   L  L         +QA A++        N  +   A  +EV+D   +  
Sbjct: 11  MLAGAGFVLTSLAILSVGGGDRAAAQALANH------NSNAPVDFAAGSIEVQDRADRVV 64

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
             GNV +TQ    + A +MT+ Y    R     +NR+D    + +  G+ +   +    D
Sbjct: 65  LAGNVRVTQAGLVVTAPRMTVAYT---RAGGTDVNRLDATGGVTVVKGDESARGNVAIYD 121

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
             +R++ + G+    V L+++ N   G +L++++++  A++ G  + +       DG P
Sbjct: 122 LDRRLITMVGN----VELRQRGNNLRGGRLVIDLNSGRATVDGRGAAR-----GPDGNP 171


>gi|83855389|ref|ZP_00948919.1| hypothetical protein NAS141_11676 [Sulfitobacter sp. NAS-14.1]
 gi|83843232|gb|EAP82399.1| hypothetical protein NAS141_11676 [Sulfitobacter sp. NAS-14.1]
          Length = 164

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 59/157 (37%), Gaps = 12/157 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q         +      + + AD L V      A F GNV + Q +  L A ++
Sbjct: 17  AMPIAAQGTNVAFGSIRQDTGLPVEVTADNLSVDQGDGSAVFTGNVLIGQGEMRLSAARV 76

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y       +  I R++    + + SG+    +     D     +V++G+    V+L 
Sbjct: 77  LVVYRAD----AEGIARLEATGGVTLVSGKDAAESERADYDIDTGTIVMSGN----VLLT 128

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  N      + V +    A +    S +V++I++  
Sbjct: 129 QGRNALSSDTMSVKLSDGTAQM----SGRVKTILQTG 161


>gi|83941913|ref|ZP_00954375.1| hypothetical protein EE36_06753 [Sulfitobacter sp. EE-36]
 gi|83847733|gb|EAP85608.1| hypothetical protein EE36_06753 [Sulfitobacter sp. EE-36]
          Length = 164

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 60/157 (38%), Gaps = 12/157 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q         +      + + AD L V      A F GNV + Q +  L A ++
Sbjct: 17  AMPIAAQGTNVAFGSIRQDTGLPVEVTADNLSVDQGDGSAVFTGNVLIGQGEMRLSAARV 76

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y    R  +  I R++    + + SG+    +     D     +V++G+    V+L 
Sbjct: 77  LVVY----RAEAEGIARLEATGGVTLVSGKDAAESERADYDIDTGTIVMSGN----VLLT 128

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  N      + V +    A + G    +V++I++  
Sbjct: 129 QGRNALSSDTMSVKLSDGTAQMSG----RVKTILQTG 161


>gi|119385333|ref|YP_916389.1| OstA family protein [Paracoccus denitrificans PD1222]
 gi|119375100|gb|ABL70693.1| OstA family protein [Paracoccus denitrificans PD1222]
          Length = 161

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 75/165 (45%), Gaps = 11/165 (6%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           LL ++  L+ A  +    +          + + + AD L V     +A F GNV + Q  
Sbjct: 7   LLPVILSLVLAAGAALGQTAGFGNAQDIKQPVEVTADALTVDQKTGRATFSGNVLIGQGA 66

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             L AD +T+ Y   +     +I+ +  E N+ + SGE    A     D +   +VL GD
Sbjct: 67  MRLSADSVTVTYAQGD---QRRISALHAEGNVTLASGEDAAEAQAADYDVETGTIVLTGD 123

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
               V+L +  N   G K+ VN+++  A+     S +V+S+++ +
Sbjct: 124 ----VLLTQGGNLLAGDKVTVNLESGTAN----ASGRVRSVLQPE 160


>gi|254561640|ref|YP_003068735.1| hypothetical protein METDI3227 [Methylobacterium extorquens DM4]
 gi|254268918|emb|CAX24879.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 246

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 60/172 (34%), Gaps = 31/172 (18%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
                G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y          
Sbjct: 38  GTVGGGKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPSK 97

Query: 92  -----------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
                                    N I +++    + +   +      N   D + + +
Sbjct: 98  DANKDAAKSDAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRI 157

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           VL G+    V+L +  N   G +L+ ++ +  A++      +V ++      
Sbjct: 158 VLTGN----VVLSQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPGEA 205


>gi|85705767|ref|ZP_01036864.1| hypothetical protein ROS217_10717 [Roseovarius sp. 217]
 gi|85669757|gb|EAQ24621.1| hypothetical protein ROS217_10717 [Roseovarius sp. 217]
          Length = 167

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 66/170 (38%), Gaps = 15/170 (8%)

Query: 12  IHLLALVFVLLKAD---LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
           I  L L F LL      L+Q A       +   N  + + +D L V  A   A F GNV 
Sbjct: 7   ISSLILAFALLLPPVVTLAQGAQVAFGNTQADRNLPVEVTSDSLSVNQADNTATFTGNVV 66

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           + Q    L A ++ + Y        + I  +     + + SGE    A     D    ++
Sbjct: 67  IGQGAMRLAAPEVLVVYLPD----KSGIESLKATGGVTLVSGEDAAEAERADYDITTGMI 122

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L G+    V+L +  N   G  + V+     A + G    +V++I++  
Sbjct: 123 ELRGN----VLLVQGTNAITGETVFVDTAAGTAQVSG----RVKTILQPG 164


>gi|89067361|ref|ZP_01154874.1| hypothetical protein OG2516_10991 [Oceanicola granulosus HTCC2516]
 gi|89046930|gb|EAR52984.1| hypothetical protein OG2516_10991 [Oceanicola granulosus HTCC2516]
          Length = 161

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 13/157 (8%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
            A  +Q +   +       +  + + AD L V      A F GNV + Q +  + A ++ 
Sbjct: 17  SAGWAQ-SNVDLGGISADPDAPVEVTADSLSVNREEGTAVFSGNVLIGQGELRISAAEVQ 75

Query: 83  IDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
           + Y+    + +  I R+     + + +      A     D     LV+ GD    V+L +
Sbjct: 76  VIYS----EETGDITRLLASGGVTMVTETEQAEAQTADYDIDAGQLVMEGD----VLLTQ 127

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             +     +++V++DT  A + G    +V+++ + DG
Sbjct: 128 GASALSAGRMVVDLDTGAAQMDG----RVRTVFQQDG 160


>gi|94495609|ref|ZP_01302189.1| OstA-like protein [Sphingomonas sp. SKA58]
 gi|94424997|gb|EAT10018.1| OstA-like protein [Sphingomonas sp. SKA58]
          Length = 187

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 77/182 (42%), Gaps = 13/182 (7%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +  L S         ++        +QA  ++        N  ++  AD +EV+D   + 
Sbjct: 4   TLILLSTGFLATTGVMIVGSGGPLFAQALRNH------DSNAPVNFTADRIEVQDRADRV 57

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK--INRMDVERNIFIQSGEINVIASNG 119
              GNV +TQ   +L A +MT+ Y N     +N   I+R+D   N+ +  G+     +  
Sbjct: 58  VVSGNVVVTQAGMTLNAARMTVAYRNQPGGGANGVEIDRIDASGNVVVTKGDQTARGNVA 117

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-DQVQSIIRYD 178
             D   +++ + G+    V L +  N   G +L++++++  +++ G  S     +     
Sbjct: 118 IYDLNAKLITMLGN----VALTQGANRLTGGRLVMDLNSGRSTVDGRSSGGGAGTSTSPS 173

Query: 179 GR 180
           GR
Sbjct: 174 GR 175


>gi|85709985|ref|ZP_01041050.1| hypothetical protein NAP1_13908 [Erythrobacter sp. NAP1]
 gi|85688695|gb|EAQ28699.1| hypothetical protein NAP1_13908 [Erythrobacter sp. NAP1]
          Length = 183

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

Query: 7   SIHLYIHLLALVFVLLKADL--SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++   +  LAL  V        +Q  AS+ TR        +   A  +   D   +    
Sbjct: 12  ALSWAVGGLALGLVAAGGMTLSAQGIASHNTR------APVSFDAGNIAFDDRANRVVLT 65

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           G V + Q    +++ +M   Y +   D S  + R+    N+ +  G           DF 
Sbjct: 66  GGVTVDQAGLRVRSQRMLASYTD---DGSLDVQRITANGNVVVTRGNERASGDVAVYDFN 122

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           +RI+ + G+    V L+   +T  G +L++N+DT  +++ G  S   Q+    DGR
Sbjct: 123 RRIITMAGN----VSLRRGTDTLNGGRLVINLDTGLSTMDGRASG-AQTTTNSDGR 173


>gi|149201446|ref|ZP_01878421.1| hypothetical protein RTM1035_17512 [Roseovarius sp. TM1035]
 gi|149145779|gb|EDM33805.1| hypothetical protein RTM1035_17512 [Roseovarius sp. TM1035]
          Length = 152

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 32/164 (19%), Positives = 66/164 (40%), Gaps = 12/164 (7%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           + +L     +QA      + +      + + +D L V  A   A F GNV + Q +  L 
Sbjct: 1   MALLPVGAWAQAGQVAFGKTQADRGLPVEVTSDNLSVNQADNTATFTGNVVIGQGEMRLA 60

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           A ++ + Y        + I  ++    + + SGE    A     +    ++ L G+    
Sbjct: 61  APRVLVVYLPDR----SGIESLEATGGVTLVSGEDAAEAERADYNISTGLIELRGN---- 112

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           V+L +  +   G  ++V+     A +    S +V++I++    P
Sbjct: 113 VLLVQGTSAIAGETVLVDTAAGTAQV----SGRVKTILQPGTTP 152


>gi|312114052|ref|YP_004011648.1| OstA family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219181|gb|ADP70549.1| OstA family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 250

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 75/218 (34%), Gaps = 42/218 (19%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M A    +   + L A V  +     +  +            + I I++D LEV D    
Sbjct: 1   MIAEKALLAFALMLSAAVMSIPSYAQTPGSGFRGIGSGDNAKKPIDIESDRLEVDDKRHV 60

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----------------------------- 91
           A F GNV   Q D++L+A ++ + Y     D                             
Sbjct: 61  AIFIGNVSANQGDYNLRAPRLEVTYERQGGDSAGGKAQKLVSAPGGDSPAKSPKTATDAA 120

Query: 92  ------VSNKINRMDVERN---IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                  S +I  +        +  +  E  V       D + + + + G    +VIL +
Sbjct: 121 AAADPISSGQIRYIRALGGHVVVTNKKDEQEVTGDEALYDVKGQKITMTG---KEVILSQ 177

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           K N   G +L ++++T  A++   E  +VQ+I      
Sbjct: 178 KANVVKGRQLSIDLETGRATV-IPEKGRVQAIFDQGAA 214


>gi|163733023|ref|ZP_02140467.1| hypothetical protein RLO149_10195 [Roseobacter litoralis Och 149]
 gi|161393558|gb|EDQ17883.1| hypothetical protein RLO149_10195 [Roseobacter litoralis Och 149]
          Length = 163

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 67/168 (39%), Gaps = 13/168 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++  L+LVF       +Q         +      + + AD L V      A F  NV + 
Sbjct: 7   FVFSLSLVFA-ATGLFAQGTQVAFGTVQENSGLPVEVTADSLAVDQNAGTALFTDNVIVI 65

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L AD + + Y+      +  I+R++   N+ + SG+    +     +     +V+
Sbjct: 66  QGEMRLSADNVLVIYD----TTAQAIDRIEATGNVVLISGQDAAESERADYNVDDGTIVM 121

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +G     V++ +  +      + V I    A + G    +V+++++  
Sbjct: 122 SG----SVLVAQGPSAISADTMTVQISDGTAQMSG----RVKTVLQTG 161


>gi|99079866|ref|YP_612020.1| OstA-like protein [Ruegeria sp. TM1040]
 gi|99036146|gb|ABF62758.1| OstA-like protein [Ruegeria sp. TM1040]
          Length = 144

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 66/154 (42%), Gaps = 12/154 (7%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           ++Q         +   ++ + I +D + V      A   GNV + Q +  L AD + +  
Sbjct: 1   MAQGTGVSFGVLQTDTSQPVDIASDNMSVNQEDGSALLTGNVLIIQGEMRLSADNVLV-- 58

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
               R   N I R++   N+ + SGE    A       Q   +V+ G+    V+L ++ +
Sbjct: 59  --VRRTEGNGIERLEARGNVLLVSGEDAAEAREADYTIQSGTVVMRGN----VLLTQQGS 112

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           T    ++ VN+ T  A+L    S +V++ +   G
Sbjct: 113 TLGAEQMTVNMTTGNATL----SGRVRTTLPGSG 142


>gi|85375261|ref|YP_459323.1| hypothetical protein ELI_12170 [Erythrobacter litoralis HTCC2594]
 gi|84788344|gb|ABC64526.1| hypothetical protein ELI_12170 [Erythrobacter litoralis HTCC2594]
          Length = 183

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 68/168 (40%), Gaps = 9/168 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
            A+ F       +    +         N  ++  A  LEV+D   +    G V +TQ   
Sbjct: 13  FAIGFAATATLAAGIGLNAQVFGGHNANAPVNFDAGRLEVQDRQNRVVLSGAVTVTQAGL 72

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           ++++++M ++Y++     +  I R+     + +  G           D  +RI+ + G+ 
Sbjct: 73  TVRSNRMVVNYSDAG---TLDIGRITATGGVTVTRGNERAQGDVAIYDLNRRIITMAGN- 128

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV--QSIIRYDGR 180
              V L    +   G +L++++++  +S+ G  +       +   DGR
Sbjct: 129 ---VRLNRGGDNLSGGRLVIDLNSGVSSVDGSAAPGAGETGVRGSDGR 173


>gi|182677565|ref|YP_001831711.1| OstA family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633448|gb|ACB94222.1| OstA family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 212

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 15/148 (10%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID-------YNNTNR 90
              G++ ++I+A  L+  D  QK  + GNV  TQ +  L+   + I         N+   
Sbjct: 57  GGNGHQPVNIEATKLDYFDKEQKLIYTGNVVATQGETILKTSTLIIYLVPKGSTANSAGG 116

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
             S+++ RM+    + + S +      +G  +  +  + LNG+    V L +  N   G 
Sbjct: 117 TGSDQVRRMEAPNAVVMISKDQVGTGDSGVYEKAENKVTLNGN----VTLTQGPNVTKGD 172

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           KL+ ++ TS A + G     V+S+    
Sbjct: 173 KLVYDLHTSQAVVIG----HVRSLFLPS 196


>gi|83944935|ref|ZP_00957301.1| hypothetical protein OA2633_09909 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851717|gb|EAP89572.1| hypothetical protein OA2633_09909 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 193

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 58/139 (41%), Gaps = 7/139 (5%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
             G   + I AD  +  DA     + G+V + + D  L+AD++   Y       S ++NR
Sbjct: 27  GSGEGPVDISADDFQAFDAQGMGVYTGDVNVVRGDVRLRADRLEAYYVRRG-GGSPELNR 85

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           +  E  +F  +         G  D    ++ L G     V+L +  N   G  L   + T
Sbjct: 86  IVAEGEVFYITPNEIARGDRGTYDLVNEVIELTG----SVVLTQGCNVSTGEHLHAELAT 141

Query: 159 SFASLQGCE--SDQVQSII 175
             A L+G +  S +V+S+ 
Sbjct: 142 GVARLEGGQNSSGRVRSVF 160


>gi|114568661|ref|YP_755341.1| OstA family protein [Maricaulis maris MCS10]
 gi|114339123|gb|ABI64403.1| OstA family protein [Maricaulis maris MCS10]
          Length = 180

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 63/141 (44%), Gaps = 6/141 (4%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN-KIN 97
              +  + I+A+  EV DA +   + GNV + Q D SLQAD+M + Y           I+
Sbjct: 26  GNSSLPLDIEAETFEVLDAERHIVWLGNVHVVQGDSSLQADRMDVYYTGEGPGGGWGDID 85

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R+    N+F  +         G  +  + ++ L GD    V++ +  N     + + N+ 
Sbjct: 86  RIVATDNVFYITPAQRARGDRGVYELAEEVITLTGD----VVITQGDNVITTTRFVNNLT 141

Query: 158 TSFASL-QGCESDQVQSIIRY 177
           T  ++  +    ++V+ +++ 
Sbjct: 142 TGNSNFGEAGTGERVRMVLQP 162


>gi|255020585|ref|ZP_05292648.1| OstA-like protein [Acidithiobacillus caldus ATCC 51756]
 gi|254969970|gb|EET27469.1| OstA-like protein [Acidithiobacillus caldus ATCC 51756]
          Length = 178

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 8/166 (4%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDA-VQKAFFKGNVFMTQE 72
           L+  + +L    L+ A  +       LG   IHI AD L  ++   Q+A + G V MTQ 
Sbjct: 8   LIPFLALLAGVFLASAQGAVAPTDAGLGKGPIHISADSLAAQNKPQQQAVYTGKVVMTQG 67

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           D  + A+K+TID      +V+  +          + S + +   +          +VL G
Sbjct: 68  DIVIHAEKLTIDARQGKVEVATAVGSPVTF---TMSSAQRHGYGNTLVYRPGSGEIVLTG 124

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L +  N   G ++I ++D    S+      +VQS+    
Sbjct: 125 NA----HLWQGPNEVSGQQVIYHLDDQRTSVSAAPGGRVQSVFYPG 166


>gi|110677769|ref|YP_680776.1| hypothetical protein RD1_0370 [Roseobacter denitrificans OCh 114]
 gi|109453885|gb|ABG30090.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 66/166 (39%), Gaps = 13/166 (7%)

Query: 14  LLALVFVLLKADL-SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
           +L+L  V     L +Q         +      + + AD L V      A F  NV + Q 
Sbjct: 8   ILSLPLVFAATGLLAQGTQVAFGTIQDNSGLPVEVTADSLAVDQNAGTALFTDNVIVIQG 67

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           +  L AD + + Y+      +  I+R++   N+ + SG+    +     +     +V++G
Sbjct: 68  EMRLSADNVLVVYD----TTAQAIDRIEATGNVVLISGQDAAESERADYNVDDGTIVMSG 123

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                V++ +  +      + V I    A +    S +V+++++  
Sbjct: 124 ----SVLVAQGPSAISADTMTVQISDGTAQM----SGRVKTVLQTG 161


>gi|149912956|ref|ZP_01901490.1| hypothetical protein RAZWK3B_03170 [Roseobacter sp. AzwK-3b]
 gi|149813362|gb|EDM73188.1| hypothetical protein RAZWK3B_03170 [Roseobacter sp. AzwK-3b]
          Length = 167

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 65/160 (40%), Gaps = 12/160 (7%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L+  +     +Q+A       +      + + +++L V +    A F GNV + Q +  
Sbjct: 11  VLLAGMPTVGHAQSAQVAFGDSQQDSTLPVEVVSEVLNVNENDGTAIFTGNVIVGQGEMR 70

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L A ++ + Y        + I  +     + + SGE    A     +    ++ ++G+  
Sbjct: 71  LWAPRVEVIYKQD----QSGIESLHATGGVTLVSGEDAAEAREADYNIDTGMIEMDGE-- 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
             V+L +   T    K++V+     A + G    +V++++
Sbjct: 125 --VLLVQGPQTLTSDKMVVDTRAGTAQMTG----RVKTVL 158


>gi|126724657|ref|ZP_01740500.1| OstA-like protein [Rhodobacterales bacterium HTCC2150]
 gi|126705821|gb|EBA04911.1| OstA-like protein [Rhodobacterales bacterium HTCC2150]
          Length = 162

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 12/168 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  ++ALV  L +  L+Q A       +   +  + I++D   V  +   A F GNV + 
Sbjct: 5   FWAVIALV-CLPQLLLAQGADVAFKDMEHDASAPVEIESDKFSVDQSTNLAVFLGNVLVV 63

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q    L AD++ ++Y     D SN I+ +    N+   +G     A           +V+
Sbjct: 64  QGLLRLSADQVNVEY---ASDESNDISAVIAVGNVTFVNGAEAAEAQRAEYTLATNEIVM 120

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            GD    V++ +  +   G K++VN++T    + G    +V++I+R  
Sbjct: 121 TGD----VLVTQGRSALSGQKMVVNLETGKGEMIG----RVKTILRSG 160


>gi|300021931|ref|YP_003754542.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523752|gb|ADJ22221.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 640

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 66/154 (42%), Gaps = 13/154 (8%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-------- 86
             FK   N    + +D L+V D  + A F GNV   Q +F++Q+ +MT  Y         
Sbjct: 448 QAFKTDPNAPYDVTSDRLDVDDNAKTALFTGNVVTVQGNFTIQSGEMTAYYTGRSGLGMS 507

Query: 87  NTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           +        +  +  ++++ + S +          VD +  +  L G+    V+L +  N
Sbjct: 508 DDKAKSGASLTHIRAKKDVTVVSKDGQKASGDWAEVDVKTNLAKLGGN----VVLTQGKN 563

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
              G KL++++ T  A+++   +   +S +   G
Sbjct: 564 VVRGTKLLIDMTTGQATIKTEPTASSESSMVSAG 597



 Score = 77.0 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 53/163 (32%), Gaps = 40/163 (24%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-------------NNTN 89
           E I + +  L+V D  + A F G V  TQ   +L A +M + Y               T 
Sbjct: 246 EPIDVASSRLDVDDNKKVALFTGQVTATQGGSTLVAPEMAVTYEGQVTPEAGADESKQTP 305

Query: 90  RDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDR-------------- 134
            +   K+ ++  + ++ +         +     D   ++ VL GD               
Sbjct: 306 AEGGTKVKQVVAKESVTLTQASGETATSRTATFDTAAQLAVLEGDVVLTQGADKKAVGDR 365

Query: 135 ------------ADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
                          V++ +  N   G +L+ +  TS   L  
Sbjct: 366 AEYDEANQKLTLTGPVVVTQGQNVLKGRRLVYHRATSKMQLTA 408


>gi|260753181|ref|YP_003226074.1| OstA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552544|gb|ACV75490.1| OstA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 198

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           FL +  L +    L+   L A  +Q    +        N  I I AD  EV     +A +
Sbjct: 13  FLKAAALLLCGFTLILTPLSALSAQGFRHH------DTNAPIDIDADHSEVLYNDNRAIY 66

Query: 64  KGNVFMTQEDFSLQADKMTIDY----NNTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
            G+V   Q D ++ A  + I Y    N+   + S ++ R+D    + IQ+ +        
Sbjct: 67  SGHVRARQADMTITAAYVRIAYTMPKNSKTGEASPQMQRLDASGGVTIQTPDEMAKGEIA 126

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
             D  KR++ L G     V +    +   G +LI++++T   ++ G
Sbjct: 127 IYDVPKRLVTLVGH----VEMVRGDSVVHGARLIIDLNTGKGTMDG 168


>gi|85859056|ref|YP_461258.1| organic solvent tolerance protein [Syntrophus aciditrophicus SB]
 gi|85722147|gb|ABC77090.1| organic solvent tolerance protein [Syntrophus aciditrophicus SB]
          Length = 197

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 73/170 (42%), Gaps = 15/170 (8%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
           + ++ A ++        + +V G+E I I +D L+  +  +   F GN    Q D ++++
Sbjct: 26  WAVMAAPVA-GEPQSQKKNQVTGSEPIRIDSDRLDAYNDQRLVVFSGNAVAVQGDKTIKS 84

Query: 79  DKMTIDYNNTNRDV----------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +K+ + Y                 +  + R++ + N+ +  GE  V           + +
Sbjct: 85  EKILLYYKKGESGTQKVASKEVGKTGDLERIEAKGNVILTQGERVVTGDEAVYYQGSQKI 144

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           V++G+     +++E  N   G +++V I+ +   ++  +  +V + I   
Sbjct: 145 VMSGNA----VMRENRNIIRGDRIVVFINENRGMVESTQRKRVTATIYPS 190


>gi|56551172|ref|YP_162011.1| OstA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760849|ref|ZP_04758938.1| OstA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|56542746|gb|AAV88900.1| OstA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374468|gb|EER63929.1| OstA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 198

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           FL +  L +    L+   L A  +Q    +        N  I I AD  EV     +A +
Sbjct: 13  FLKAAALSLCGFTLILTPLSALSAQGFRHH------DTNAPIDIDADHSEVLYNDNRAIY 66

Query: 64  KGNVFMTQEDFSLQADKMTIDY----NNTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
            G+V   Q D ++ A  + I Y    N+   + S ++ R+D    + IQ+ +        
Sbjct: 67  SGHVRARQADMTITAAYVRIAYTMPKNSKTGEASPQMQRLDASGGVTIQTPDEMAKGEIA 126

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
             D  KR++ L G     V +    +   G +LI++++T   ++ G
Sbjct: 127 IYDVPKRLVTLVGH----VEMVRGDSVVHGARLIIDLNTGKGTMDG 168


>gi|89052717|ref|YP_508168.1| OstA-like protein [Jannaschia sp. CCS1]
 gi|88862266|gb|ABD53143.1| OstA-like protein [Jannaschia sp. CCS1]
          Length = 160

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 68/168 (40%), Gaps = 12/168 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +H  + LL ++  L     +Q             ++ + + +D L V     +A F GNV
Sbjct: 1   MHRILALLGVILCLTTPLSAQVNIG-FGGVAYDSSQPVEVTSDALTVDQTTGEAVFTGNV 59

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q D  + A  + + Y     D +  I+ +     + I  G      ++   +    +
Sbjct: 60  IVVQGDLRMAASAVRVLYT---TDGNQDISEVIATGGVLITRGTEAAEGNSAVFNVASSL 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           L L G+    V++ +      G  ++V++ T   ++ G    +V++++
Sbjct: 117 LTLRGN----VLVTQGQTAIAGDNMVVDMTTGSGTVDG----RVRTVL 156


>gi|254463023|ref|ZP_05076439.1| OstA family protein [Rhodobacterales bacterium HTCC2083]
 gi|206679612|gb|EDZ44099.1| OstA family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 180

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 70/178 (39%), Gaps = 12/178 (6%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           +SA +  + L                           K   +  I + ++ L V +    
Sbjct: 7   LSAVVLGLALSFGGFVHAQDTNTDPAEGGTTIAFGDRKQDTDAPIDVTSERLAVDENANT 66

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           A F G+V + Q+  +L A  + + Y        + I+ +  +  + +   E         
Sbjct: 67  ALFTGDVVVIQDTMTLYAPWVKVFYKED----QSGISHLKAKDGVTLLQNEEAAEGETAD 122

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            D +K I+V+NGD    V++ +KL+     K+ V +D   A + G    +V+S++R +
Sbjct: 123 YDLEKEIIVMNGD----VLVTQKLSAIASDKMTVRLDEGTALMTG----RVKSLLRTN 172


>gi|323136909|ref|ZP_08071989.1| OstA family protein [Methylocystis sp. ATCC 49242]
 gi|322397670|gb|EFY00192.1| OstA family protein [Methylocystis sp. ATCC 49242]
          Length = 179

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 73/180 (40%), Gaps = 13/180 (7%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRF-KVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           H    +LA  F+L     +QAA             + ++I A  L+  D  QK  + G+V
Sbjct: 3   HTAFAVLAA-FLLAGVAPAQAAGRSGGILPGATAKDPLNIDAGKLDFFDKEQKLVYSGSV 61

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNK-----INRMDVERNIFIQSGEINVIASNGYVD 122
            +T    +L+A K+TI   N     +       +  +D +  + + S +          D
Sbjct: 62  IVTNGPSTLKASKITIFLENKGAAAAGATSNDRVKHIDADGPVTLVSKDQIGTGDRASYD 121

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ--GCESDQVQSIIRYDGR 180
             +  + L G+    V L +  N   G +L+ ++ T+ A++Q  G +  +V+S       
Sbjct: 122 KAENKVYLTGN----VTLTQGENVVKGERLVYDVTTAIATVQGGGAQGGRVRSTFTPGSA 177


>gi|95928725|ref|ZP_01311471.1| OstA-like protein [Desulfuromonas acetoxidans DSM 684]
 gi|95135070|gb|EAT16723.1| OstA-like protein [Desulfuromonas acetoxidans DSM 684]
          Length = 162

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 74/171 (43%), Gaps = 13/171 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L   ++  V V     +++         +   ++ IH+ +  LE  DA     F G V
Sbjct: 1   MRLLFLIICTVLVGFTPAMAE------PDMEHDASQPIHVTSQRLEANDAKGFFIFTGEV 54

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
              Q D ++ A KMTI Y++       +++R+  E+++ I          N     +   
Sbjct: 55  QAQQGDVTMYAHKMTIYYSDGE---QRQVDRVVAEKDVRIVQLNRVATGQNAVFWQKDGR 111

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           + L GD   +V+  +  N   G K+IV ++ S + ++G +  +V+++    
Sbjct: 112 VELTGDP--RVV--QGENVVEGEKIIVYLNESRSIVEGGKQGRVKAVFVPG 158


>gi|296446796|ref|ZP_06888734.1| OstA family protein [Methylosinus trichosporium OB3b]
 gi|296255671|gb|EFH02760.1| OstA family protein [Methylosinus trichosporium OB3b]
          Length = 183

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 62/147 (42%), Gaps = 11/147 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD----VS 93
              G + + I A  L+  D  Q+  + G V +     +L+A ++TI  +          S
Sbjct: 33  GASGKDPVDIDAGKLDYFDKEQRLVYSGGVIVVNGPSTLKASRLTILLDKAKEGEQTTGS 92

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +++  +D E  + + S +   +  +   D  +  + L G+    V L +  N   G KL+
Sbjct: 93  DRVRHIDAEGPVTLVSKDQIGVGDHASYDRGEDKIYLTGN----VTLTQGDNIAKGDKLV 148

Query: 154 VNIDTSFASLQGCESDQVQSIIRYDGR 180
             + +  A++ G   ++V+S+      
Sbjct: 149 YEVGSGHATMMG---ERVRSLFTPGEA 172


>gi|295691422|ref|YP_003595115.1| OstA family protein [Caulobacter segnis ATCC 21756]
 gi|295433325|gb|ADG12497.1| OstA family protein [Caulobacter segnis ATCC 21756]
          Length = 187

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 58/146 (39%), Gaps = 6/146 (4%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
              AA      +   +  I + A+  E  ++     F+GNV + Q+   ++A ++T+   
Sbjct: 16  GYGAAGVAHAQQGDSSAPIDVSANQQETINSKCITIFRGNVEILQDRSRMRAQQVTVYSA 75

Query: 87  NTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                 S      R++ E ++++ S             F     VL GD    VIL +  
Sbjct: 76  KRAGSESGCGNAQRLEAEGDVYVVSENQKARGDRAVYTFSDNTAVLTGD----VILTKGK 131

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQ 170
           +   G +L VN  T+ A L+   + +
Sbjct: 132 DVARGDRLTVNTKTNDAKLESNATGR 157


>gi|315497168|ref|YP_004085972.1| lipopolysaccharide transport periplasmic protein lpta
           [Asticcacaulis excentricus CB 48]
 gi|315415180|gb|ADU11821.1| lipopolysaccharide transport periplasmic protein LptA
           [Asticcacaulis excentricus CB 48]
          Length = 176

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 9/164 (5%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            ++   L   A     +F       I   AD  E  +    A F G+V   QE   L+AD
Sbjct: 8   WVMGVALCLTAPVAWAQFVPTKESPIGYAADTFEADEGNHTATFTGSVEFLQETSRLRAD 67

Query: 80  KMTIDYNNTNRDVSNKI-NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           K+T+ Y          + +  +   N++    +  +  S          LV+ G+    V
Sbjct: 68  KVTVTYGQNQATGKWDVLSTAEATGNVYYVVDDQVMTGSRAVYTKSTDTLVMTGN----V 123

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRYD 178
           +LK+  N   G +L+ N+    +S+ G  +     +V+ +   D
Sbjct: 124 VLKQGQNVMEGSRLVYNVGAKKSSMDGVPTSGSKSRVRGVFYPD 167


>gi|146338573|ref|YP_001203621.1| hypothetical protein BRADO1494 [Bradyrhizobium sp. ORS278]
 gi|146191379|emb|CAL75384.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 161

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 55/144 (38%), Gaps = 26/144 (18%)

Query: 54  VKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY---------------------NNTNRDV 92
           ++    +A F  NV + Q D ++++  + + Y                     +      
Sbjct: 1   MRKKSNRATFSDNVKVVQGDTTMRSKSLEVLYASGQQRSPNANTAKSKRPLHSDQPGPSG 60

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           + +I R++    + +   +          D +  ++ + GD    V+L +  N   G +L
Sbjct: 61  NTEIKRLEAGGGVVVTRKDQTASGQRAVFDTKTNLISMLGD----VVLTQCGNVLRGDRL 116

Query: 153 IVNIDTSFASLQGCESDQVQSIIR 176
           +V++ T  + ++  +  +V + I 
Sbjct: 117 LVDMTTGVSHVEVDK-GRVTATIN 139


>gi|197103639|ref|YP_002129016.1| hypothetical protein PHZ_c0173 [Phenylobacterium zucineum HLK1]
 gi|196477059|gb|ACG76587.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 175

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 65/160 (40%), Gaps = 9/160 (5%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           +LV  +  A     AA    +     +  I + AD LEV+ +   + ++GN    Q D  
Sbjct: 3   SLVIPMALAAALLGAAPAAAQLGRSSDGPIDVTADELEVQQSECVSIWRGNAEALQGDTR 62

Query: 76  LQADKMTIDYNN-----TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           L+A  M +          +     ++ R++ E  ++  + +  V    G  D  K  +VL
Sbjct: 63  LRASVMRMYMAKSSSRPGSGSSCGELLRLEAEGGVYYVTPQQRVRGDRGVYDAVKETVVL 122

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
            GD    V+  +  N   G +++ N  T    ++G  + +
Sbjct: 123 TGD----VVAVQGQNVLRGSRMVFNTRTGEGKMEGQATGR 158


>gi|83950824|ref|ZP_00959557.1| hypothetical protein ISM_06980 [Roseovarius nubinhibens ISM]
 gi|83838723|gb|EAP78019.1| hypothetical protein ISM_06980 [Roseovarius nubinhibens ISM]
          Length = 139

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 62/148 (41%), Gaps = 12/148 (8%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                    +  + + A+ L V      A F G+V + Q D  L A  + + Y    ++ 
Sbjct: 2   AFGASPHSRDLPVEVTAETLSVDQKDGTAIFTGDVLIAQGDMRLSAPWVKVHY----QEG 57

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
            ++I +++ +  + + SG     A     +    I+ ++GD    V+L +  +   G ++
Sbjct: 58  QSEIEKLEAKEGVTLVSGADAAEAQQADYNVSTGIITMDGD----VLLVQGASAITGDQM 113

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYDGR 180
            V+     A + G    +V+++++   R
Sbjct: 114 FVDTVAGTARMAG----RVKTVLQPQSR 137


>gi|254292597|ref|YP_003058620.1| lipopolysaccharide transport periplasmic protein LptA [Hirschia
           baltica ATCC 49814]
 gi|254041128|gb|ACT57923.1| lipopolysaccharide transport periplasmic protein LptA [Hirschia
           baltica ATCC 49814]
          Length = 178

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 69/177 (38%), Gaps = 18/177 (10%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +A VFV +   L  AA + +          I I AD  E+ D   +A ++GNV + Q   
Sbjct: 7   VAPVFVAIITMLVPAAHAQLG----NSRGPIEITADRFELDDVKHEAIYQGNVDVIQGQS 62

Query: 75  SLQADKMTIDY---------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            ++A+K+ + Y                   +  +     ++  +    V A  G  + +K
Sbjct: 63  RIRANKVVVSYWSKESQKERAAAATGSIGALKEIIATGEVYYITPVEKVKAERGVYNAEK 122

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE-SDQVQSIIRYDGRP 181
             + L+G+    V++        G  L+++I     ++ G     +V S+    G P
Sbjct: 123 ERITLSGN----VLVTNAEGVIAGAHLVIDIPKGRYNMDGGGLGGRVTSVFESVGEP 175


>gi|310817098|ref|YP_003965062.1| OstA-like protein [Ketogulonicigenium vulgare Y25]
 gi|308755833|gb|ADO43762.1| OstA-like protein [Ketogulonicigenium vulgare Y25]
          Length = 160

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 57/152 (37%), Gaps = 8/152 (5%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
            L     L  A L    +  M   +   ++ + I ++ L V    Q A F GNV + Q D
Sbjct: 8   GLVAAMSLSPAALLAQTSIAMPGMRADPSQPVEITSETLNVNQGSQTAIFSGNVVIIQGD 67

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             + A    + Y+     V+++I R+ +E  +   +      +     D     LVL   
Sbjct: 68  IRIGAQIANVSYS----SVTSQITRILLEGGVTFTTPTEAAESDRATYDIGDGALVL--- 120

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
             D V+L +        ++  ++    A L G
Sbjct: 121 -EDNVLLTQGGLIMASDRMAADLAAGTAQLDG 151


>gi|21328701|gb|AAM48707.1| protein-glutamate methylesterase family protein [uncultured marine
           proteobacterium]
          Length = 162

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 72/173 (41%), Gaps = 14/173 (8%)

Query: 9   HLYIHLLALVFVLLKA-DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           H+ + +  L+  +  A  LS      +  F+      + + AD L V      A F+GNV
Sbjct: 3   HILLLITVLLSSVCGALALSAQTTVSLDGFQSDPEASVEMLADRLTVSQTDGAARFEGNV 62

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q D  L AD + + Y          I R+    ++ + S      A +   DF  R 
Sbjct: 63  VIAQGDMRLSADLVDVTYLEAG-----GIGRLSASGSVLLVSPSDTAQADSAVYDFSARE 117

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           L + G+    V+L +   +     L ++++T  A ++G    +V++++    +
Sbjct: 118 LRMRGN----VLLNQGAISLSADLLTIDLETGGAVMEG----RVRTVLPSGSK 162


>gi|217976353|ref|YP_002360500.1| lipopolysaccharide transport periplasmic protein LptA [Methylocella
           silvestris BL2]
 gi|217501729|gb|ACK49138.1| lipopolysaccharide transport periplasmic protein LptA [Methylocella
           silvestris BL2]
          Length = 207

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 64/165 (38%), Gaps = 17/165 (10%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +      Q  +S +        E IHI+A  L+  D  QK  + GNV  TQ   +L++  
Sbjct: 27  VAARAAEQQGSSILPG--GDSKEPIHIEAAKLDYFDKEQKLIYTGNVVATQGGSTLKSTI 84

Query: 81  MTIDYNN-------TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           + +                S+++ RM+    + + + +       G  +  +  L L   
Sbjct: 85  LILYLTPKSDPDQAGVPSSSSQLRRMEATGPVTMITKDQVSTGDRGVYEKAENKLYLY-- 142

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             D V + +  N   G K+  ++ T  A + G    +V+S+   +
Sbjct: 143 --DNVTVTQGTNVTKGDKMTYDLTTKKAIVTG----RVKSMFLPE 181


>gi|221236651|ref|YP_002519088.1| protein yhbN [Caulobacter crescentus NA1000]
 gi|220965824|gb|ACL97180.1| protein yhbN precursor [Caulobacter crescentus NA1000]
          Length = 186

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 8/135 (5%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID----YNNTNRDVSNK 95
             +  + + AD  E  ++     F GNV + Q    L+A+K+TI         N +    
Sbjct: 29  NSSAPVDVSADNQETINSKCLIIFTGNVEILQNRSRLRAEKVTIYNAKRPTAENANACGN 88

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             RM+ E  +++ + + N         F     VL GD    VIL +  +   G +L VN
Sbjct: 89  AQRMEAEGGVYLVNEQQNARGDRAVYTFSNNTAVLTGD----VILVKGNDVARGDRLTVN 144

Query: 156 IDTSFASLQGCESDQ 170
             T+ A L+   + +
Sbjct: 145 TKTNDAKLESTSTGR 159


>gi|16127831|ref|NP_422395.1| hypothetical protein CC_3601 [Caulobacter crescentus CB15]
 gi|13425347|gb|AAK25563.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 189

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 8/135 (5%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID----YNNTNRDVSNK 95
             +  + + AD  E  ++     F GNV + Q    L+A+K+TI         N +    
Sbjct: 32  NSSAPVDVSADNQETINSKCLIIFTGNVEILQNRSRLRAEKVTIYNAKRPTAENANACGN 91

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             RM+ E  +++ + + N         F     VL GD    VIL +  +   G +L VN
Sbjct: 92  AQRMEAEGGVYLVNEQQNARGDRAVYTFSNNTAVLTGD----VILVKGNDVARGDRLTVN 147

Query: 156 IDTSFASLQGCESDQ 170
             T+ A L+   + +
Sbjct: 148 TKTNDAKLESTSTGR 162


>gi|84514853|ref|ZP_01002216.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
 gi|84511012|gb|EAQ07466.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
          Length = 153

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 67/160 (41%), Gaps = 12/160 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           ++  L  +  S      +    V  +  I + +D L V      A F+G+V + Q D  L
Sbjct: 1   MLLALAFSTASAQTQINLGALVVDPSAAIEVTSDALSVDQDTGIAVFEGDVLVIQGDLRL 60

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            A ++ + Y N     + +I R+       + + +    A     D    +L L GD   
Sbjct: 61  SAQRVEVVYGND----TAEIARLIASGGALLANTQDAAEADTADYDITTGLLTLTGD--- 113

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
            V++ +  N      +IVN+    A++QG    +V+++++
Sbjct: 114 -VLVTQGGNVISAQSMIVNVTDGTATMQG----RVRTMLQ 148


>gi|322418291|ref|YP_004197514.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M18]
 gi|320124678|gb|ADW12238.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M18]
          Length = 165

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 74/164 (45%), Gaps = 10/164 (6%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L F++L   LS A A         G E + +K+D L   +  + A F+G V   Q D  L
Sbjct: 6   LSFIVLVLSLSTAVAYAAQGV--SGKEPLKVKSDTLTTDNEKKTAIFEGKVVAHQGDMVL 63

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
             D++ + Y+       N+++R++   N+ I   E     ++G    ++  +VL+G+   
Sbjct: 64  YTDRLVVSYSGPG----NEVSRVEAFGNVRIVQQERQATGAHGVYQPKEGRVVLDGNP-- 117

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           KV+     +   G  +   ++   + +     ++V+++I   G+
Sbjct: 118 KVV--SGDDVITGKVITYYVNEQKSVVTSGPKERVEAVIHPGGK 159


>gi|254436871|ref|ZP_05050365.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           307]
 gi|198252317|gb|EDY76631.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           307]
          Length = 161

 Score = 99.7 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 59/164 (35%), Gaps = 13/164 (7%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            L     +      +Q   + +       N  + I AD L +  A   A F GNV   Q 
Sbjct: 7   ALFCAALICATTAFAQTDIN-LGAISADPNAPVEITADSLSIDQATGTAIFIGNVVFGQG 65

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           D  L A ++ + Y+    D S  I+R+     +   +      A     +     L L G
Sbjct: 66  DLRLNAARVQVIYS----DASGDISRLSASGGVTFVTATEAAEALTADYNLDTGTLELAG 121

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           D    V+L +  +      + VN+    A + G    +V++I  
Sbjct: 122 D----VLLTQGASAISSDTMRVNLSDGSAQMYG----RVRTIFN 157


>gi|126734478|ref|ZP_01750225.1| hypothetical protein RCCS2_09964 [Roseobacter sp. CCS2]
 gi|126717344|gb|EBA14208.1| hypothetical protein RCCS2_09964 [Roseobacter sp. CCS2]
          Length = 161

 Score = 98.6 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 70/169 (41%), Gaps = 12/169 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            I + A +FV             +    V  +  I + AD L V  A  KA F GNV + 
Sbjct: 4   LIAICASLFVATAGAAYAQTNVNLGGITVDTSAAIEVTADSLSVDQASGKAIFDGNVIIG 63

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q D  L A ++ + Y       +++I R+   + +   + E    A     D    +L+L
Sbjct: 64  QGDLRLTAGRVEVIYGAD----TSQIARLIATKGVTFVTAEEAAEAQEADYDITTGLLIL 119

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            G     V+L +  +     ++ +N+    A++ G    +V+++++  G
Sbjct: 120 AG----GVLLTQGPSAISADQMTINVTDGTAAMDG----RVRTVLQQGG 160


>gi|254453115|ref|ZP_05066552.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           238]
 gi|198267521|gb|EDY91791.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           238]
          Length = 143

 Score = 97.0 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 54/143 (37%), Gaps = 12/143 (8%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
           +          + I AD L +  A   A F GNV   Q D  L A ++ + YN    D S
Sbjct: 9   LGAINADPTAPVEITADSLSIDQASGTAIFIGNVVFGQGDLRLNAARVQVIYN----DAS 64

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
             I+R+     +   +      A     +     L L GD    V+L +  +      + 
Sbjct: 65  GDISRLSASGGVTFATATEAAEALTADYNLDTGTLELAGD----VLLTQGASAISSDTMR 120

Query: 154 VNIDTSFASLQGCESDQVQSIIR 176
           VN+    A ++G    +V++I  
Sbjct: 121 VNLSDGSAQMEG----RVRTIFN 139


>gi|78222495|ref|YP_384242.1| OstA-like protein [Geobacter metallireducens GS-15]
 gi|78193750|gb|ABB31517.1| OstA-like protein [Geobacter metallireducens GS-15]
          Length = 169

 Score = 97.0 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 8/135 (5%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + I IK++ L        A F G V   Q D ++ ADK+ + Y          ++R++  
Sbjct: 32  QPITIKSNELSTDSRHNTATFTGKVIARQGDLTIYADKLVVHYKADG----GDLDRVEAS 87

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
            N+ I  G+    A +G     ++ +VL GD   KV   +  NT  G  +   +D   + 
Sbjct: 88  GNVRIVQGDRLATARDGVYQSAEQKIVLTGDP--KVF--QGENTVSGKVITYFVDEEKSI 143

Query: 163 LQGCESDQVQSIIRY 177
           + G    +V+++I  
Sbjct: 144 VTGGPDTRVEAVITP 158


>gi|167648911|ref|YP_001686574.1| OstA family protein [Caulobacter sp. K31]
 gi|167351341|gb|ABZ74076.1| OstA family protein [Caulobacter sp. K31]
          Length = 196

 Score = 96.6 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 76/186 (40%), Gaps = 17/186 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M+ ++    + + LL    +L  A ++Q  A+         +  + I AD  EV  +  K
Sbjct: 1   MNRWMAPAAIALSLLGGQALLGGAAMAQTPAA---GGGNNSSAPVDISADEQEVITSQCK 57

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN----------NTNRDVSNKINRMDVERNIFIQSG 110
             F+G V + Q+   ++A  MT+                 +    ++ ++ + N+F  + 
Sbjct: 58  TIFRGAVEVLQDKARMRAATMTVYNRRKAPGKASSAPGGNNDCGDVDHVEADGNVFYVTP 117

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           E  V   +   D+    +V+ GD    V+  +  +   G ++ +   T+   ++   + +
Sbjct: 118 EQTVRGDHAVYDYATDTIVVTGD----VVAVQGQDVARGDRMTIKTKTNDVKMESNATGR 173

Query: 171 VQSIIR 176
            ++ +R
Sbjct: 174 GKTRVR 179


>gi|114769795|ref|ZP_01447405.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|114549500|gb|EAU52382.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|161170291|gb|ABX59261.1| uncharacterized protein conserved in bacteria [uncultured marine
           bacterium EB000_55B11]
 gi|297183819|gb|ADI19942.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 160

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q A+  ++      N  + I A+ L +  +   A F+G  ++ Q    L ADK+
Sbjct: 16  SPKVFAQNASLSLSGANHDINLPVEITANNLSINQSSNSAIFEGTAYVGQGSLRLSADKI 75

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + YN      + K+  ++    +   +GE    A +        +L ++G+    V+L 
Sbjct: 76  VVRYNQD----TGKVTSVEATGKVVFTNGEDIAEAESAIYKIDSGLLSMSGN----VLLV 127

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +T  G  L ++I  + A+L    S  V++ +  +
Sbjct: 128 QGKSTISGNYLDMDILKNIANL----SGNVKTTLAPN 160


>gi|39996987|ref|NP_952938.1| hypothetical protein GSU1889 [Geobacter sulfurreducens PCA]
 gi|39983875|gb|AAR35265.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506004|gb|ADI84727.1| cell envelope biogenesis ABC transporter, periplasmic protein
           [Geobacter sulfurreducens KN400]
          Length = 167

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 70/165 (42%), Gaps = 12/165 (7%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            +++ +F+L    ++ A     +R    G + I +K++ L      + A F G V   Q 
Sbjct: 4   TIISALFLLTVTAMAVAGPLPASR----GGQPITVKSNELSADSRNRTATFSGKVTARQG 59

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           D ++ +D++ + Y +        + +++   N+ I  G     A  G     ++ +VL+G
Sbjct: 60  DLTIYSDRLIVHYRDDG----GDVEKVEAVGNVKIVQGNRLATAKEGVYYNTEQKIVLSG 115

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D      + +  N   G  +   ++   + + G    +V+++I  
Sbjct: 116 DPK----VYQGENMISGKVITYFVNEERSVVTGGGDSRVEAVIHP 156


>gi|117926611|ref|YP_867228.1| OstA family protein [Magnetococcus sp. MC-1]
 gi|117610367|gb|ABK45822.1| OstA family protein [Magnetococcus sp. MC-1]
          Length = 179

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 7/139 (5%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERN 104
           I AD LE+ D  Q A FKGNV   +    L +D+M + Y  +    +  ++I  +    N
Sbjct: 34  ITADALEMNDLKQIAVFKGNVQAEEGAMQLFSDRMVVTYRPSQAGGTKQDRIREIVANGN 93

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF---- 160
           + ++ G+    A         R L L G+    V+ +   +   G K+++ +D +     
Sbjct: 94  VVLRQGDHIGRADKAVYSVSSRALSLEGNNRTAVV-QHNKDRLEGQKIVLQMDENRQIQN 152

Query: 161 ASLQGCESDQVQSIIRYDG 179
             ++G    +V ++I  DG
Sbjct: 153 VKVEGGRKGRVSAVITPDG 171


>gi|308271828|emb|CBX28436.1| hypothetical protein N47_G37600 [uncultured Desulfobacterium sp.]
          Length = 164

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 54/144 (37%), Gaps = 9/144 (6%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY------NNTNRDVSNKI 96
           EK  I ADML V     KA F G V   Q    + +D++ I Y         N      I
Sbjct: 22  EKTRITADMLIVDGNSDKAEFIGKVKAVQGTTVITSDRLNIFYQKVDTAAKDNPKEKESI 81

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
             +    N+ I   +   I  +       R+  L G  +    +    N+  G K+    
Sbjct: 82  KEIIATGNVKILFDDKIAITQHAVYATSTRVFTLTGVGSK---ITSGNNSITGSKITFFR 138

Query: 157 DTSFASLQGCESDQVQSIIRYDGR 180
           D     ++   S++V+++   DG+
Sbjct: 139 DDGHVKIESSRSNRVEAVFESDGK 162


>gi|302343389|ref|YP_003807918.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfarculus baarsii DSM 2075]
 gi|301640002|gb|ADK85324.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfarculus baarsii DSM 2075]
          Length = 183

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 62/158 (39%), Gaps = 22/158 (13%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR---------- 90
            ++ I++ AD LEV +    A F G V   Q D ++  D++ + Y+NT++          
Sbjct: 29  SDKPINVDADSLEVDNKNNVAHFIGKVTAKQGDVNIVCDQLDVYYDNTDKPRQEAPAQAS 88

Query: 91  --------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                       ++ ++    ++ +   +   +   G      R L++ G+      + +
Sbjct: 89  GESALGLGGGDGRVTKVVALGHVRVTQKDRVAVGRKGTYWAGARKLLMEGNAT----VWQ 144

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             N   G K+ V +D   A + G    +V   I  D +
Sbjct: 145 GKNQVAGEKITVFLDQDRALVHGQPGKRVSVTIVPDKK 182


>gi|116749502|ref|YP_846189.1| OstA family protein [Syntrophobacter fumaroxidans MPOB]
 gi|116698566|gb|ABK17754.1| OstA family protein [Syntrophobacter fumaroxidans MPOB]
          Length = 199

 Score = 94.3 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/147 (20%), Positives = 68/147 (46%), Gaps = 11/147 (7%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-------NNTNRDVS 93
            +  +HI +D +EV+   +   F+G+V + Q+D ++  +++ +          N    + 
Sbjct: 55  SDSPLHIASDRMEVRQRDRTIVFQGHVVVRQDDLTITGNQLKVTAARVDPSIRNDQSAIV 114

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
            KI+R++VE  + I   E    A       Q++ +VL G+     ++ + L+   G  + 
Sbjct: 115 EKIDRIEVEGGVKITQREKQATADKAVYYHQEQKIVLLGNP----VVSQGLDKVQGRLIT 170

Query: 154 VNIDTSFASLQGCESDQVQSIIRYDGR 180
           + I    + ++G E   VQ+++    +
Sbjct: 171 LYIAEGKSVVEGGEQTPVQALLHPSRK 197


>gi|198284715|ref|YP_002221036.1| lipopolysaccharide transport periplasmic protein LptA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667648|ref|YP_002427394.1| hypothetical protein AFE_3027 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198249236|gb|ACH84829.1| lipopolysaccharide transport periplasmic protein LptA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519861|gb|ACK80447.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 182

 Score = 93.5 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 8/141 (5%)

Query: 38  KVLGNEKIHIKADMLEVKDA-VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
           + LG   I I AD L  ++   Q+A + GNV MTQ D  + ADK+T+D        +  +
Sbjct: 37  QGLGKGPIQISADALHGENKPQQQAVYTGNVVMTQGDVVVHADKLTVDAIAGKVHQATAV 96

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                     + + + +           K  +VL G+      L +K N   G ++   +
Sbjct: 97  GSPVTF---TMSAAQRHGYGDTLVYKPGKGEIVLTGNA----HLWQKKNEISGQQVTYFL 149

Query: 157 DTSFASLQGCESDQVQSIIRY 177
            T   ++      +VQSI   
Sbjct: 150 QTQQTAVTAAPGKRVQSIFYP 170


>gi|114798835|ref|YP_758937.1| OstA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114739009|gb|ABI77134.1| OstA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 178

 Score = 93.5 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 68/184 (36%), Gaps = 23/184 (12%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
             L      LV  LL    + A  S            I+I ++  E  +  +K    GNV
Sbjct: 2   ALLKAAGAGLVLGLLMGAPAFAQISSDGG-------PIYINSERTESLERERKVLLVGNV 54

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVS-----------NKINRMDVERNIFIQSGEINVIA 116
            + Q    L+AD +TI +     + +            ++  +  E N++  + E+    
Sbjct: 55  DIRQGTARLRADTVTIQFAPQQGETAAQPAQGVAGSFGQVESILAEGNVYYVTPELKAKG 114

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
             G  +     +V+ G+    V L    +   G +L++ +      L+G    + + +I 
Sbjct: 115 DRGNYELATDTIVMTGN----VALMRDRDVAEGQRLVMEVTNRRTRLEG-GGGRTRMVID 169

Query: 177 YDGR 180
            +G+
Sbjct: 170 PEGK 173


>gi|119713541|gb|ABL97593.1| hypothetical protein MBMO_EB0-39F01.0004 [uncultured marine
           bacterium EB0_39F01]
          Length = 153

 Score = 93.5 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 56/138 (40%), Gaps = 12/138 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q A+  ++      N  + I A+ L +  +   A F+G  ++ Q    L ADK+
Sbjct: 16  SPKVFAQNASLSLSGANHDINLPVEITANNLSINQSSNSAIFEGTAYVGQGSLRLSADKI 75

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + YN      + K+  ++    +   +GE    A +        +L ++G+    V+L 
Sbjct: 76  VVRYNQD----TGKVTSVEATGKVVFTNGEDIAEAESAIYKIDSGLLSMSGN----VLLV 127

Query: 142 EKLNTFLGCKLIVNIDTS 159
           +  +T  G     ++D  
Sbjct: 128 QGKSTIGGN----HLDDG 141


>gi|225851254|ref|YP_002731488.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
 gi|225646594|gb|ACO04780.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
          Length = 156

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 10/138 (7%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            E I I+AD L        A +KGNV + + + ++ A+KM I            I+R+  
Sbjct: 23  EEPILIEADELVYNKNENTAVYKGNVTVKKGNLTINAEKMIIY-----LSEEGDISRIYA 77

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           E ++  + G  +  +        K I+VL     DK  L ++ N   G ++I ++DT  A
Sbjct: 78  EGDVRFKKGNRSGSSKKAEYIKDKDIIVL----IDKAKLIQEKNIIEGDEIIYHLDTEVA 133

Query: 162 SLQGCESDQVQSIIRYDG 179
            ++G + ++V+++I  D 
Sbjct: 134 EVKG-KDNKVRTVIFPDK 150


>gi|320352645|ref|YP_004193984.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfobulbus propionicus DSM 2032]
 gi|320121147|gb|ADW16693.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfobulbus propionicus DSM 2032]
          Length = 185

 Score = 91.6 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 64/156 (41%), Gaps = 19/156 (12%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN------------- 86
             ++ I I+A+ +  ++      F G V   Q +  +++++MT+ Y+             
Sbjct: 31  DADQPISIEANRMVSQENQNTVVFLGKVDARQGNLIIRSEEMTVFYSEKPANKDGQPSTP 90

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 ++++ ++  ++N+ I  G+            ++R +VL G+        +  N 
Sbjct: 91  GPGNQNTSQLEKLICKQNVKISEGDWLGTGDRMDYFAKERKVVLTGNAKA----WQGPNM 146

Query: 147 FLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDGR 180
             G  +   ++   + ++  E    +V+++I  + +
Sbjct: 147 VAGKTITYYLNEKRSVVEQDEKSKGRVKAVIHPESK 182


>gi|254420969|ref|ZP_05034693.1| OstA-like protein [Brevundimonas sp. BAL3]
 gi|196187146|gb|EDX82122.1| OstA-like protein [Brevundimonas sp. BAL3]
          Length = 172

 Score = 90.8 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 62/155 (40%), Gaps = 16/155 (10%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A       +   N+ I   AD  E   + ++   +G   +TQ    L+A+ +T+      
Sbjct: 27  AVGDAQSARTSSNQPIAFGADTGE--QSAERISLRGRAEVTQGQNRLRAEAITLF----- 79

Query: 90  RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           R+ +    R++    ++  +   ++             LV+ G+    VIL +  N   G
Sbjct: 80  RNAAGDPERVEATGTVYFVTPTQSMRGDRAVYTLSNGELVVTGN----VILNQGKNVLTG 135

Query: 150 CKLIVNIDTSFASLQGCE-----SDQVQSIIRYDG 179
            +L+ N++T  A++ G         ++Q +   +G
Sbjct: 136 GRLVYNVNTDAANMSGAPRGGTAGSRIQGVFYPNG 170


>gi|189425227|ref|YP_001952404.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           lovleyi SZ]
 gi|189421486|gb|ACD95884.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           lovleyi SZ]
          Length = 182

 Score = 90.8 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 76/171 (44%), Gaps = 8/171 (4%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            + + +   +  +L A  +   AS     +   +  I IKAD L+  +  + A F G V 
Sbjct: 6   RILVLVSVWLLGVLPAVAASQPASGGAAARDRSSRPITIKADELKADNKGKIATFTGRVV 65

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
             QED ++ +DK+ I Y     D  +++++++   ++ I          +   + ++  +
Sbjct: 66  ARQEDVTIYSDKLVIYY----GDKQDQVDKIEAIGSVRILQTNRIGTGGHALYESREGKI 121

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            L+G+      + +  ++  G  ++  +D   + + G E+ +V+++I    
Sbjct: 122 TLSGNPK----VTQDKDSITGKVIVYYLDDDRSVVIGGENARVEAVIHPTK 168


>gi|118579408|ref|YP_900658.1| OstA family protein [Pelobacter propionicus DSM 2379]
 gi|118502118|gb|ABK98600.1| OstA family protein [Pelobacter propionicus DSM 2379]
          Length = 174

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 7/140 (5%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            N  I IKA  L   +  +KA F G V   Q D ++ +DK+TI Y        N++ +++
Sbjct: 35  SNLPITIKASQLTADNKGKKAVFTGKVVAKQGDITIFSDKLTIHY----GTNKNEVEKIE 90

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
            + N+ I        A++   D ++  + L+G       + +  ++  G  +   ID   
Sbjct: 91  ADGNVRIVQENRVGSAAHAVYDSKEGKITLSGGTPR---VTQGADSTTGKIITYLIDDER 147

Query: 161 ASLQGCESDQVQSIIRYDGR 180
           +++ G     V +II    R
Sbjct: 148 STVTGDAGAPVVTIIHPRER 167


>gi|94265427|ref|ZP_01289179.1| OstA-like protein [delta proteobacterium MLMS-1]
 gi|93454084|gb|EAT04419.1| OstA-like protein [delta proteobacterium MLMS-1]
          Length = 242

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 58/143 (40%), Gaps = 12/143 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY------NNTNRDVSNKIN 97
            I I+AD +E  +      F G V   Q+  ++ +D+MT+ Y           D   ++ 
Sbjct: 75  PIQIEADRMESVEGTNAILFTGQVVAQQQGLTVYSDEMTVHYFSDEEQAALADDDQRRLK 134

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           ++    N+ I+S + +           +R++ L+G+        ++ N   G K+ + +D
Sbjct: 135 KLFATGNVRIESDDFSGTGQRMDYFEVERVVHLSGNARA----WQEGNLVTGDKITMYLD 190

Query: 158 TSF--ASLQGCESDQVQSIIRYD 178
                A   G    +V++    D
Sbjct: 191 EGKSIAEYDGKSDQRVRAFFFSD 213


>gi|292490480|ref|YP_003525919.1| lipopolysaccharide transport periplasmic protein LptA
           [Nitrosococcus halophilus Nc4]
 gi|291579075|gb|ADE13532.1| lipopolysaccharide transport periplasmic protein LptA
           [Nitrosococcus halophilus Nc4]
          Length = 275

 Score = 88.5 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 64/173 (36%), Gaps = 22/173 (12%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA ++++      + A +          + IHI+AD  E+ D  Q A ++GNV +TQ   
Sbjct: 9   LATLWLIFGGLNGETAWA----LSSDQEQPIHIEADRGELDDRKQIAVYRGNVHLTQGTL 64

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVER-------NIFIQSGEINVIASNGYVDFQKRI 127
            + +D +TI Y    +     + +   E               +I   A           
Sbjct: 65  RIDSDILTIYYTPGKK-----LEKAIAEGQPAWYRQRPDNSDEDIRAKALRMEYHANTAT 119

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRYD 178
           + L      K  + +  N F G +++   +      +G ++   +V   IR D
Sbjct: 120 IYL----LQKAHVWQGANEFTGDRIVYETEHDIVRGEGSKTGDGRVHVTIRPD 168


>gi|329888478|ref|ZP_08267076.1| ostA-like family protein [Brevundimonas diminuta ATCC 11568]
 gi|328847034|gb|EGF96596.1| ostA-like family protein [Brevundimonas diminuta ATCC 11568]
          Length = 162

 Score = 88.1 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 64/166 (38%), Gaps = 13/166 (7%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L +   +L   L+  A S          + +   AD  E       +  +G   +TQ   
Sbjct: 8   LTIAGAVLMTALALPAVSGAQNRADASRQPVQYGADSGEYT-PDGFS-LRGRAEVTQGGN 65

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            L+AD +           + ++NR++    ++  + + ++             +V+ GD 
Sbjct: 66  RLRADAI------RGFTANGELNRIEANGGVYFVTPDQSMKGDRAVYTLNDGNVVVTGD- 118

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-DQVQSIIRYDG 179
              VIL +  +   G +L+ N+ T  A ++G  +  +VQ +    G
Sbjct: 119 ---VILTQGKSVLTGNRLVYNVRTETARIEGGGANGRVQGVFYPQG 161


>gi|225848796|ref|YP_002728960.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643365|gb|ACN98415.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 157

 Score = 88.1 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 58/138 (42%), Gaps = 10/138 (7%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              E + I AD LE  +  + A + GNV + + +F+L+AD + I       D    ++R+
Sbjct: 24  NKKEPVVINADKLEYYNKEKVAVYSGNVDVKKGNFNLKADTVKIY-----LDEKGDVSRI 78

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
               N++ Q       +        K +++L  +      + +  N   G ++   ID  
Sbjct: 79  YAVGNVYFQQENKWGKSKEAEYYKDKNLIILKNNAE----VHQGKNVVEGDEIYYYIDEE 134

Query: 160 FASLQGCESDQVQSIIRY 177
            A +   +  +V+S++  
Sbjct: 135 KA-VATSKGSRVRSVLFP 151


>gi|300113013|ref|YP_003759588.1| lipopolysaccharide transport periplasmic protein lptA
           [Nitrosococcus watsonii C-113]
 gi|299538950|gb|ADJ27267.1| lipopolysaccharide transport periplasmic protein LptA
           [Nitrosococcus watsonii C-113]
          Length = 272

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 59/173 (34%), Gaps = 10/173 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L        +   +            + IHI+AD  E+ D  Q A + GNV +TQ   
Sbjct: 5   LSLKLTAAWFIIGSLSIETALALSSDSEQPIHIEADRGELDDREQVAVYSGNVHLTQGTL 64

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDV--ERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + +D +TI Y    +              +       +I   A           + L  
Sbjct: 65  RIDSDTLTIYYTLDKKLEKAVAEGQPAWYRQRPDNSKEDIRAKALRMEYHADTTTIHL-- 122

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY--DGRP 181
               K  + +  N F G +++ N +      +G E+   ++   I    DG P
Sbjct: 123 --LQKAHIWQGTNEFTGDRIVYNTERDIVRGEGSETGVGRIHVTIHPADDGPP 173


>gi|206889363|ref|YP_002248080.1| hypothetical protein THEYE_A0231 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741301|gb|ACI20358.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 160

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 49/126 (38%), Gaps = 7/126 (5%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + I I +  L      + A F+G+V   + + +L A KM + Y +  +     I  ++  
Sbjct: 31  QPIIITSKTLINDSKAKTATFEGDVVAKRGEVTLYAAKMIVYYEDEQKGG--NIKMIEAI 88

Query: 103 RNIFIQSGEINVIASNGYVDFQ-KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
            N+ +  G+  + +       + +  ++  G+        E  N   G K+   +    +
Sbjct: 89  GNVKLVKGDRVITSHKATYYPEPEERVIFTGEPRA----TEGKNLVTGEKITYFMKDDRS 144

Query: 162 SLQGCE 167
            ++  +
Sbjct: 145 LVEKSK 150


>gi|94266462|ref|ZP_01290155.1| OstA-like protein [delta proteobacterium MLMS-1]
 gi|93452940|gb|EAT03445.1| OstA-like protein [delta proteobacterium MLMS-1]
          Length = 211

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 57/140 (40%), Gaps = 12/140 (8%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY------NNTNRDVSNKIN 97
            I I+AD +E  +      F G V   Q+  ++ +D+MT+ Y           D   ++ 
Sbjct: 44  PIQIEADRMESVEGTNAILFTGQVVAQQQGLTVYSDEMTVHYFSDEEQAALADDDQRRLK 103

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           ++    N+ ++S + +           +R++ L+G+        ++ N   G K+ + +D
Sbjct: 104 KLFATGNVRVESDDFSGTGQRMDYFEVERVVHLSGNARA----WQEGNLVTGDKITMYLD 159

Query: 158 TSF--ASLQGCESDQVQSII 175
                A   G    +V++  
Sbjct: 160 EGKSIAEYDGKSDQRVRAFF 179


>gi|327398725|ref|YP_004339594.1| lipopolysaccharide transport periplasmic protein LptA [Hippea
           maritima DSM 10411]
 gi|327181354|gb|AEA33535.1| lipopolysaccharide transport periplasmic protein LptA [Hippea
           maritima DSM 10411]
          Length = 166

 Score = 86.2 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 54/141 (38%), Gaps = 9/141 (6%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           GN  IHI AD L   D      F+G V  T+ D  L +DKM +  +      +  I ++ 
Sbjct: 30  GNIPIHITADKLTAFDKKGLYIFEGGVVATRGDVRLTSDKMEVYKDKK----TGDIGKVV 85

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID-TS 159
              ++ I   +                +VL G    KV+     N     ++I  +D   
Sbjct: 86  CIGHVVITKQDKKATGDKAIYTASDSKVVLIGHA--KVV--SGKNNITSDRIIYYLDRDY 141

Query: 160 FASLQGCESDQVQSIIRYDGR 180
             S    ++ +V+ II  + +
Sbjct: 142 VVSQSDNKTKRVEVIIYPNQK 162


>gi|253701986|ref|YP_003023175.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M21]
 gi|251776836|gb|ACT19417.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M21]
          Length = 162

 Score = 86.2 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 63/142 (44%), Gaps = 8/142 (5%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
           + GNE + +K+D L   +  + A F+G V   Q + +L  D++ +          N++++
Sbjct: 23  ISGNEPLKVKSDNLTADNEKKTATFEGKVVAHQGELTLYTDRLVVSSAGDG----NELSK 78

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           ++   N+ I  G       +   D ++ +++L+G+    V             +   I+ 
Sbjct: 79  VEAFGNVRILQGNRQATGGHAVYDPKRGVILLDGNPRVVVGDDVVTGKV----ITYFINE 134

Query: 159 SFASLQGCESDQVQSIIRYDGR 180
             + + G   ++V+++I   G+
Sbjct: 135 QRSVVTGGPKERVEAVIHPGGK 156


>gi|220933908|ref|YP_002512807.1| OstA-like protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995218|gb|ACL71820.1| OstA-like protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 180

 Score = 85.8 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 25/174 (14%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L   L A + + L   L+ A+           +  I I++D  E+ D    + ++GNV +
Sbjct: 13  LVATLFAGLMLALITALASASE---------RDLPIRIQSDSAELDDQRGVSVYRGNVEV 63

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG------EINVIASNGYVDF 123
           TQ D  + AD +T+         S  + RM+ E N+           E+   A +     
Sbjct: 64  TQGDLVIHADTLTVH------SPSRVLQRMEAEGNLARLRTLTEDGREVRAEARHMEYLA 117

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +R +VL  D      + +  + F G +++ ++D         +S +V+ I+  
Sbjct: 118 AERRMVLTRDAR----IWQAQDEFRGARIVYDMDRETLDAASGDSGRVEVILTP 167


>gi|209966460|ref|YP_002299375.1| hypothetical protein RC1_3201 [Rhodospirillum centenum SW]
 gi|209959926|gb|ACJ00563.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 279

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 58/154 (37%), Gaps = 8/154 (5%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q A       K+   + +    D LE       A  +G+    + D  ++AD++ +    
Sbjct: 122 QVAVLTGQGLKLETEQDVVTARDSLEYWREQNLAVARGDAVAVRGDNRVRADRL-VGLLQ 180

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
            N      + R+D E ++ I +         G  D  +R+ VL G+    V +    N  
Sbjct: 181 ENDQGDLDLTRIDAEGSVVITTPTDVARGDQGTYDMTERVAVLTGN----VKITRGRNQL 236

Query: 148 LGCKLIVNIDTSFAS-LQGCES--DQVQSIIRYD 178
            G    V+++T  +  L G E    +V+ +    
Sbjct: 237 NGNAAEVDLETGISRILSGPEGGKGRVRGLFVPG 270



 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 40  LGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
            G   + I AD  LE     Q    +GN   T+ D S++AD +T  Y       + +I R
Sbjct: 36  EGKAPVAIDADQALEWHKEQQAYVARGNAVATRGDLSVRADTLTAYYRELPAGGT-EIYR 94

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           +  E  + I++         G  +  +++ VL G
Sbjct: 95  LAAEGGVVIKAPRQTAYGDRGVYEVDRQVAVLTG 128


>gi|148265013|ref|YP_001231719.1| OstA family protein [Geobacter uraniireducens Rf4]
 gi|146398513|gb|ABQ27146.1| OstA family protein [Geobacter uraniireducens Rf4]
          Length = 169

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 73/164 (44%), Gaps = 11/164 (6%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +LA+V  L  A +  AA            + I IK++ L   +  + A F G V   Q D
Sbjct: 6   ILAIVLSLTLAGVVLAAGKSGGDRNA---QPIKIKSNELFTDNNNRTATFVGKVSARQGD 62

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
            ++ +DK+ I+Y+  ++D    + +++   N+ +  G    +A +   + +   +VL  D
Sbjct: 63  MTIYSDKLVINYSEKDKD----VEKVEAFGNVRVVQGNRQALAGHALYENKAGKIVL--D 116

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            + KV   +  +   G  +   +D   + + G    +V+++I  
Sbjct: 117 TSPKVY--QGDDVVSGKVITYFVDEQKSVVTGGGDARVEAVIHP 158


>gi|163794943|ref|ZP_02188912.1| hypothetical secreted protein [alpha proteobacterium BAL199]
 gi|159179762|gb|EDP64289.1| hypothetical secreted protein [alpha proteobacterium BAL199]
          Length = 273

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 53/134 (39%), Gaps = 7/134 (5%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS 109
           D LE +   + A  +G+    +E+  ++AD +   +    +  S  +  ++   N+ I +
Sbjct: 144 DSLEYRQGQRVAIARGDATAIRENQRIRADTLVARFEERTKGAST-LAVVEANGNVVITT 202

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL--QGCE 167
            +       G  +  K    L GD    V +    N   G + +VN+ T  + L   G  
Sbjct: 203 PQEVARGREGVYNADKETATLTGD----VRITRGKNQLNGERAVVNLKTGISRLLPAGKG 258

Query: 168 SDQVQSIIRYDGRP 181
            ++V+ +      P
Sbjct: 259 GERVKGLFTPGKAP 272



 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 51/130 (39%), Gaps = 9/130 (6%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE--KIHIKADM-LEVKDAVQKAF 62
           + + + I  +ALV           A +     +  G++   + ++AD  +E         
Sbjct: 5   HPLAILIACVALVGFTAA-----VAPARAQLLQGSGDDQVPVTVEADQGIEWIRDSSTYV 59

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
            +GN   T+ D  + AD +T  Y     D + +I R++ + ++ I +            D
Sbjct: 60  ARGNAKATRGDTRVNADTLTARYRE-KPDGTTEIFRLEADGHVVITTPRERATGDRAVYD 118

Query: 123 FQKRILVLNG 132
             K  +VL G
Sbjct: 119 LDKANVVLTG 128


>gi|301062327|ref|ZP_07202990.1| lipopolysaccharide transport periplasmic protein LptA [delta
           proteobacterium NaphS2]
 gi|300443531|gb|EFK07633.1| lipopolysaccharide transport periplasmic protein LptA [delta
           proteobacterium NaphS2]
          Length = 167

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 71/168 (42%), Gaps = 13/168 (7%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           ++V   A L    AS   + +      + IK+  LE  D  +K  F+G+V   ++DF++ 
Sbjct: 1   MWVFSGAALC---ASSFAKSQNKPQGPMVIKSKTLEADDNKKKVTFEGDVEAKRDDFTVF 57

Query: 78  ADKMTIDYNNTN-----RDVSNKINRMDVERNI-FIQSGEINVIASNGYVDFQKRILVLN 131
             ++ + Y   +       VS +I+++     +  I++              +   LVL 
Sbjct: 58  CQELVVLYEKPSEQKETEKVSARIDKIIATGGVKIIRAEGGVATGEKAVFHQKDEKLVLT 117

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           G      ++K+  +   G  + + +  + + ++   + +V+++I  + 
Sbjct: 118 GKP----VVKQGEDFVEGDVITLFLKENRSVVESAGNKKVRAVIFPNK 161


>gi|149199440|ref|ZP_01876476.1| hypothetical protein LNTAR_07829 [Lentisphaera araneosa HTCC2155]
 gi|149137518|gb|EDM25935.1| hypothetical protein LNTAR_07829 [Lentisphaera araneosa HTCC2155]
          Length = 222

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I+++          A FK NV +   DF L+ D+M + Y+   +     I ++    
Sbjct: 87  PLRIQSESSSYNSKKGLAIFKRNVVVEDGDFYLECDEMHVFYSKATKTTKGGIEKIVAID 146

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNG-DRADKVILKEKLNTFLGCKLIVNIDT---- 158
           N+ I+       A+      + + + L G ++   V++ E          I++ +T    
Sbjct: 147 NVKIRQSPNTATATKAVYLLKDQTITLTGTEKEKPVLISEDGQRMKSDFFIIHRETETIE 206

Query: 159 -SFASLQGCES 168
               +++  ES
Sbjct: 207 SGQVTIESDES 217


>gi|163784675|ref|ZP_02179499.1| hypothetical protein HG1285_12282 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880057|gb|EDP73737.1| hypothetical protein HG1285_12282 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 164

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 79/169 (46%), Gaps = 16/169 (9%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           +   LL +V +L     +Q  ++            I I+AD  E  +  + A +K NV +
Sbjct: 1   MAKSLLMVVLLLTSFLYAQTESNE------KNKVPIVIEADSFEYDNKQKIAVYKDNVIV 54

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
            + DF+L ++ M + ++      ++KI  +  E N+  + G     A+ G  +  K I+ 
Sbjct: 55  RKGDFTLWSNLMRVYFDE-----NSKIKEIIAEGNVKFEKGLYKGKANKGIYNANKEIIR 109

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L G+     ++K+K N   G ++I  +    A + G ++ +V++II  +
Sbjct: 110 LIGNA----MVKKKSNILEGDEIIYYMKEDKAVVIG-KNKKVRTIIVPE 153


>gi|77166243|ref|YP_344768.1| OstA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|254435695|ref|ZP_05049202.1| cell envelope biogenesis protein YhbN, putative [Nitrosococcus
           oceani AFC27]
 gi|76884557|gb|ABA59238.1| OstA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|207088806|gb|EDZ66078.1| cell envelope biogenesis protein YhbN, putative [Nitrosococcus
           oceani AFC27]
          Length = 275

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 61/169 (36%), Gaps = 10/169 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
           L+L    +   +S   +   T   +  +  + IHI+A+  E+ D    A + GNV +TQ 
Sbjct: 5   LSLKLTAVGFIISSNLSIIETALALSSDSEQPIHIEANRGELDDREHVAVYSGNVHLTQG 64

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDV--ERNIFIQSGEINVIASNGYVDFQKRILVL 130
              + +D +TI Y    +              +     + +I   A           + L
Sbjct: 65  TLRIDSDTLTIYYTPDKKLEKAVAEGQPAWYRQRPDNSNEDIRAKALRMEYHADTATIHL 124

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY 177
                 K  + +  N F G +++ + +      +G E+   ++   I  
Sbjct: 125 ----LQKAQVWQGTNEFTGDRIVYDTERDIVRGEGSETGVGRIHVTIHP 169


>gi|304320835|ref|YP_003854478.1| hypothetical protein PB2503_06352 [Parvularcula bermudensis
           HTCC2503]
 gi|303299737|gb|ADM09336.1| hypothetical protein PB2503_06352 [Parvularcula bermudensis
           HTCC2503]
          Length = 159

 Score = 83.9 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 62/169 (36%), Gaps = 17/169 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKAD-MLEVKDAVQKAFFKGN 66
           I  Y+ LLAL   +  A     A +            I + AD   EV D        G 
Sbjct: 2   IAFYVSLLALGAAISAAQPVAVAPAADAP--------IDLSADGACEVIDNGAIVRCSGG 53

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           V + Q    L +D+MT+       D     +R++   ++   +GE  +  + G       
Sbjct: 54  VRIVQGAAILASDRMTVY----GIDPDGGFDRIEAVGDVRYSNGENAISGARGTYSALST 109

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            L + GD    V++ +      G +L+ N +T  +        +V+ + 
Sbjct: 110 ELTVTGD----VVVIQGDQVLTGGELVYNTETGASRFSPPPGGRVRGLF 154


>gi|188996154|ref|YP_001930405.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931221|gb|ACD65851.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 179

 Score = 83.9 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 54/138 (39%), Gaps = 10/138 (7%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              E + I AD LE  +  + A + G V   + +  L AD M I  ++        ++++
Sbjct: 47  NKKEPVVITADKLEYFNKDKIAIYTGKVEAIKGNIKLNADMMKIFLDD-----KGDVSKI 101

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
               N++ +                K +++L  +      + +  N   G ++   ID  
Sbjct: 102 IATGNVYFEQENKWGKGKEAEYYKDKNLIILRNNAE----VHQDKNVVEGDEIYYYIDEE 157

Query: 160 FASLQGCESDQVQSIIRY 177
            A +   ++ +V+SII  
Sbjct: 158 KA-IATSKTKRVRSIIFP 174


>gi|297570148|ref|YP_003691492.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296926063|gb|ADH86873.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 212

 Score = 83.5 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 58/158 (36%), Gaps = 12/158 (7%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY--- 85
           A  +     +    E + I+AD +E  D      F+G V   Q D  + AD MTI +   
Sbjct: 16  AGVAVTYAAEGERAEPVRIEADRMETGDEPNSVLFRGQVVARQGDLVIHADTMTIFHLSQ 75

Query: 86  ---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
              +        ++ ++     + +++ +              R ++L G         +
Sbjct: 76  EEQDQLPAGDRRRLKKLYATGQVRVEAEDWIGTGDTLEYTEADRKVLLAGKARA----WQ 131

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESD--QVQSIIRYD 178
           + N   G  + + +D   + ++  E+   +V++    D
Sbjct: 132 EGNLITGRSITLYLDEGRSVVERGETPEERVRAFFYAD 169


>gi|237755600|ref|ZP_04584215.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692227|gb|EEP61220.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 144

 Score = 83.1 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 54/138 (39%), Gaps = 10/138 (7%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              E + I AD LE  +  + A + G V   + +  L AD M I  ++        ++++
Sbjct: 13  NKKEPVVITADKLEYFNKDKIAIYTGKVEAIKGNIKLNADMMKIFLDD-----KGDVSKI 67

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
               N++ +                K +++L  D      + +  N   G ++   ID  
Sbjct: 68  IATGNVYFEQENKWGKGKEAEYYKDKNLIILRKDAE----VHQDKNVVEGDEIYYYIDEE 123

Query: 160 FASLQGCESDQVQSIIRY 177
            A +   ++ +V+SII  
Sbjct: 124 KA-IATSKTKRVRSIIFP 140


>gi|51244292|ref|YP_064176.1| hypothetical protein DP0440 [Desulfotalea psychrophila LSv54]
 gi|50875329|emb|CAG35169.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 166

 Score = 83.1 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 58/143 (40%), Gaps = 5/143 (3%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            + +       +  I+I+A+ +   +     FF+G+V   Q+D  ++++KMT+ Y+  ++
Sbjct: 17  QTLIASTAFAKDAPIYIEANHMTSTENTNTVFFEGDVDAKQDDVRIRSNKMTVFYSKASK 76

Query: 91  DV-SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              S ++ ++    N  +  GE            + + +VL G+        +  N   G
Sbjct: 77  GEKSQQVKKIICTGNTEVTRGEWLGTGQRMVYTTKDKKIVLTGNAKA----WQNQNMVSG 132

Query: 150 CKLIVNIDTSFASLQGCESDQVQ 172
             +   +D   + + G      +
Sbjct: 133 ETITYFLDQKRSEVVGTPQKNKK 155


>gi|197117259|ref|YP_002137686.1| cell envelope biogenesis ABC transporter periplasmic protein
           [Geobacter bemidjiensis Bem]
 gi|197086619|gb|ACH37890.1| cell envelope biogenesis ABC transporter, periplasmic protein
           [Geobacter bemidjiensis Bem]
          Length = 162

 Score = 83.1 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 63/142 (44%), Gaps = 8/142 (5%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
           + GNE + +K+D L   +  + A F+G V   Q + +L  D++ +          N++++
Sbjct: 23  ISGNEPLKVKSDNLTADNEKKTATFEGKVVAHQGELTLYTDRLVVSSAGDG----NELSK 78

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           ++   N+ I  G       +   D ++ +++L+G+    V             +   I+ 
Sbjct: 79  VEAFGNVRILQGIRQATGGHAVYDPKRGVILLDGNPRVVVGDDVVTGKV----ITYFINE 134

Query: 159 SFASLQGCESDQVQSIIRYDGR 180
             + + G   ++V+++I   G+
Sbjct: 135 QRSIVTGGPKERVEAVIHPGGK 156


>gi|329847150|ref|ZP_08262178.1| ostA-like family protein [Asticcacaulis biprosthecum C19]
 gi|328842213|gb|EGF91782.1| ostA-like family protein [Asticcacaulis biprosthecum C19]
          Length = 181

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 64/181 (35%), Gaps = 17/181 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + +      +  +    L    S  A              + +  D  +  +      + 
Sbjct: 1   MTTKTFLAAMFCVALGSLALTGSVGAQVAQEG------GPVMVGGDSWQADENALTQTWD 54

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVS---NKINRMDVERNIFIQSGEINVIASNGYV 121
           G V + Q +  L+AD + I +       +    ++ +++   N++  + E  V  +    
Sbjct: 55  GRVEVIQANSRLRADHVVISHAPGGEGENKGWGEVVKIEATGNVYYVTPENTVKGNTAVY 114

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRY 177
                 +V++GD    V+LK+  N   G +L+  +     ++          +V++++  
Sbjct: 115 TKANDTMVISGD----VVLKQGKNVMTGTRLVAEVGAGTTTMDAAPGSTNNGRVRAVLYP 170

Query: 178 D 178
           D
Sbjct: 171 D 171


>gi|222055371|ref|YP_002537733.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. FRC-32]
 gi|221564660|gb|ACM20632.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. FRC-32]
          Length = 172

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           ++  F +L    +   AS ++   +  N+ I IK+D L    A + A F G V   Q D 
Sbjct: 5   ISSAFTILLVLTATVFASGLSG-SLRSNQPIKIKSDELFTDTANRTATFVGKVSARQGDL 63

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            + ++K+ I Y+  ++D    ++ ++   N+ +  G+    A +   D +   +V   D 
Sbjct: 64  IIYSEKLIIKYSEKDQD----VDSVEASGNVRVIQGDRQATAGHAVYDNKAGKIVF--DV 117

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD---QVQSIIRYDGR 180
           + KV   +  N   G  +   ++   + + G  +    +V++ I   GR
Sbjct: 118 SPKVF--QGNNIVSGKVITYFVEEQRSVVTGGGNGADARVEAEIHPRGR 164


>gi|218779213|ref|YP_002430531.1| OstA family protein [Desulfatibacillum alkenivorans AK-01]
 gi|218760597|gb|ACL03063.1| OstA family protein [Desulfatibacillum alkenivorans AK-01]
          Length = 202

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 63/180 (35%), Gaps = 17/180 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + ++  + +L  +           + +  F +     I IKA  L       KA+F  +V
Sbjct: 19  LTVFACVCSLGPLWADNTAQTPDQAALAGFDLS-KGPIKIKAQKLVTNQEENKAWFSMDV 77

Query: 68  FMTQEDFSLQADKMTIDY--------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
             TQ   +++A+++TI Y          +    S  + ++    N+ I +      +   
Sbjct: 78  VATQGKTTIKANELTIWYVGEKEQNDVQSGLPASQSLKKIQALGNVEIVNEAFTSHSDEA 137

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
               +   LVL G  A  V      NT  G  +  +      + +G     VQ+    + 
Sbjct: 138 LYLQKTGDLVLTGGPAKVV---SGKNTVSGEIITRS-KDGLLTFEG----GVQAEFFPEK 189


>gi|170743376|ref|YP_001772031.1| OstA family protein [Methylobacterium sp. 4-46]
 gi|168197650|gb|ACA19597.1| OstA family protein [Methylobacterium sp. 4-46]
          Length = 285

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 38/95 (40%), Gaps = 4/95 (4%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
              +   S  I ++     + + + +      N   D     ++L G+    V+L +  N
Sbjct: 166 KPVDPTDSGAIRQVVCAGPVTVVNKDQVATGDNAVFDKAANRVILTGN----VVLSQCQN 221

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              G +L+ +++T  A++      +V ++    G+
Sbjct: 222 VTRGNRLVYDMNTGRANMDPTAGGRVSAMFVPGGK 256



 Score = 70.8 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 30/69 (43%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S    F   G E I I AD L+V D   KA F GNV   Q + +++   MT+ Y      
Sbjct: 31  SGFGAFGSSGKEPIKIDADRLDVFDHENKAVFAGNVVAVQGESTIRCSSMTVHYQRNRDK 90

Query: 92  VSNKINRMD 100
            +    R +
Sbjct: 91  GAKDEARAE 99


>gi|23015175|ref|ZP_00054959.1| COG1934: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 325

 Score = 80.8 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 53/140 (37%), Gaps = 8/140 (5%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAF 62
                 +     A++  L    L+Q            G+++I + AD  +E      +  
Sbjct: 1   MKPPALIPFITAAILMALPGLSLAQGFE-----MSKSGDQQIQVYADNGIEWHSEELRVI 55

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
            +GN    + + ++ AD +T  Y    +   ++I R+D + N+ I+S            D
Sbjct: 56  ARGNAHAIRGNMTVDADVLTAHYRKGPKG--DEIWRLDADGNVVIRSPNDTATGHKAIYD 113

Query: 123 FQKRILVLNGDRADKVILKE 142
             K I VL G  A  V   +
Sbjct: 114 LDKSIFVLKGTPAKLVTPTD 133



 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 53/164 (32%), Gaps = 36/164 (21%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQ-EDFSLQADKMTIDYNNTNRD----------------- 91
           D LE  +  + A  +G+    Q    +L+ D +T  + +  +D                 
Sbjct: 139 DSLEYWELTKMAVLRGDAVAVQEGGKTLKGDVLTAHFKDKEKDKPAPARPGAKPQSGTSS 198

Query: 92  ---------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                       ++ R D   ++ I S    V    G  + +  I  ++G      I +E
Sbjct: 199 GAAAGSGDGGGLELQRADAYGHVVIISSSETVTGDRGDYNAETGIATVSGSVK---ISRE 255

Query: 143 KLNTFLGCKLIVNIDTSFASL------QGCESDQVQSIIRYDGR 180
             N   G    VN++T  + L            +VQ +     +
Sbjct: 256 GGNQLEGGWAHVNLNTGVSKLFPTAAGAAESGQRVQGVFIPQKK 299


>gi|239787677|emb|CAX84185.1| OstA-like family protein [uncultured bacterium]
          Length = 277

 Score = 80.4 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 10/135 (7%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS 109
           D LE  +A + A  +G+ F+  ED  L+AD +T D     ++   +I R D   N+ +++
Sbjct: 143 DSLEYWEAKRVAVARGDAFIQHEDKRLRADTITADLKED-KNGKLEIKRADAFGNVLVRT 201

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL-----Q 164
                    G      ++  L G+    V +    N   G    VN+ T  + L      
Sbjct: 202 PTDIATGDKGVYFTDTQLATLTGN----VKITRDKNQLNGGYAEVNLATGISRLFPAPPG 257

Query: 165 GCESDQVQSIIRYDG 179
             +  +VQ I+  DG
Sbjct: 258 NAQGTRVQGILMPDG 272



 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 43/100 (43%), Gaps = 2/100 (2%)

Query: 45  IHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
           I I +D  +E     Q+   +GN    + + ++ AD++   Y +       +I +++   
Sbjct: 38  IDITSDNGIEWMQREQRFIARGNAKAIRNNVTVLADELIAHYRDRKEGGGTEIWKLEALG 97

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADK-VILKE 142
           ++ I S +  V   +   D    +LV+ G    K V L +
Sbjct: 98  HVRIHSADTKVFGDSAVYDIDNVVLVVRGKPMAKLVTLTD 137


>gi|332704275|ref|ZP_08424363.1| OstA family protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554424|gb|EGJ51468.1| OstA family protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 184

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 73/186 (39%), Gaps = 28/186 (15%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++  HL + L+      +    +QAA   +            + AD L       +A F+
Sbjct: 1   MHPSHLIVFLI-CAMAWILPITAQAAEENLV--------PTKVTADRLTYSQEGNRAVFE 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRD---------------VSNKINRMDVERNIFIQS 109
           G V + ++D  L AD++ ID                       +++INR+    N+ ++ 
Sbjct: 52  GKVHVVRQDMELWADRIEIDLRPNGDGKSGASGPDMAFATTEGASRINRIIALGNVRMRR 111

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
           G+             K +++L GD     +LKE  NT  G ++ + I+ + + + G    
Sbjct: 112 GQSEGKCRKATYLADKSMIILEGDP----VLKEGENTLQGKEIRIYINENRSEVIGNTKR 167

Query: 170 QVQSII 175
            V+ I 
Sbjct: 168 PVEMIF 173


>gi|78485318|ref|YP_391243.1| OstA-like protein [Thiomicrospira crunogena XCL-2]
 gi|78363604|gb|ABB41569.1| OstA-like protein; ABC transporter solute binding subunit homolog
           [Thiomicrospira crunogena XCL-2]
          Length = 180

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 70/169 (41%), Gaps = 8/169 (4%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +L+  F LL   +S    S  T      +  I IKAD L  +D   ++ + G V +TQ  
Sbjct: 5   ILSTSFFLLLTAISVQTNSAET--NANESLPIEIKADSLVSQDQKGQSVYSGRVIITQGT 62

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNG 132
             +  DK+TI + N     +  I +    +    +    I+  A       ++R ++L G
Sbjct: 63  TVIHGDKVTIFHPNRKVIKAIVIGQPATFKRFLPEEKNWIDGRADTITYHAERRTVLLEG 122

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRYDG 179
                   +E  N+  G +++ N++    S +G ++   ++  I   + 
Sbjct: 123 HAFVN---QEGKNSISGPEILYNLNDKTLSAKGNKTEKKRITVIFEPEK 168


>gi|319790124|ref|YP_004151757.1| lipopolysaccharide transport periplasmic protein LptA [Thermovibrio
           ammonificans HB-1]
 gi|317114626|gb|ADU97116.1| lipopolysaccharide transport periplasmic protein LptA [Thermovibrio
           ammonificans HB-1]
          Length = 173

 Score = 78.9 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 67/166 (40%), Gaps = 10/166 (6%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L   V ++  A     A + + + +V  N  + ++A  L   D  ++A + G+V    
Sbjct: 5   VFLFLTVLLVSPAVEFAHAGTPLKKIEVNKNLPVVVEAQELIYNDKKRQAVYIGSVVAQH 64

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
               +  DK+ I +         +I ++ VE N+ ++                +  +VL 
Sbjct: 65  GSTVITGDKLIIYF----GPAKTRITKIVVEGNVHVKDPRGEGWCDELIYYPMQEKVVLL 120

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           G+      LK+  N  +G K+I   D     + G +  +V+++I  
Sbjct: 121 GNAK----LKQGKNVLIGDKIIAYRD-GRVEVVGLK-QKVKTVIYP 160


>gi|325295349|ref|YP_004281863.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065797|gb|ADY73804.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 170

 Score = 78.5 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 73/171 (42%), Gaps = 18/171 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L + LL     +  + L +         K   +  I I++  L        A + GNV
Sbjct: 1   MRLVVSLLIFFMSISLSALGET--------KEKTSTPIVIESQKLIYIQKKHMATYIGNV 52

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
              +E   ++ DK+ + ++ T+R     I +++V  +++I+        +  Y    +  
Sbjct: 53  IAQREKTIMKGDKLIVYFDPTDRY----IEKIEVIGHVYIKDPRGEGWCNKLYYYPVQEK 108

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            VL G+      LK+K N  +G ++I        +++G +  +V+++I  +
Sbjct: 109 AVLIGNAK----LKQKENLVVGDEIIAY-KDGRVTVEGIK-QRVKTVIFPE 153


>gi|158520525|ref|YP_001528395.1| OstA family protein [Desulfococcus oleovorans Hxd3]
 gi|158509351|gb|ABW66318.1| OstA family protein [Desulfococcus oleovorans Hxd3]
          Length = 198

 Score = 78.5 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 68/190 (35%), Gaps = 18/190 (9%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +   N++ +   LL + F++  A  + A      +      + IHI AD L  +     A
Sbjct: 6   TGIWNTMKIQTGLLTICFLVFPALFASADTPPPPQDDA---KAIHISADRLVSESRADYA 62

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNT------------NRDVSNKINRMDVERNIFIQS 109
            F GNV    E F +QAD + + Y+              +      +  +    N+ I  
Sbjct: 63  EFTGNVRAVGEKFDIQADTLQVFYSPAPDTQAPGTANRLDTGTGKTVREIIATGNVTILF 122

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
            +            +   +VL G     V  K       G  + ++ +T   ++      
Sbjct: 123 DDKVAKTDQAVYSRESGRVVLMG-PGSTVTGKSGR--ISGDTITLHTETESVTVISGGET 179

Query: 170 QVQSIIRYDG 179
           +VQ++I  DG
Sbjct: 180 RVQAVIHPDG 189


>gi|302381886|ref|YP_003817709.1| OstA family protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192514|gb|ADL00086.1| OstA family protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 164

 Score = 78.5 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/180 (18%), Positives = 65/180 (36%), Gaps = 22/180 (12%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
              +  L I        L    ++Q+  +         N+ I   AD  E+ +       
Sbjct: 1   MKTTSILAIGATVAALGLGGMAVAQSRPNT-------SNQPIGYGADSGELTNTA--VSL 51

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           +G   + Q    L+A+ +        RD S  + R++   +++  +    +         
Sbjct: 52  RGRAEIQQGQTRLRANAI-----EGARDASGGLTRIEASGDVYYVTPNETIRGDRAVYTV 106

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRYDG 179
               +V+ GD    VIL +  N   G  L  N+DT  A +QG  +     +V+ +   +G
Sbjct: 107 TNATVVVTGD----VILTQGQNVLTGGSLTYNVDTGEARIQGGGAGANDGRVRGVFYPEG 162


>gi|258405723|ref|YP_003198465.1| OstA family protein [Desulfohalobium retbaense DSM 5692]
 gi|257797950|gb|ACV68887.1| OstA family protein [Desulfohalobium retbaense DSM 5692]
          Length = 181

 Score = 78.5 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 70/178 (39%), Gaps = 22/178 (12%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L++ +LA V  +     +Q         +      I I +D +    A ++  FKG+V  
Sbjct: 6   LFLGMLAAVLSMASPLGAQ---------QGEQTAPIKITSDTMRYAHADKQVRFKGSVHA 56

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNK---------INRMDVERNIFIQSGEINVIASNGY 120
            ++ F L ++ +T+       D +           I+ +  E ++ +Q G         +
Sbjct: 57  IRDTFELWSETLTVFLKAGAADTAEGGMGMGGDQSIDHLVAEGDVRLQEGNRTGYCDTAW 116

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
               + +L L G       L++  N+  G  + + +  + + + G +S +V+++    
Sbjct: 117 FYPDEGMLRLEGSPR----LEQGENSISGSVIKMYLKENRSEVIGGDSGRVEALFYSP 170


>gi|317485282|ref|ZP_07944162.1| OstA-like protein [Bilophila wadsworthia 3_1_6]
 gi|316923408|gb|EFV44614.1| OstA-like protein [Bilophila wadsworthia 3_1_6]
          Length = 191

 Score = 77.7 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 66/181 (36%), Gaps = 21/181 (11%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L++ +  L   L  +    AA       K   N +  I +D L      Q   F  NV +
Sbjct: 4   LFLGITTLSLSLFCSAPLWAAPVTPP--KPAKNVETRITSDQLTYLAEKQLVIFDKNVHV 61

Query: 70  TQEDFSLQADKMTIDYNNTNRDVS---------------NKINRMDVERNIFIQSGEINV 114
            + D  + AD++T+       D                   ++R+  ERN+ ++S   N 
Sbjct: 62  VRPDIEIWADRITVYLKPPKGDAQKKEGEKGGMPAGMAAGDVDRIVAERNVRMKSENRNG 121

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSI 174
             +         +L++ GD      L +  NT  G  +    + + + + G    +V+++
Sbjct: 122 TCAKATYTMDDGVLLMEGDPR----LTDGENTVTGETIKYFTEENRSEVMGGSKKRVEAV 177

Query: 175 I 175
            
Sbjct: 178 F 178


>gi|288942543|ref|YP_003444783.1| lipopolysaccharide transport periplasmic protein LptA
           [Allochromatium vinosum DSM 180]
 gi|288897915|gb|ADC63751.1| lipopolysaccharide transport periplasmic protein LptA
           [Allochromatium vinosum DSM 180]
          Length = 166

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 59/154 (38%), Gaps = 18/154 (11%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           ++    +    + I+I+AD +EV +A   + + G+V + Q    L AD +T+ +    + 
Sbjct: 22  THAWALEADARQPIYIEADEVEVNEANSTSVYVGHVQVDQGSMRLLADHVTVYHREDRQP 81

Query: 92  VSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                  +            +    GE+   A     D  K  L L G+     +L +  
Sbjct: 82  -----RLIIALGQPARYKQLLDDDQGEVQAFAKRMEYDADKDELALIGEG----LLIQGE 132

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   G +++ +     A  +   + +V+  I  D
Sbjct: 133 DRLTGERILYDRA--KARFRAGGAGRVKITITPD 164


>gi|74316553|ref|YP_314293.1| OstA-like family protein [Thiobacillus denitrificans ATCC 25259]
 gi|74056048|gb|AAZ96488.1| OstA-like family protein [Thiobacillus denitrificans ATCC 25259]
          Length = 177

 Score = 77.4 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 63/148 (42%), Gaps = 10/148 (6%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
              ++ I+++AD + + D  + + ++GNV +TQ   +L+AD+M +  N    D  +   R
Sbjct: 26  ADRDKPINLEADTVTLDDIKKVSVYQGNVILTQGTLTLRADRMQLTQNAAGLDKVSATGR 85

Query: 99  MDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
               R       E I   A+    D     L L GD      L+   +   G ++  N D
Sbjct: 86  PVAFRQKVDGRDEFIEGFAARIEFDNTTSELDLIGDAR----LRRGEDELRGARISYNSD 141

Query: 158 TSFASL-----QGCESDQVQSIIRYDGR 180
           + F  +      G    +V+++IR   R
Sbjct: 142 SGFYKVVGQNGAGSPGGRVRAVIRPKPR 169


>gi|83313034|ref|YP_423298.1| hypothetical protein amb3935 [Magnetospirillum magneticum AMB-1]
 gi|82947875|dbj|BAE52739.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 321

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 49/121 (40%), Gaps = 8/121 (6%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
            + L+Q            G+++I + AD  +E      +   +GN    + + ++ AD +
Sbjct: 20  GSALAQGFE-----MSKSGDQQIQVYADNGIEWHSEELRVIARGNAHAIRGNMTVDADVL 74

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
           T  Y    +   ++I R+D + N+ I+S            D  K I VL G  A  V   
Sbjct: 75  TAHYRKGPKG--DEIWRLDADGNVVIRSPNDTATGHKAIYDLDKSIFVLKGAPAKMVTPT 132

Query: 142 E 142
           +
Sbjct: 133 D 133



 Score = 65.0 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 52/159 (32%), Gaps = 32/159 (20%)

Query: 51  MLEVKDAVQKAFFKGNVFMTQ-EDFSLQADKMTIDYNNTNRD------------------ 91
            LE  +  + A  +G+    Q    +L+ D +T  + +  +D                  
Sbjct: 140 SLEYWELKKMAVLRGDAVAVQEGGKTLKGDVLTAHFKDKEKDKPAPARPGAKPAQAGQPS 199

Query: 92  ----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                  ++ R D   ++ I S    V    G  + +  I  ++G      I +E  N  
Sbjct: 200 GGDGGGLELQRADAYGHVVILSASETVTGDRGDYNAETGIATVSGSVK---ISREGGNQL 256

Query: 148 LGCKLIVNIDTSFASL------QGCESDQVQSIIRYDGR 180
            G    VN++T  + L            +VQ +     +
Sbjct: 257 EGGWAHVNLNTGVSKLFPTAAGAAESGQRVQGVFIPQKK 295


>gi|328953772|ref|YP_004371106.1| OstA family protein [Desulfobacca acetoxidans DSM 11109]
 gi|328454096|gb|AEB09925.1| OstA family protein [Desulfobacca acetoxidans DSM 11109]
          Length = 207

 Score = 76.2 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 64/183 (34%), Gaps = 30/183 (16%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
                L  +    +   + L    ++I A  LEV  + Q   F   V    +D  L  D 
Sbjct: 20  FAAPPLCYSQTDNVPGQEQL---PLNITAARLEVDHSQQVISFLTKVEARYKDLILYTDL 76

Query: 81  MTIDY---------------NNTNRDVSN--------KINRMDVERNIFIQSGEINVIAS 117
           + I Y                + ++  ++        KI R++   N+ I   +      
Sbjct: 77  LKIFYQAKTETPGGKTSAGQKDDSKGAASPLGAVGIEKILRIEALGNVRIVQQDRVATGE 136

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                 Q+  +VL G+      L    ++  G +++  +  + A ++G    +V+++I  
Sbjct: 137 KAIYYTQEEKIVLLGNPQ----LWRGESSLKGREIVFFLKDNRAVVEGDPEKRVEAVIYP 192

Query: 178 DGR 180
             +
Sbjct: 193 SSK 195


>gi|120555624|ref|YP_959975.1| OstA family protein [Marinobacter aquaeolei VT8]
 gi|120325473|gb|ABM19788.1| OstA family protein [Marinobacter aquaeolei VT8]
          Length = 188

 Score = 76.2 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 62/156 (39%), Gaps = 24/156 (15%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
           + F +  +  I + AD   + D+   A + G V + Q +  L+AD++ +  N        
Sbjct: 25  SAFNLDSDIPIKVSADSARLDDSAGTAVYTGAVELIQGETRLEADRVVLYRNQQG----- 79

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR-----ADKVILKEKLNTFLG 149
            ++R++   N              G  D +   +  +GD        + ++++  N F G
Sbjct: 80  -VSRIEAAGN--PAHYRQPGQEGEGMTDAKALNITWSGDENLVIFERQAVIEQGGNVFRG 136

Query: 150 CKLIVNIDT--------SFASLQGCESDQVQSIIRY 177
              +++ DT           S +G  S +V+ +I+ 
Sbjct: 137 D--VIHYDTVRRVVTAEGDTSSEG-GSGRVEMVIQP 169


>gi|153007151|ref|YP_001381476.1| OstA family protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030724|gb|ABS28492.1| OstA family protein [Anaeromyxobacter sp. Fw109-5]
          Length = 186

 Score = 75.8 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 12/143 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN---VFMTQEDFSLQADKMTID 84
            +AAS      V G  K+HI AD LE     ++  F G    V +T+ D  L   ++   
Sbjct: 29  SSAASRSPVATVAGEAKVHIDADELEYVFQKREVIFTGKRTPVVLTRGDARLTCRRLV-- 86

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                 D   +I R     ++  + GE  V       +     LV  G+     +L++  
Sbjct: 87  ---ATNDARGEIARAVCSGDVRFERGERLVTCEKATYEAAAARLVCEGNP----VLRDGP 139

Query: 145 NTFLGCKLIVNIDTSFASLQGCE 167
           +   G +L+ +++   A L+G  
Sbjct: 140 SEASGTRLVYDLEIDKARLEGAR 162


>gi|195952774|ref|YP_002121064.1| lipopolysaccharide transport periplasmic protein LptA
           [Hydrogenobaculum sp. Y04AAS1]
 gi|195932386|gb|ACG57086.1| lipopolysaccharide transport periplasmic protein LptA
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 170

 Score = 75.8 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 68/180 (37%), Gaps = 14/180 (7%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N   +++     +  L  + + +   +   +     N+ I+I+A+ ++  +    
Sbjct: 1   MKNKVNKKVVFVISSLTLSFLAFSKVEKPTQNTPVKNTSNNNKPIYIEANKMDYNN--NV 58

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
             + GNV  T+ +  L   ++ I  +   +     I ++    N         +      
Sbjct: 59  ITYTGNVVATRGNGKLTCQELKIFLDKNKK-----IEKIIATGNPVYTEPNKLIKGDVIE 113

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            D  +  +++ G+      L+ K +   G ++I       A + G    +VQSI   +G+
Sbjct: 114 YDALQDEIIVTGNAY----LENKGDVVQGDRVIYYKKLDKAIVTG---KRVQSIFIPNGK 166


>gi|262273850|ref|ZP_06051663.1| LptA protein [Grimontia hollisae CIP 101886]
 gi|262222265|gb|EEY73577.1| LptA protein [Grimontia hollisae CIP 101886]
          Length = 170

 Score = 75.8 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 59/145 (40%), Gaps = 7/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + I+I +D   +        F GNV++ Q    L+ADK+ +    +  + +  
Sbjct: 22  ALSTDSEQPIYIDSDSQNLDMKTNTVVFTGNVYLRQGSIRLRADKVVVT-RPSGEEGAEV 80

Query: 96  IN---RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           I+   +            +IN  A +   +  K  L++   + + V+ +E  N   G K+
Sbjct: 81  IDAYGKPAAFEQTMDDGKKINGEAFDLRYETAKSFLIM---KRNAVLTQEGGNQVEGQKI 137

Query: 153 IVNIDTSFASLQGCESDQVQSIIRY 177
             NID      +  +S +V ++++ 
Sbjct: 138 TYNIDKQLLVAESDDSSRVTTVLQP 162


>gi|258591943|emb|CBE68248.1| putative OstA-like protein precursor [NC10 bacterium 'Dutch
           sediment']
          Length = 187

 Score = 75.4 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 62/171 (36%), Gaps = 16/171 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +  ++ LV + +   L  A        +  G   + I +D LEV   +  A + GNV 
Sbjct: 5   GWFAAVVMLVNLAVPLGLGFAQE------QPKGKYPVTITSDRLEVNRKLHTAIYTGNVM 58

Query: 69  MTQE--DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
              +  D  + ADKM   ++     +   I       N+     E  V A    +   + 
Sbjct: 59  ADDKDRDMVVLADKMEFLFDEKMERIQKGI----ATGNVRATIKEKRVTADQLELFPDED 114

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             VL G+        +  +   G K+ +      A ++G  S +V +I+  
Sbjct: 115 KAVLTGNPRA----WQDNDLVTGTKMTIFSKEDRAIVEGEPSKRVTAILYP 161


>gi|170765506|ref|ZP_02900317.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia albertii
           TW07627]
 gi|170124652|gb|EDS93583.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia albertii
           TW07627]
          Length = 185

 Score = 75.4 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 64/166 (38%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +   +      +      +   AS  + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      LK+  +   G K+   +          +  +V +++   
Sbjct: 126 NA----FLKQIDSNITGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|313673392|ref|YP_004051503.1| osta family protein [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940148|gb|ADR19340.1| OstA family protein [Calditerrivibrio nitroreducens DSM 19672]
          Length = 176

 Score = 75.4 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 62/137 (45%), Gaps = 9/137 (6%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            ++I+AD ++     Q + F GNV  T +D  + +D M + +++       ++  +    
Sbjct: 25  PVNIEADSVKYFGKEQYSLFTGNVKATYKDTKVYSDSMKVVFDSKK-----EVEFIYCSG 79

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+ +    +  ++    +  ++ ILVL GD      + +  N   G ++IV  + +   +
Sbjct: 80  NVKMVKEGMYSLSKEAELKMKENILVLKGDAK----VWQGENYLEGEEVIVYNNDNRVVV 135

Query: 164 QGCESDQVQSIIRYDGR 180
              E+ +V+ I   D +
Sbjct: 136 NRAENKRVKVIFYPDNK 152


>gi|26249786|ref|NP_755826.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli CFT073]
 gi|91212625|ref|YP_542611.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UTI89]
 gi|110807066|ref|YP_690586.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 5 str. 8401]
 gi|26110214|gb|AAN82400.1|AE016767_160 Protein yhbN precursor [Escherichia coli CFT073]
 gi|91074199|gb|ABE09080.1| conserved hypothetical protein [Escherichia coli UTI89]
 gi|110616614|gb|ABF05281.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281602583|gb|ADA75567.1| putative ABC superfamily transport protein [Shigella flexneri
           2002017]
          Length = 192

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 64/166 (38%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 15  LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 72

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +   +      +      +   AS  + +  K  +VL G
Sbjct: 73  KINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTG 132

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 133 NAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 174


>gi|218885533|ref|YP_002434854.1| OstA family protein [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756487|gb|ACL07386.1| OstA family protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 224

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 73/203 (35%), Gaps = 34/203 (16%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
             ++       +AL+       ++  A S     +V  +    +K+D ++     Q   F
Sbjct: 1   MRHTGIRSALCVALLLTFSAPAMAADAKSAT---EVRRDVPTAVKSDRMQYDAKGQVVIF 57

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDV---------------------------SNKI 96
           +G+V++ + DF + A+K+T+                                    + +I
Sbjct: 58  EGDVYVQRPDFEMWAEKITLHLRKKAAKPGKAGAGQGADASGAAGQSGAAGMSGMDAGEI 117

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
           +RM  ER + ++                  +LV+ G+     +L E  N+  G  +    
Sbjct: 118 DRMVAERKVRMKRENRTGECEKATYTVDNAVLVMEGNP----VLHEGENSIRGDVITFYT 173

Query: 157 DTSFASLQGCESDQVQSIIRYDG 179
             + + ++G  + +VQ++    G
Sbjct: 174 RENRSEVRGTSTKRVQAVFTSSG 196


>gi|320181475|gb|EFW56393.1| LptA, protein essential for LPS transport across the periplasm
           [Shigella boydii ATCC 9905]
          Length = 185

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 64/166 (38%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +   +      +      +   AS  + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V S++   
Sbjct: 126 NAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTSVLVPS 167


>gi|312881876|ref|ZP_07741643.1| hypothetical protein VIBC2010_12664 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370455|gb|EFP97940.1| hypothetical protein VIBC2010_12664 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 165

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 70/173 (40%), Gaps = 22/173 (12%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  L+L+FVL    L+ A             + +++ AD  ++     KA F GNV + Q
Sbjct: 3   LSHLSLLFVLFTPALALA-------LDSDTEQPVYVDADSQQLDMQSNKATFIGNVKLKQ 55

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQK 125
              ++ ADK+ ++ +  +      I R++   N+   S        +   A   Y     
Sbjct: 56  GSININADKVVVERDPKDST----IRRIEGYGNLATFSQLSEDGKTLYGEAKELYYVMVD 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
             L +     D+ +L +  +   G K+  NI +      G  + D+V ++++ 
Sbjct: 112 DQLTM----IDQAMLSQDDSVIRGSKITYNISSQKLIADGKQQGDRVSTVLQP 160


>gi|283788161|ref|YP_003368026.1| organic solvent tolerance protein [Citrobacter rodentium ICC168]
 gi|282951615|emb|CBG91315.1| putative organic solvent tolerance protein [Citrobacter rodentium
           ICC168]
          Length = 184

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 64/166 (38%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   AS  + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEEGKEVIDGFGNPATFYQMQDNGKPVKGHASKMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          + ++V +++   
Sbjct: 126 NAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGNRVTTVLVPS 167


>gi|114778207|ref|ZP_01453079.1| possible OstA-like protein [Mariprofundus ferrooxydans PV-1]
 gi|114551454|gb|EAU54009.1| possible OstA-like protein [Mariprofundus ferrooxydans PV-1]
          Length = 166

 Score = 73.9 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 59/134 (44%), Gaps = 10/134 (7%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I I+A  + +     K  F G V +T++   +  D +   Y++      +++   D + +
Sbjct: 28  IQIEAKKMTLLQKESKVEFTGKVHLTRDTMQMDCDHLVAYYSD------HQLTHADADGH 81

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + I   +++  ++   +D  K IL L G    + +L+++ N   G  ++ N+++    + 
Sbjct: 82  VVIVQDKVHGHSNKARLDQIKGILTLTG----QAVLEQQGNRVEGETIVHNLNSQKTVVT 137

Query: 165 GCESDQVQSIIRYD 178
                ++   I  +
Sbjct: 138 PDTGGRIHMTIESE 151


>gi|209694095|ref|YP_002262023.1| hypothetical protein VSAL_I0500 [Aliivibrio salmonicida LFI1238]
 gi|208008046|emb|CAQ78185.1| putative exported protein [Aliivibrio salmonicida LFI1238]
          Length = 166

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 51/150 (34%), Gaps = 6/150 (4%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT-- 88
           +S          + IHI +D         +  F G+V + Q    + ADK+ +       
Sbjct: 15  SSSSWALSTDTEQPIHINSDTQNFDMQSNRVTFNGDVTLKQGSIKIFADKLIVIRPQGQE 74

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            R++     +      +      +   A+    + +   L +     D   L +  +   
Sbjct: 75  GREILEAYGKPARFSQLTDDGKTLRGKANKLRYELENEFLTMT----DNAELTQDDSVIQ 130

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G  +  N+ T      G + ++V +I++  
Sbjct: 131 GKVITYNMKTQKLIADGGKDERVTTILQPS 160


>gi|330446807|ref|ZP_08310458.1| lipopolysaccharide transport periplasmic protein LptA
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490998|dbj|GAA04955.1| lipopolysaccharide transport periplasmic protein LptA
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 168

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 58/149 (38%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I+I +D  E+      A F GNV + Q    ++A+K+ +    T  +  +K
Sbjct: 21  ALKSDTKQPINIDSDSQEIDVQNNIATFTGNVKLRQGTIDIRANKVVV----TRPNSKSK 76

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +    N      I      I+  A     + +   L +     DK +L +  +   G
Sbjct: 77  EQTIVAYGNPATFHQIMDDGKPIDGEALKMRYETKTEFLKMT----DKAVLNQDGSEIKG 132

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   ID      +  ++++V ++I+ +
Sbjct: 133 NVITYKIDEQRLMAKSGDNERVTTVIQPN 161


>gi|224369875|ref|YP_002604039.1| putative organic solvent tolerance protein OstA precursor
           [Desulfobacterium autotrophicum HRM2]
 gi|223692592|gb|ACN15875.1| putative organic solvent tolerance protein OstA precursor
           [Desulfobacterium autotrophicum HRM2]
          Length = 177

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 55/165 (33%), Gaps = 10/165 (6%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            ++    LS +  S  T   +  +  +HI AD +  +       F GN   T +D  + A
Sbjct: 7   LMVWAVILSPSLISAQTADNLQ-DRSLHITADAMTSERDSSFVAFTGNAVATSQDDVIHA 65

Query: 79  DKMTID-YNNTN-----RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           D + I  Y         +     I  +    N+   S +    A          +L L G
Sbjct: 66  DAIKIFIYTEDERKKLSKTDEQNIKEIIATGNVTFTSQDQKAFADKAVYTTSTLVLTLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D    +      +   G K+ +        ++  +  +V+++   
Sbjct: 126 DAPRVIT---GESFVTGKKITLFRSNGKVVVESGKDQRVEALFNP 167


>gi|242279723|ref|YP_002991852.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio salexigens DSM 2638]
 gi|242122617|gb|ACS80313.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio salexigens DSM 2638]
          Length = 541

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/139 (15%), Positives = 50/139 (35%), Gaps = 8/139 (5%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN---RDVSNKINRMD 100
            I I +  +   +   +  F G V + + D +L +D +T           D  +KI ++ 
Sbjct: 404 PIKITSTKMTFSENRNRITFSGKVKVVRLDVTLTSDTLTAHLRPEGDSLSDTQDKIKKIV 463

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
              N+ +   +               I+ +NG+      L++  N   G ++   +  + 
Sbjct: 464 AAGNVKVVMKKRKGHCDKLTYVVGDSIIYMNGNAE----LQDGPNLIQGDEIKFYLKDNR 519

Query: 161 ASLQGCESDQVQSIIRYDG 179
           A + G     +++I     
Sbjct: 520 AEVVGGNKP-IEAIFYTPK 537


>gi|15803740|ref|NP_289774.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 EDL933]
 gi|15833333|ref|NP_312106.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. Sakai]
 gi|16131090|ref|NP_417667.1| periplasmic LPS-binding protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30064538|ref|NP_838709.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2a str. 2457T]
 gi|56480284|ref|NP_708999.2| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2a str. 301]
 gi|74313737|ref|YP_312156.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           sonnei Ss046]
 gi|82545562|ref|YP_409509.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii Sb227]
 gi|82778514|ref|YP_404863.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae Sd197]
 gi|89109963|ref|AP_003743.1| predicted transporter subunit [Escherichia coli str. K-12 substr.
           W3110]
 gi|110643441|ref|YP_671171.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 536]
 gi|117625492|ref|YP_858815.1| hypothetical protein APECO1_3235 [Escherichia coli APEC O1]
 gi|157156158|ref|YP_001464678.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E24377A]
 gi|157162684|ref|YP_001460002.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli HS]
 gi|168751606|ref|ZP_02776628.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|168754182|ref|ZP_02779189.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|168763737|ref|ZP_02788744.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769056|ref|ZP_02794063.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777255|ref|ZP_02802262.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|168781344|ref|ZP_02806351.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786086|ref|ZP_02811093.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC869]
 gi|168800914|ref|ZP_02825921.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC508]
 gi|170018550|ref|YP_001723504.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli ATCC 8739]
 gi|170082734|ref|YP_001732054.1| ABC transporter periplasmic-binding protein [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170682501|ref|YP_001745472.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli SMS-3-5]
 gi|187731673|ref|YP_001881885.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii CDC 3083-94]
 gi|188493941|ref|ZP_03001211.1| OstA family protein [Escherichia coli 53638]
 gi|191168640|ref|ZP_03030422.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B7A]
 gi|191174473|ref|ZP_03035973.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           F11]
 gi|193065329|ref|ZP_03046400.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E22]
 gi|193070327|ref|ZP_03051270.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E110019]
 gi|194429131|ref|ZP_03061661.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B171]
 gi|194434477|ref|ZP_03066737.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Shigella dysenteriae
           1012]
 gi|194439203|ref|ZP_03071284.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           101-1]
 gi|195940056|ref|ZP_03085438.1| hypothetical protein EscherichcoliO157_27295 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808977|ref|ZP_03251314.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4206]
 gi|208813997|ref|ZP_03255326.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4045]
 gi|208819233|ref|ZP_03259553.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4042]
 gi|209396095|ref|YP_002272670.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4115]
 gi|209920675|ref|YP_002294759.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli SE11]
 gi|215488516|ref|YP_002330947.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217326728|ref|ZP_03442811.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. TW14588]
 gi|218555770|ref|YP_002388683.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli IAI1]
 gi|218560270|ref|YP_002393183.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli S88]
 gi|218691490|ref|YP_002399702.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli ED1a]
 gi|218696905|ref|YP_002404572.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 55989]
 gi|218701969|ref|YP_002409598.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli IAI39]
 gi|218706820|ref|YP_002414339.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UMN026]
 gi|227887921|ref|ZP_04005726.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, periplasmic lipopolysaccharide-binding
           protein [Escherichia coli 83972]
 gi|237706048|ref|ZP_04536529.1| yhbN [Escherichia sp. 3_2_53FAA]
 gi|238902302|ref|YP_002928098.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli BW2952]
 gi|254038365|ref|ZP_04872423.1| yhbN [Escherichia sp. 1_1_43]
 gi|254795149|ref|YP_003079986.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. TW14359]
 gi|256018881|ref|ZP_05432746.1| lipopolysaccharide transport periplasmic protein LptA [Shigella sp.
           D9]
 gi|256024225|ref|ZP_05438090.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           sp. 4_1_40B]
 gi|260846013|ref|YP_003223791.1| putative transporter subunit [Escherichia coli O103:H2 str. 12009]
 gi|260857327|ref|YP_003231218.1| putative transporter subunit [Escherichia coli O26:H11 str. 11368]
 gi|260869951|ref|YP_003236353.1| putative transporter subunit [Escherichia coli O111:H- str. 11128]
 gi|261228211|ref|ZP_05942492.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255067|ref|ZP_05947600.1| putative transporter subunit [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284574|ref|YP_003501392.1| Protein yhbN precursor [Escherichia coli O55:H7 str. CB9615]
 gi|293406809|ref|ZP_06650735.1| hypothetical protein ECGG_02119 [Escherichia coli FVEC1412]
 gi|293412571|ref|ZP_06655294.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293416629|ref|ZP_06659268.1| hypothetical protein ECDG_03389 [Escherichia coli B185]
 gi|293449533|ref|ZP_06663954.1| hypothetical protein ECCG_02566 [Escherichia coli B088]
 gi|298382550|ref|ZP_06992147.1| hypothetical protein ECFG_02311 [Escherichia coli FVEC1302]
 gi|300817545|ref|ZP_07097761.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 107-1]
 gi|300823834|ref|ZP_07103958.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 119-7]
 gi|300897968|ref|ZP_07116344.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 198-1]
 gi|300904392|ref|ZP_07122240.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 84-1]
 gi|300918962|ref|ZP_07135517.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 115-1]
 gi|300926055|ref|ZP_07141877.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 182-1]
 gi|300929896|ref|ZP_07145338.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 187-1]
 gi|300938116|ref|ZP_07152890.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 21-1]
 gi|300948855|ref|ZP_07162920.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 116-1]
 gi|300955789|ref|ZP_07168131.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 175-1]
 gi|300979951|ref|ZP_07174803.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 200-1]
 gi|300990930|ref|ZP_07179382.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 45-1]
 gi|301022102|ref|ZP_07186028.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 69-1]
 gi|301047953|ref|ZP_07194998.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 185-1]
 gi|301306746|ref|ZP_07212800.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 124-1]
 gi|301326367|ref|ZP_07219731.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 78-1]
 gi|301644914|ref|ZP_07244883.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 146-1]
 gi|306816458|ref|ZP_07450590.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli NC101]
 gi|307139886|ref|ZP_07499242.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H736]
 gi|307313095|ref|ZP_07592721.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli W]
 gi|309793779|ref|ZP_07688205.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 145-7]
 gi|331643898|ref|ZP_08345029.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H736]
 gi|331649000|ref|ZP_08350088.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M605]
 gi|331654804|ref|ZP_08355804.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M718]
 gi|331659487|ref|ZP_08360429.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA206]
 gi|331664813|ref|ZP_08365718.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA143]
 gi|331670027|ref|ZP_08370872.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA271]
 gi|331674729|ref|ZP_08375488.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA280]
 gi|331679279|ref|ZP_08379951.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H591]
 gi|331684847|ref|ZP_08385439.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H299]
 gi|332279969|ref|ZP_08392382.1| yhbN [Shigella sp. D9]
 gi|83288016|sp|P0ADV3|LPTA_ECO57 RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|83288017|sp|P0ADV2|LPTA_ECOL6 RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|83288018|sp|P0ADV1|LPTA_ECOLI RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|83288019|sp|P0ADV4|LPTA_SHIFL RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|12517818|gb|AAG58334.1|AE005548_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|551336|gb|AAB60161.1| orf185 [Escherichia coli str. K12 substr. W3110]
 gi|606139|gb|AAA58002.1| ORF_o185 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789592|gb|AAC76232.1| periplasmic LPS-binding protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13363552|dbj|BAB37502.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30042797|gb|AAP18520.1| hypothetical protein S3458 [Shigella flexneri 2a str. 2457T]
 gi|56383835|gb|AAN44706.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|73857214|gb|AAZ89921.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242662|gb|ABB63372.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246973|gb|ABB67681.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85675994|dbj|BAE77244.1| predicted transporter subunit [Escherichia coli str. K12 substr.
           W3110]
 gi|110345033|gb|ABG71270.1| hypothetical protein ECP_3288 [Escherichia coli 536]
 gi|115514616|gb|ABJ02691.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli APEC O1]
 gi|157068364|gb|ABV07619.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli HS]
 gi|157078188|gb|ABV17896.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E24377A]
 gi|169753478|gb|ACA76177.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli ATCC 8739]
 gi|169890569|gb|ACB04276.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli str. K-12 substr. DH10B]
 gi|170520219|gb|ACB18397.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           SMS-3-5]
 gi|187428665|gb|ACD07939.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Shigella boydii CDC
           3083-94]
 gi|187767477|gb|EDU31321.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014365|gb|EDU52487.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|188489140|gb|EDU64243.1| OstA family protein [Escherichia coli 53638]
 gi|189001064|gb|EDU70050.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4076]
 gi|189358723|gb|EDU77142.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361851|gb|EDU80270.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|189366148|gb|EDU84564.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|189374133|gb|EDU92549.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC869]
 gi|189376819|gb|EDU95235.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC508]
 gi|190901334|gb|EDV61101.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B7A]
 gi|190905228|gb|EDV64867.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           F11]
 gi|192926970|gb|EDV81593.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E22]
 gi|192956386|gb|EDV86846.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E110019]
 gi|194412856|gb|EDX29148.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B171]
 gi|194417256|gb|EDX33365.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Shigella dysenteriae
           1012]
 gi|194421899|gb|EDX37905.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           101-1]
 gi|208728778|gb|EDZ78379.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4206]
 gi|208735274|gb|EDZ83961.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4045]
 gi|208739356|gb|EDZ87038.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4042]
 gi|209157495|gb|ACI34928.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4115]
 gi|209758038|gb|ACI77331.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758040|gb|ACI77332.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758042|gb|ACI77333.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758044|gb|ACI77334.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758046|gb|ACI77335.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209913934|dbj|BAG79008.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266588|emb|CAS11027.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli O127:H6 str. E2348/69]
 gi|217319095|gb|EEC27520.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. TW14588]
 gi|218353637|emb|CAU99848.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli 55989]
 gi|218362538|emb|CAR00162.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli IAI1]
 gi|218367039|emb|CAR04810.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli S88]
 gi|218371955|emb|CAR19811.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli IAI39]
 gi|218429054|emb|CAR09861.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli ED1a]
 gi|218433917|emb|CAR14834.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli UMN026]
 gi|222034917|emb|CAP77660.1| Protein yhbN [Escherichia coli LF82]
 gi|226839989|gb|EEH72010.1| yhbN [Escherichia sp. 1_1_43]
 gi|226899088|gb|EEH85347.1| yhbN [Escherichia sp. 3_2_53FAA]
 gi|227835317|gb|EEJ45783.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, periplasmic lipopolysaccharide-binding
           protein [Escherichia coli 83972]
 gi|238863248|gb|ACR65246.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli BW2952]
 gi|254594549|gb|ACT73910.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli O157:H7 str. TW14359]
 gi|257755976|dbj|BAI27478.1| predicted transporter subunit [Escherichia coli O26:H11 str. 11368]
 gi|257761160|dbj|BAI32657.1| predicted transporter subunit [Escherichia coli O103:H2 str. 12009]
 gi|257766307|dbj|BAI37802.1| predicted transporter subunit [Escherichia coli O111:H- str. 11128]
 gi|260447773|gb|ACX38195.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli DH1]
 gi|281180242|dbj|BAI56572.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284923222|emb|CBG36316.1| putative organic solvent tolerance protein [Escherichia coli 042]
 gi|290764447|gb|ADD58408.1| Protein yhbN precursor [Escherichia coli O55:H7 str. CB9615]
 gi|291322623|gb|EFE62052.1| hypothetical protein ECCG_02566 [Escherichia coli B088]
 gi|291426815|gb|EFE99847.1| hypothetical protein ECGG_02119 [Escherichia coli FVEC1412]
 gi|291431985|gb|EFF04968.1| hypothetical protein ECDG_03389 [Escherichia coli B185]
 gi|291469342|gb|EFF11833.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490504|gb|ADE89260.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           IHE3034]
 gi|298277690|gb|EFI19206.1| hypothetical protein ECFG_02311 [Escherichia coli FVEC1302]
 gi|300300185|gb|EFJ56570.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 185-1]
 gi|300307886|gb|EFJ62406.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 200-1]
 gi|300317335|gb|EFJ67119.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 175-1]
 gi|300358316|gb|EFJ74186.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 198-1]
 gi|300397698|gb|EFJ81236.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 69-1]
 gi|300403666|gb|EFJ87204.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 84-1]
 gi|300407006|gb|EFJ90544.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 45-1]
 gi|300413904|gb|EFJ97214.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 115-1]
 gi|300417913|gb|EFK01224.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 182-1]
 gi|300451660|gb|EFK15280.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 116-1]
 gi|300456879|gb|EFK20372.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 21-1]
 gi|300462182|gb|EFK25675.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 187-1]
 gi|300523602|gb|EFK44671.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 119-7]
 gi|300529843|gb|EFK50905.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 107-1]
 gi|300838025|gb|EFK65785.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 124-1]
 gi|300846931|gb|EFK74691.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 78-1]
 gi|301076765|gb|EFK91571.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 146-1]
 gi|305850023|gb|EFM50482.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli NC101]
 gi|306907006|gb|EFN37514.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli W]
 gi|307625201|gb|ADN69505.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UM146]
 gi|308122736|gb|EFO59998.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 145-7]
 gi|309703626|emb|CBJ02966.1| putative organic solvent tolerance protein [Escherichia coli ETEC
           H10407]
 gi|312947757|gb|ADR28584.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O83:H1 str. NRG 857C]
 gi|315062506|gb|ADT76833.1| periplasmic LPS-binding protein [Escherichia coli W]
 gi|315137786|dbj|BAJ44945.1| protein yhbN precursor [Escherichia coli DH1]
 gi|315257128|gb|EFU37096.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 85-1]
 gi|315289001|gb|EFU48399.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 110-3]
 gi|315294860|gb|EFU54199.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 153-1]
 gi|315297934|gb|EFU57204.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 16-3]
 gi|320186686|gb|EFW61410.1| LptA, protein essential for LPS transport across the periplasm
           [Shigella flexneri CDC 796-83]
 gi|320189553|gb|EFW64212.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli O157:H7 str. EC1212]
 gi|320194685|gb|EFW69315.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli WV_060327]
 gi|320202114|gb|EFW76689.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli EC4100B]
 gi|320640271|gb|EFX09843.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. G5101]
 gi|320645568|gb|EFX14577.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H- str. 493-89]
 gi|320650878|gb|EFX19335.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H- str. H 2687]
 gi|320656259|gb|EFX24171.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
 gi|320661949|gb|EFX29357.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O55:H7 str. USDA 5905]
 gi|320666784|gb|EFX33763.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. LSU-61]
 gi|323154415|gb|EFZ40616.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli EPECa14]
 gi|323376906|gb|ADX49174.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli KO11]
 gi|323936106|gb|EGB32400.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E1520]
 gi|323941700|gb|EGB37879.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E482]
 gi|323946946|gb|EGB42962.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H120]
 gi|323951281|gb|EGB47156.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H252]
 gi|323957653|gb|EGB53367.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H263]
 gi|323961145|gb|EGB56759.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H489]
 gi|323966380|gb|EGB61814.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M863]
 gi|323970237|gb|EGB65508.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA007]
 gi|323979083|gb|EGB74161.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TW10509]
 gi|324008712|gb|EGB77931.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 57-2]
 gi|324012156|gb|EGB81375.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 60-1]
 gi|324018348|gb|EGB87567.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 117-3]
 gi|324119565|gb|EGC13447.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E1167]
 gi|326337900|gb|EGD61734.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli O157:H7 str. 1125]
 gi|326347470|gb|EGD71195.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli O157:H7 str. 1044]
 gi|327251291|gb|EGE62980.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli STEC_7v]
 gi|330909252|gb|EGH37766.1| lptA, protein essential for LPS transport across the periplasm
           [Escherichia coli AA86]
 gi|331037369|gb|EGI09593.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H736]
 gi|331042747|gb|EGI14889.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M605]
 gi|331048186|gb|EGI20263.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M718]
 gi|331054069|gb|EGI26098.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA206]
 gi|331058061|gb|EGI30043.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA143]
 gi|331062940|gb|EGI34854.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA271]
 gi|331068168|gb|EGI39564.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA280]
 gi|331073344|gb|EGI44667.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H591]
 gi|331078462|gb|EGI49668.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H299]
 gi|332086225|gb|EGI91383.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii 5216-82]
 gi|332102321|gb|EGJ05667.1| yhbN [Shigella sp. D9]
 gi|332345157|gb|AEE58491.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UMNK88]
 gi|332754506|gb|EGJ84872.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2747-71]
 gi|332998842|gb|EGK18438.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri VA-6]
          Length = 185

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 64/166 (38%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +   +      +      +   AS  + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|163783705|ref|ZP_02178692.1| hypothetical protein HG1285_15099 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881030|gb|EDP74547.1| hypothetical protein HG1285_15099 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 146

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 54/133 (40%), Gaps = 12/133 (9%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + I  +A  LE      +  + GNV +T+ +  L+ADK+ I  +   +       +M   
Sbjct: 20  QPITGEAKSLEF--KKDRIIYTGNVKLTRGESVLKADKVVILLDEKGKPT-----KMIAT 72

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
            N+     +    +     D +  I+VL G+   +    E  N     +++ +       
Sbjct: 73  GNVRYYEPKRKSFSEYAEYDLRNEIIVLKGNARVE----EDKNLLEAEEIVYDRKNGTLQ 128

Query: 163 LQGCESDQVQSII 175
            +G +S +V++I 
Sbjct: 129 AKGDKS-KVRTIY 140


>gi|114321377|ref|YP_743060.1| OstA family protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227771|gb|ABI57570.1| OstA family protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 175

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 59/148 (39%), Gaps = 18/148 (12%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             +  I ++AD  E+ +    + + G V +TQ    +  D+M +     + +    ++R+
Sbjct: 29  DRDRPIDLEADRAEIDNVRGISTYTGAVVLTQGSLVITGDRMVVH--TRDVEGRRVLDRV 86

Query: 100 DVERNIFIQSGEINVIASNGYVDFQK----------RILVLNGDRADKVILKEKLNTFLG 149
           +V       + E         V  +           + L L+G       L ++ N   G
Sbjct: 87  EVAGG--PATYEQLPPGQTDTVHAEAPRMEYHSRGPQRLHLSGGAE----LWQRENRMSG 140

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
            ++ VN++T  A ++G E  + ++I   
Sbjct: 141 DEIRVNLETQEAVVEGREDRRTRTIFYP 168


>gi|320174566|gb|EFW49702.1| LptA, protein essential for LPS transport across the periplasm
           [Shigella dysenteriae CDC 74-1112]
          Length = 185

 Score = 73.1 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 64/166 (38%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVIGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +   +      +      +   AS  + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|317050778|ref|YP_004111894.1| OstA family protein [Desulfurispirillum indicum S5]
 gi|316945862|gb|ADU65338.1| OstA family protein [Desulfurispirillum indicum S5]
          Length = 157

 Score = 73.1 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 60/134 (44%), Gaps = 5/134 (3%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF 106
           I+++ LE+   + ++ F G+V      + L AD + +     N     ++ R+    N+ 
Sbjct: 28  IESNHLEINAHIGESRFWGSVVFESPSYVLHADSLVVSAVQ-NAAGRQELQRLHAWDNVE 86

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           +  G+    +   Y    ++ +VL G+      L +  ++    ++ ++  T  A ++G 
Sbjct: 87  LYYGDKRGFSDTLYYYHDRQTIVLEGNAR----LIDSRSSLAAPRITIHEPTGEAFVEGD 142

Query: 167 ESDQVQSIIRYDGR 180
           ES++V+ I   D  
Sbjct: 143 ESERVKVIFEDDRA 156


>gi|332999279|gb|EGK18865.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-272]
          Length = 179

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 59/160 (36%), Gaps = 7/160 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L + L  A+           ++ IHI++D   +        F GNV +TQ    + ADK
Sbjct: 1   MLASSLLAASIPAF-AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADK 59

Query: 81  MTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +        ++V +   +      +      +   AS  + +  K  +VL G+     
Sbjct: 60  VVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY--- 116

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G K+   +          +  +V +++   
Sbjct: 117 -LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 155


>gi|283836253|ref|ZP_06355994.1| lipopolysaccharide transport periplasmic protein LptA [Citrobacter
           youngae ATCC 29220]
 gi|291067617|gb|EFE05726.1| lipopolysaccharide transport periplasmic protein LptA [Citrobacter
           youngae ATCC 29220]
          Length = 182

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 61/167 (36%), Gaps = 10/167 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++         + IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTI 65

Query: 75  SLQADKMTIDYNNTNRDVSNKIN---RMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            + ADK+ +       D    I+          +      +   AS  + +  K  +VL 
Sbjct: 66  KINADKVVVT-RPGGEDGKEVIDGYGNPATFYQMQDNGKPVKGRASQMHYELAKDFVVLT 124

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G    K  L++  +   G K+   +          +  +V +++   
Sbjct: 125 G----KAYLEQLDSNITGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|291287219|ref|YP_003504035.1| lipopolysaccharide transport periplasmic protein LptA
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290884379|gb|ADD68079.1| lipopolysaccharide transport periplasmic protein LptA
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 165

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            IHI+AD +       K+   GNV + + D ++++D+M +          N++  +  + 
Sbjct: 36  PIHIEADKMVT--IGNKSIITGNVVVVRGDMTMKSDEMEVTAAEG-----NQVKEIYSKG 88

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+ I+  ++  ++    +   ++ +VL     D   + +  N   G K+ + ++++   +
Sbjct: 89  NVRIEDKDLLALSGFARLYQDEQKVVLT----DNAKVWKGDNYIEGEKITLFMESNRLFV 144

Query: 164 QGC--ESDQVQSIIRYDG 179
                + D+++ II    
Sbjct: 145 DKGDNKGDRIKIIITPQK 162


>gi|113461318|ref|YP_719387.1| hypothetical protein HS_1175 [Haemophilus somnus 129PT]
 gi|112823361|gb|ABI25450.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 172

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 60/163 (36%), Gaps = 14/163 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL   L   + S +   K   N+ I I +D   +        F  NV + Q    ++A+K
Sbjct: 9   LLITALMMTSISAL-ALKDDTNQPIDIVSDHQSLDMENSVVTFTNNVVIKQGSILIKANK 67

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFI------QSGEINVIASNGYVDFQKRILVLNGDR 134
           + I       + SNK   ++   N  +          +   A+  + D     L L G+ 
Sbjct: 68  VVIT---RPTEKSNKKETVEAFGNPVLFNQLLDNGKPVQGKANKIHYDLSAEFLTLTGNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                LK+  +   G K+  ++        G  + +V++++  
Sbjct: 125 E----LKQLDSKINGEKITYDVKKQQLKANGAGTSRVKTVLIP 163


>gi|262373036|ref|ZP_06066315.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter junii SH205]
 gi|262313061|gb|EEY94146.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter junii SH205]
          Length = 193

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 65/166 (39%), Gaps = 7/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA +  +    ++ ++ S         N+++ + AD     D      + GNV + Q   
Sbjct: 23  LAFLKHVACIAVAFSSVSAF-ALPSDRNQQLSLVADRATYNDKTGITTYTGNVVIEQGTM 81

Query: 75  SLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            LQAD +    N+    + ++ K      ++ + +  G     A     +    I+ L+G
Sbjct: 82  KLQADSIVATLNSKKEIQTITAKGQPAKFQQQMDVNKGLARGEAQTIIYNADTGIITLSG 141

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
               K  L +  ++  G  L  +++      QG  +++VQ II   
Sbjct: 142 ----KAYLYQDGSSIRGNTLKYSMNKGDVEAQGSSTNRVQIIIPPS 183


>gi|157148771|ref|YP_001456090.1| lipopolysaccharide transport periplasmic protein LptA [Citrobacter
           koseri ATCC BAA-895]
 gi|157085976|gb|ABV15654.1| hypothetical protein CKO_04603 [Citrobacter koseri ATCC BAA-895]
          Length = 184

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 60/166 (36%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL    L+ +  ++         + IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASTLLAASLPAF--AVTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   A   + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGFGNPATFYQMQDNGKPVKGHAQKMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 167


>gi|238910112|ref|ZP_04653949.1| hypothetical protein SentesTe_03100 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 184

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 62/166 (37%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  +L  + L+ +  ++         + IHI +D   +        F GNV MTQ   
Sbjct: 8   LSLNLMLAGSLLAASIPAF--AVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   AS+ + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LEQLDSNITGDKITYLLKEQKMQAFSEKGKRVTTVLVPS 167


>gi|229527540|ref|ZP_04416932.1| LptA protein [Vibrio cholerae 12129(1)]
 gi|229335172|gb|EEO00657.1| LptA protein [Vibrio cholerae 12129(1)]
          Length = 179

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 56/154 (36%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +      
Sbjct: 29  ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFLGDVKLKQGSININADKLIVI----R 84

Query: 90  RDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              + KI  ++   N+   S        +   A   Y   +   LV+     +K +L + 
Sbjct: 85  NAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYKVRDDELVM----INKAVLSQD 140

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I             +V ++++ 
Sbjct: 141 DSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 174


>gi|91774496|ref|YP_544252.1| OstA-like protein [Methylobacillus flagellatus KT]
 gi|91708483|gb|ABE48411.1| OstA-like protein [Methylobacillus flagellatus KT]
          Length = 176

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 15/173 (8%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           +LV  +L   LS +A +     K   ++ I ++AD ++V DA + + + GNV +TQ    
Sbjct: 7   SLVLAILAGMLSVSAFAE----KADRDKPIELEADAVQVNDAKKTSTYTGNVILTQGTLV 62

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDR 134
           ++ DK+ +  +      S         R       E +         D +   + L  + 
Sbjct: 63  IRGDKLIVREDKEGFQHSTSYGNPTTFRQKRDGKNEYMEGGGQRIEYDGRMDKVQLFTNA 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES------DQVQSIIRYDGRP 181
             K       +   G  ++ + +  +A +    S       +V++II+   +P
Sbjct: 123 WVK----RGDDIVHGDYIMYDANAEYAEVISGGSQATTPTGRVRAIIQPRKKP 171


>gi|82701221|ref|YP_410787.1| OstA-like protein [Nitrosospira multiformis ATCC 25196]
 gi|82409286|gb|ABB73395.1| OstA-like protein [Nitrosospira multiformis ATCC 25196]
          Length = 190

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 60/156 (38%), Gaps = 21/156 (13%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +    + +H++AD   V+DA + A F GNV +TQ    ++ADKMT+      ++ +N   
Sbjct: 34  RADSEKPVHLEADRATVQDANKLATFIGNVVLTQGTLIIRADKMTV------KEDANGFQ 87

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA-----DKVILKEKLNTFLGCKL 152
                 N  + S        + YV+     +  +G         K  L+   +   G  +
Sbjct: 88  YATAFGN--LASFRQKRDGKDEYVEGWSERMEYDGKADKVQLFKKARLRRGKDEVHGDYI 145

Query: 153 IVNIDT--------SFASLQGCESDQVQSIIRYDGR 180
             +              S Q     +V+++I+   +
Sbjct: 146 SYDAVNEFFQVNGEGGTSTQTHSEGRVRAVIQPKKK 181


>gi|52425770|ref|YP_088907.1| hypothetical protein MS1715 [Mannheimia succiniciproducens MBEL55E]
 gi|52307822|gb|AAU38322.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 171

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 65/170 (38%), Gaps = 14/170 (8%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA+  +LL + L   + S     K   N+ I+I +D   +        F  NV +TQ   
Sbjct: 3   LAINKILLTSALVMTSLSAF-ALKDDTNQPINIVSDNQSLDMEKSIVTFTDNVVITQGSI 61

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRIL 128
            ++A+K+ I       + S +   ++   N      +       +  A+  + D  K  L
Sbjct: 62  LIKANKVIIT---RPPEGSKQKETVEAFGNPVTFHQMLDDGKPADGKANRVHYDLGKEFL 118

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L G+      LK+  +T  G  +  +++            +V++++   
Sbjct: 119 TLTGNAQ----LKQLDSTIDGDVITYDVNKQQLKASSTAKSRVKTVLIPS 164


>gi|323697962|ref|ZP_08109874.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio sp. ND132]
 gi|323457894|gb|EGB13759.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio desulfuricans ND132]
          Length = 265

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 56/138 (40%), Gaps = 7/138 (5%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID--YNNTNRDVSNKINRMDV 101
            + I +D +   +  +   F GNV  T  + +L ADK++         +  ++ ++R+  
Sbjct: 128 PVRITSDRMTYDETGKVIAFVGNVVATHGELTLWADKLSAYLSARTDKKFSADSVDRIVA 187

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           E N+  + G               ++L +  +      L++  N+  G  +  +I    +
Sbjct: 188 EGNVRAKKGTTEGTCGKLTYLVGPQLLKMERNPK----LQDGPNSLTGEVINFHIKDDRS 243

Query: 162 SLQGCESDQVQSIIRYDG 179
            + G E  +V++I    G
Sbjct: 244 EVIGGE-QRVKAIFMTPG 260


>gi|261884644|ref|ZP_06008683.1| OstA-like protein [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 90

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           +Q G        G  D   +I+VL G    KV+L +  N   GCKL  ++DT  A+++ C
Sbjct: 7   LQVGTQVATGDTGRYDAINQIMVLQG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESC 63

Query: 167 ES---DQVQSIIRY 177
           +     +V  I+  
Sbjct: 64  KGQTKGRVSIIMAP 77


>gi|50084656|ref|YP_046166.1| hypothetical protein ACIAD1485 [Acinetobacter sp. ADP1]
 gi|49530632|emb|CAG68344.1| putative lipopolysaccharide transport protein A (ABC superfamily,
           peri_bind) (LptA) [Acinetobacter sp. ADP1]
          Length = 158

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 53/154 (34%), Gaps = 16/154 (10%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S         N+ I + AD     D      + GNV + Q    LQAD +         +
Sbjct: 4   SAAFAVPSDRNQPISLVADHATYNDKTGVTTYTGNVVIEQGTMKLQADSIV-----GQLN 58

Query: 92  VSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
              ++  ++           I  Q G     A     + +  I+ L+G+      L +  
Sbjct: 59  SQRQLQTINATGRPAKFQQQINAQKGIARGEAQKIVYNAETGIITLSGNAY----LNQDG 114

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +  G  L  +++      QG  S++VQ +I   
Sbjct: 115 ASVRGNTLRYSMNKGDIEAQGSGSNRVQLVIPPS 148


>gi|46143808|ref|ZP_00133923.2| COG1934: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207821|ref|YP_001053046.1| hypothetical protein APL_0337 [Actinobacillus pleuropneumoniae L20]
 gi|165975795|ref|YP_001651388.1| hypothetical protein APJL_0353 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149611|ref|YP_001968136.1| hypothetical protein APP7_0342 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249490|ref|ZP_07335697.1| hypothetical protein APP6_0891 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307245161|ref|ZP_07527253.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249555|ref|ZP_07531542.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307251884|ref|ZP_07533785.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254109|ref|ZP_07535955.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256379|ref|ZP_07538162.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258572|ref|ZP_07540308.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260807|ref|ZP_07542494.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307262935|ref|ZP_07544557.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126096613|gb|ABN73441.1| hypothetical protein APL_0337 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875896|gb|ABY68944.1| hypothetical protein APJL_0353 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914742|gb|ACE60994.1| hypothetical protein APP7_0342 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302651564|gb|EFL81713.1| hypothetical protein APP6_0891 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853941|gb|EFM86154.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306858410|gb|EFM90479.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860576|gb|EFM92588.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862933|gb|EFM94881.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865205|gb|EFM97105.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867366|gb|EFM99218.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869533|gb|EFN01323.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871561|gb|EFN03283.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 167

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 50/143 (34%), Gaps = 4/143 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   ++ I+I +    +        F  NV +TQ    + ADK+TI      ++    
Sbjct: 22  ALKGDTDQPINIDSGSQSLDMNSNVVTFSDNVVITQGSIKVTADKVTIIRQEGKKETLEA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                  +        +N   ++ + D     L L G+      LK++ +     K+  +
Sbjct: 82  SGSPVTFQQTLDNGKPVNGKGNSVHYDLNSEFLTLVGNAE----LKQQGSFIKASKITYD 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +             +V++I+  +
Sbjct: 138 VKKQQLKANSGNKSRVKTILIPN 160


>gi|37678634|ref|NP_933243.1| hypothetical protein VV0450 [Vibrio vulnificus YJ016]
 gi|37197374|dbj|BAC93214.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 169

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 55/155 (35%), Gaps = 14/155 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A S     K    + ++I +D  ++     +  F G+V + Q   ++ ADK+ +    T 
Sbjct: 19  ATSNAYALKSDTQQPVYIDSDSQQLDMRSNQVIFDGDVSLKQGSININADKIVV----TR 74

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              SN I +++          +      ++  A           L + G       L + 
Sbjct: 75  DPESNTIKKIEAFGQPATFSQLMDDGKTLSGSAKQLDYSIDNDQLTMKGQAE----LAQD 130

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            N   G  ++  I          ++++V ++++  
Sbjct: 131 NNVIKGSSIVYQIALQKLMADSSKNERVTTVLQPS 165


>gi|333015003|gb|EGK34347.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-227]
          Length = 171

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 59/160 (36%), Gaps = 7/160 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L + L  A+           ++ IHI++D   +        F GNV +TQ    + ADK
Sbjct: 1   MLASSLLAASIPAF-AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADK 59

Query: 81  MTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +        ++V +   +      +      +   AS  + +  K  +VL G+     
Sbjct: 60  VVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY--- 116

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G K+   +          +  +V +++   
Sbjct: 117 -LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 155


>gi|253997531|ref|YP_003049595.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera mobilis JLW8]
 gi|253984210|gb|ACT49068.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera mobilis JLW8]
          Length = 226

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 60/151 (39%), Gaps = 12/151 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I ++AD ++V DA Q + + GNV +TQ    ++ADK+ +  +      S  + 
Sbjct: 34  AADRDKPIDLEADTMKVDDAKQISTYSGNVILTQGTLEIRADKLIVREDKEGFQHSTSLG 93

Query: 98  RMDVER-NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                +  +  +S  I   A     D +   + L      K  +K   +   G  ++ + 
Sbjct: 94  NPTTFKQKLEGKSEYIQGSAQRIEYDGRMDKVQLY----TKAWVKRGEDVVHGDYIMYDA 149

Query: 157 DT-------SFASLQGCESDQVQSIIRYDGR 180
           +          +      S +V+++I+   +
Sbjct: 150 NAEYAEVIGGNSQSATSGSGRVRAVIQPKNK 180


>gi|77919536|ref|YP_357351.1| hypothetical protein Pcar_1940 [Pelobacter carbinolicus DSM 2380]
 gi|77545619|gb|ABA89181.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 166

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 21/139 (15%), Positives = 62/139 (44%), Gaps = 8/139 (5%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + + I +  LE    ++K  F G V   Q+  ++++ K+ + Y  +      +++ ++  
Sbjct: 33  QPLEITSQKLEADGTLKKVVFVGKVVARQDGLTIRSSKLIVAYGQSG----TRVSSIEAI 88

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
            ++ +Q  +    A  G  +  +  +VL         +++  N+  G +++  ++   + 
Sbjct: 89  GDVVVQKDDRTATAGRGLYNVAEGTVVLTETPR----VQQGDNSVEGDEIVFYLEEDRSI 144

Query: 163 LQGCESDQVQSIIRYDGRP 181
           ++     +V++I+   G P
Sbjct: 145 VKSQSGSRVRAILTPGGTP 163


>gi|62181826|ref|YP_218243.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|62129459|gb|AAX67162.1| putative ABC superfamily (bind_prot) transport protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322716315|gb|EFZ07886.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323131678|gb|ADX19108.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326629341|gb|EGE35684.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 191

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 62/166 (37%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  +L  + L+ +  ++         + IHI +D   +        F GNV MTQ   
Sbjct: 15  LSLNLMLAGSLLAASIPAF--AVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTI 72

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   AS+ + +  K  +VL G
Sbjct: 73  KINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTG 132

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 133 NAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 174


>gi|89075264|ref|ZP_01161691.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
 gi|89048945|gb|EAR54513.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
          Length = 168

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 56/151 (37%), Gaps = 6/151 (3%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
            ++     K    + I+I ++  E+      A F G+V + Q    + ADK+ +   N+N
Sbjct: 15  VSTSSWALKSDTKQPINISSNSQELDVQNNIATFTGDVRLRQGTIDIHADKVVVTRPNSN 74

Query: 90  RDVSNKI--NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                 I   +      I      I+  A     + +   L +     DK +L +     
Sbjct: 75  AKEQTIIAYGKPATFHQIMDDGKPIDGEALKMRYETKTEFLKMT----DKAVLNQDGTEM 130

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G  +  +I+      Q  +  +V ++I+ +
Sbjct: 131 KGNVITYDINKQRLVAQSGDKQRVTTVIQPN 161


>gi|311695331|gb|ADP98204.1| OstA family protein [marine bacterium HP15]
          Length = 188

 Score = 70.8 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 65/170 (38%), Gaps = 24/170 (14%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL A L+ A A  +  F +  +  I + AD   + D    A + G+V + Q +  L A++
Sbjct: 11  LLAALLTVAMAGPVAAFDLDSDIPIKVTADNARLDDGQGIATYTGDVELEQGNTRLNAER 70

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD---- 136
           + +          + ++R++                  G  D +   +  +   +     
Sbjct: 71  VVLY------RTEDGLSRIEASG--TPARYRQPAREGEGETDARALNITWSATDSQLTFE 122

Query: 137 -KVILKEKLNTFLGCKLIVNIDT--------SFASLQGCESDQVQSIIRY 177
            + ++++  N F G   +++ DT          A   G  + +V+ +I+ 
Sbjct: 123 REAVIEQNGNLFRGD--VIHYDTAGRVVTAEGGAE-TGDGTGRVEMVIQP 169


>gi|301025898|ref|ZP_07189385.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 196-1]
 gi|309785528|ref|ZP_07680159.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae 1617]
 gi|312968461|ref|ZP_07782670.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 2362-75]
 gi|312972526|ref|ZP_07786700.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1827-70]
 gi|299879920|gb|EFI88131.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 196-1]
 gi|307555293|gb|ADN48068.1| lipopolysaccharide ABC transporter [Escherichia coli ABU 83972]
 gi|308926648|gb|EFP72124.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae 1617]
 gi|310334903|gb|EFQ01108.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1827-70]
 gi|312286679|gb|EFR14590.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 2362-75]
 gi|313648557|gb|EFS12999.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2a str. 2457T]
 gi|315617283|gb|EFU97892.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 3431]
 gi|323162892|gb|EFZ48727.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E128010]
 gi|323165161|gb|EFZ50951.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           sonnei 53G]
 gi|323173540|gb|EFZ59169.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli LT-68]
 gi|323178624|gb|EFZ64200.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1180]
 gi|323183154|gb|EFZ68552.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1357]
 gi|323189179|gb|EFZ74463.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli RN587/1]
 gi|332086471|gb|EGI91618.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae 155-74]
 gi|332090699|gb|EGI95793.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii 3594-74]
 gi|332752359|gb|EGJ82749.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 4343-70]
 gi|332752885|gb|EGJ83270.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-671]
 gi|332765196|gb|EGJ95423.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2930-71]
          Length = 173

 Score = 70.8 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 59/160 (36%), Gaps = 7/160 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L + L  A+           ++ IHI++D   +        F GNV +TQ    + ADK
Sbjct: 1   MLASSLLAASIPAF-AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADK 59

Query: 81  MTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +        ++V +   +      +      +   AS  + +  K  +VL G+     
Sbjct: 60  VVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY--- 116

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G K+   +          +  +V +++   
Sbjct: 117 -LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 155


>gi|262170533|ref|ZP_06038211.1| LptA protein [Vibrio mimicus MB-451]
 gi|261891609|gb|EEY37595.1| LptA protein [Vibrio mimicus MB-451]
          Length = 165

 Score = 70.8 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 58/154 (37%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  N  N
Sbjct: 14  ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFLGDVKLKQGSININADKLIVIRNADN 73

Query: 90  RDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
                KI  ++   N+   S        +   A   Y   +   LV+     +K +L + 
Sbjct: 74  ----GKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYKVRDDELVM----INKAMLSQD 125

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I +           +V ++++ 
Sbjct: 126 DSEIRGSKIRYKISSQKLIADSDGKGRVSTVLQP 159


>gi|320157532|ref|YP_004189911.1| lptA, protein essential for LPS transport across the periplasm
           [Vibrio vulnificus MO6-24/O]
 gi|326423751|ref|NP_759675.2| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           vulnificus CMCP6]
 gi|319932844|gb|ADV87708.1| lptA, protein essential for LPS transport across the periplasm
           [Vibrio vulnificus MO6-24/O]
 gi|319999113|gb|AAO09202.2| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           vulnificus CMCP6]
          Length = 164

 Score = 70.8 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 55/155 (35%), Gaps = 14/155 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A S     K    + ++I +D  ++     +  F G+V + Q   ++ ADK+ +    T 
Sbjct: 14  ATSNAYALKSDTQQPVYIDSDSQQLDMRSNQVIFDGDVSLKQGSININADKIVV----TR 69

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              SN I +++          +      ++  A           L + G       L + 
Sbjct: 70  DPESNTIKKIEAFGQPATFSQLMDDGKTLSGSAKQLDYSIDNDQLTMKGQAE----LAQD 125

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            N   G  ++  I          ++++V ++++  
Sbjct: 126 NNVIKGSSIVYQIALQKLMADSSKNERVTTVLQPS 160


>gi|311277827|ref|YP_003940058.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cloacae SCF1]
 gi|308747022|gb|ADO46774.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cloacae SCF1]
          Length = 185

 Score = 70.8 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 57/164 (34%), Gaps = 6/164 (3%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L   L    +  AA+          ++ IHI++D   +      A F GNV +TQ    +
Sbjct: 8   LSLKLALTSVLLAASLPALALTGDTDQPIHIESDQQSLDMQGNVATFTGNVIVTQGSIKI 67

Query: 77  QADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            ADK+ +        ++  +          +      +   +S  + +     +VL G+ 
Sbjct: 68  NADKVVVTRPGGEKGKETIDGYGNPATFYQMQDNGKPVKGHSSKMHYETANDFVVLTGNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L++  +   G K+   +          +  +V +++   
Sbjct: 128 Y----LEQLDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|149378028|ref|ZP_01895752.1| hypothetical protein MDG893_01465 [Marinobacter algicola DG893]
 gi|149357683|gb|EDM46181.1| hypothetical protein MDG893_01465 [Marinobacter algicola DG893]
          Length = 184

 Score = 70.8 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 67/161 (41%), Gaps = 22/161 (13%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A + T F +  ++ I + AD   + +    A + G+V M+Q D +L ADK+ +  +    
Sbjct: 12  APFATAFDLESDQPIRVNADNARLDEGQGIATYTGSVEMSQGDANLMADKVVLHRDE--- 68

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA-----DKVILKEKLN 145
              N ++R++              +   G  D +   +  +          + ++++  N
Sbjct: 69  ---NGVSRIEATG--TPARYRQPAMEGQGETDARALTITWSASDNRVTFRREAVIEQGGN 123

Query: 146 TFLGCKLIVNIDTSFASL-------QGCESDQVQSIIRYDG 179
            F G   +++ D++   +       QG  S +V+ +I+  G
Sbjct: 124 LFRGD--VIHYDSAERVVTAEGSADQGDGSGRVEMVIQPRG 162


>gi|253771966|ref|YP_003034797.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163142|ref|YP_003046250.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli B str. REL606]
 gi|297520034|ref|ZP_06938420.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli OP50]
 gi|242378743|emb|CAQ33533.1| LptA, subunit of LptABCFG ABC transporter [Escherichia coli
           BL21(DE3)]
 gi|253323010|gb|ACT27612.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975043|gb|ACT40714.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli B str. REL606]
 gi|253979199|gb|ACT44869.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli BL21(DE3)]
          Length = 185

 Score = 70.4 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 65/166 (39%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ+  
Sbjct: 8   LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQDTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +   +      +      +   AS  + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|170717854|ref|YP_001784912.1| cell envelope biogenesis YhbN [Haemophilus somnus 2336]
 gi|168825983|gb|ACA31354.1| Cell envelope biogenesis YhbN [Haemophilus somnus 2336]
          Length = 172

 Score = 70.4 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 65/180 (36%), Gaps = 23/180 (12%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
             ++ + Y+ + AL+   + A             K   N+ I I +D   +        F
Sbjct: 1   MKSTTNKYLLITALMMTSISAL----------ALKDDTNQPIDIVSDHQSLDMENSVVTF 50

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI------QSGEINVIAS 117
             NV + Q    ++A+K+ I       + SNK   ++   N  +          +   A+
Sbjct: 51  TNNVVIKQGSILIKANKVVIT---RPTEKSNKKETVEAFGNPVLFNQLLDNGKPVQGKAN 107

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             + D     L L G+      LK+  +   G K+  ++        G  + +V++++  
Sbjct: 108 KIHYDLSAEFLTLMGNAE----LKQLDSKINGEKITYDVKKQQLKANGAGTSRVKTVLIP 163


>gi|152972124|ref|YP_001337270.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206580902|ref|YP_002236388.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Klebsiella
           pneumoniae 342]
 gi|238896707|ref|YP_002921452.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           pneumoniae NTUH-K2044]
 gi|262042760|ref|ZP_06015914.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288933372|ref|YP_003437431.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           variicola At-22]
 gi|290511577|ref|ZP_06550946.1| hypothetical protein HMPREF0485_03348 [Klebsiella sp. 1_1_55]
 gi|329997610|ref|ZP_08302879.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           sp. MS 92-3]
 gi|150956973|gb|ABR79003.1| putative transport protein (ABC superfamily, peri_bind) [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206569960|gb|ACI11736.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Klebsiella
           pneumoniae 342]
 gi|238549034|dbj|BAH65385.1| putative ABC transpor system periplasmic binding protein
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259039985|gb|EEW41102.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288888101|gb|ADC56419.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           variicola At-22]
 gi|289776570|gb|EFD84569.1| hypothetical protein HMPREF0485_03348 [Klebsiella sp. 1_1_55]
 gi|328538951|gb|EGF65004.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           sp. MS 92-3]
          Length = 181

 Score = 70.4 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 51/142 (35%), Gaps = 6/142 (4%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKI 96
              ++ IHI++D   +        F GNV +TQ    + ADK+ +    N   ++V    
Sbjct: 30  GDTDQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTRPGNEKGKEVIEGF 89

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                   +      +   AS    + Q   +VL G+      L++  +   G K+   +
Sbjct: 90  GNPATFYQMQDNGKPVKGRASKMRYELQNDYVVLTGNAY----LEQLDSNIKGDKITYLV 145

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
                     +  +V +++   
Sbjct: 146 KEQKMQAFSDKGRRVTTVLVPS 167


>gi|148260669|ref|YP_001234796.1| OstA family protein [Acidiphilium cryptum JF-5]
 gi|146402350|gb|ABQ30877.1| OstA family protein [Acidiphilium cryptum JF-5]
          Length = 323

 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 54/142 (38%), Gaps = 18/142 (12%)

Query: 51  MLEVKDAVQKAFFKGNVFMTQED-FSLQADKMTIDYN-------------NTNRDVSNKI 96
            L+     +KA   G+  +  +D  S+ AD++T  +                +   ++++
Sbjct: 166 ALQYWSEARKAVAIGHAKVVGKDGRSVTADRLTGYFTAAPAAPKAGGTPPAGSTAEASQL 225

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
            ++  E ++ + +        +G       I VL G+    V +    N   G    VN+
Sbjct: 226 RKVVAEGHVVVTTQTDVATGDHGVYHPATGIAVLTGN----VHITHGPNELAGHIAQVNM 281

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
            T  A+L      +V+ +I  D
Sbjct: 282 KTGVATLVSAPGHRVEGLILPD 303



 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 37/130 (28%), Gaps = 24/130 (18%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKA-DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
             +A S            I I A + +      +    KGN    +   ++ AD++   Y
Sbjct: 20  GASAQSLGFGTAGGQPAPIDITAQNGISWNQKTRIVTAKGNARAVRGKVTVTADELVAHY 79

Query: 86  N-----------------------NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           +                             +++I ++D   ++ I +             
Sbjct: 80  SPKPASGAAKPTPAAKPDASAGGLGGLDSGASQITQLDAVGHVHIFTATEQAFGDLAVYH 139

Query: 123 FQKRILVLNG 132
             +  LVL G
Sbjct: 140 MARHELVLTG 149


>gi|332289510|ref|YP_004420362.1| lipopolysaccharide transport periplasmic protein LptA
           [Gallibacterium anatis UMN179]
 gi|330432406|gb|AEC17465.1| lipopolysaccharide transport periplasmic protein LptA
           [Gallibacterium anatis UMN179]
          Length = 172

 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 63/170 (37%), Gaps = 14/170 (8%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +   F LL   +S +A            + I+I++D   +        F  NV +TQ   
Sbjct: 6   INFAFALLALFVSYSA----NALTGDSEQPINIESDNQSLDLTNNVVTFNTNVVITQGSV 61

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIF-----IQSGEIN-VIASNGYVDFQKRIL 128
            + ADK+ I   N      NK   +D           + +G++    A   + D  K  L
Sbjct: 62  KINADKVVITRPNEKEKADNKKETVDAYGKPVKFQQKLDNGKMVYGNADKVHYDLGKEFL 121

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L     D   LK++ +   G  +  ++        G  + +V++I+  +
Sbjct: 122 TL----IDNAQLKQEDSRINGDIITYDVKKQQLKANGNGNSRVKTILIPN 167


>gi|15642522|ref|NP_232155.1| hypothetical protein VC2527 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121727448|ref|ZP_01680576.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147675161|ref|YP_001218023.1| hypothetical protein VC0395_A2107 [Vibrio cholerae O395]
 gi|153217460|ref|ZP_01951190.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153801092|ref|ZP_01955678.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153817998|ref|ZP_01970665.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153822433|ref|ZP_01975100.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153825783|ref|ZP_01978450.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153829789|ref|ZP_01982456.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227082645|ref|YP_002811196.1| hypothetical protein VCM66_2448 [Vibrio cholerae M66-2]
 gi|229507417|ref|ZP_04396922.1| LptA protein [Vibrio cholerae BX 330286]
 gi|229509658|ref|ZP_04399139.1| LptA protein [Vibrio cholerae B33]
 gi|229513451|ref|ZP_04402915.1| LptA protein [Vibrio cholerae TMA 21]
 gi|229516783|ref|ZP_04406229.1| LptA protein [Vibrio cholerae RC9]
 gi|229521592|ref|ZP_04411010.1| LptA protein [Vibrio cholerae TM 11079-80]
 gi|229524509|ref|ZP_04413914.1| LptA protein [Vibrio cholerae bv. albensis VL426]
 gi|229606924|ref|YP_002877572.1| LptA protein [Vibrio cholerae MJ-1236]
 gi|254225920|ref|ZP_04919522.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254291443|ref|ZP_04962235.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|9657110|gb|AAF95668.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121630220|gb|EAX62620.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124113549|gb|EAY32369.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124123325|gb|EAY42068.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|125621546|gb|EAZ49878.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126511433|gb|EAZ74027.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126520076|gb|EAZ77299.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146317044|gb|ABQ21583.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148874707|gb|EDL72842.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149740506|gb|EDM54621.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150422633|gb|EDN14588.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227010533|gb|ACP06745.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014416|gb|ACP10626.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229338090|gb|EEO03107.1| LptA protein [Vibrio cholerae bv. albensis VL426]
 gi|229341186|gb|EEO06190.1| LptA protein [Vibrio cholerae TM 11079-80]
 gi|229345846|gb|EEO10818.1| LptA protein [Vibrio cholerae RC9]
 gi|229349328|gb|EEO14284.1| LptA protein [Vibrio cholerae TMA 21]
 gi|229353132|gb|EEO18071.1| LptA protein [Vibrio cholerae B33]
 gi|229354922|gb|EEO19843.1| LptA protein [Vibrio cholerae BX 330286]
 gi|229369579|gb|ACQ60002.1| LptA protein [Vibrio cholerae MJ-1236]
          Length = 179

 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 56/154 (36%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +      
Sbjct: 29  ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFLGDVKLKQGSININADKLIVI----R 84

Query: 90  RDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              + KI  ++   N+   S        +   A   Y   +   LV+     +K +L + 
Sbjct: 85  NAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYKVRDDELVM----INKAMLSQD 140

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I             +V ++++ 
Sbjct: 141 DSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 174


>gi|303252579|ref|ZP_07338742.1| hypothetical protein APP2_1557 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247331|ref|ZP_07529379.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648547|gb|EFL78740.1| hypothetical protein APP2_1557 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306856175|gb|EFM88330.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 167

 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 51/143 (35%), Gaps = 4/143 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   ++ I+I +    +        F  NV +TQ    + ADK+TI      ++    
Sbjct: 22  ALKGDTDQPINIDSGSQSLDMNSNVVTFSDNVVITQGSIKVTADKVTIIRQEGKKETLEA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                  +        +N  +++ + D     L L G+      LK++ +     K+  +
Sbjct: 82  SGSPVTFQQTLDNGKPVNGKSNSVHYDLNSEFLTLVGNAE----LKQQGSFIKASKITYD 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +             +V++I+  +
Sbjct: 138 VKKQQLKANSGNKSRVKTILIPN 160


>gi|59710996|ref|YP_203772.1| ABC transporter periplasmic-binding protein [Vibrio fischeri ES114]
 gi|59479097|gb|AAW84884.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Vibrio fischeri ES114]
          Length = 165

 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 61/169 (36%), Gaps = 13/169 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  ++L+  LL +  S A +S          + IHI ++         +  F GNV + Q
Sbjct: 3   LSHVSLLASLLFSASSWALSS-------DTEQPIHINSNSQNFDMQSNQVTFTGNVTLKQ 55

Query: 72  EDFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
               + ADK+ +        R+V     +      +      +   A+    + +   L 
Sbjct: 56  GSIEIFADKIVVIRPQGKEGREVLEAYGKPTRFSQLTDDGKTLKGKANKLRYELENEFLK 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +     D   L +  +   G  +  N+ T      G + D+V +I++  
Sbjct: 116 MT----DSAELTQDDSIIKGKVITYNMKTQKLIADGGKDDRVTTILQPS 160


>gi|237730120|ref|ZP_04560601.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908726|gb|EEH94644.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 182

 Score = 70.0 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 61/167 (36%), Gaps = 10/167 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  VL  + L+ +  +          + IHI++D   +        F GNV +TQ   
Sbjct: 8   LSLNLVLASSLLAASIPAL--AVTGDTEQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 65

Query: 75  SLQADKMTIDYNNTNRDVSNKIN---RMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            + A+K+ +       D    I+          +      +   AS+ + +  K  +VL 
Sbjct: 66  KINANKVVVT-RPGGEDGKEVIDGYGDPATFYQMQDNGKPVKGRASHMHYELAKDFVVLT 124

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G    K  L++  +   G K+   +          +  +V +++   
Sbjct: 125 G----KAYLEQLDSNITGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|16766613|ref|NP_462228.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167552032|ref|ZP_02345785.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167994511|ref|ZP_02575602.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231929|ref|ZP_02656987.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238020|ref|ZP_02663078.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168243154|ref|ZP_02668086.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168262669|ref|ZP_02684642.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168463456|ref|ZP_02697373.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168819612|ref|ZP_02831612.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194444431|ref|YP_002042576.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194450949|ref|YP_002047347.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194468742|ref|ZP_03074726.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737776|ref|YP_002116268.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197248482|ref|YP_002148243.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197262981|ref|ZP_03163055.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242711|ref|YP_002217289.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200388115|ref|ZP_03214727.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204931154|ref|ZP_03221948.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205354219|ref|YP_002228020.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207858566|ref|YP_002245217.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|213021918|ref|ZP_03336365.1| hypothetical protein Salmonelentericaenterica_04022 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213053147|ref|ZP_03346025.1| hypothetical protein Salmoneentericaenterica_09610 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213419715|ref|ZP_03352781.1| hypothetical protein Salmonentericaenterica_18743 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213426639|ref|ZP_03359389.1| hypothetical protein SentesTyphi_14118 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213622832|ref|ZP_03375615.1| hypothetical protein SentesTyp_37147 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213648389|ref|ZP_03378442.1| hypothetical protein SentesTy_14559 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855448|ref|ZP_03383688.1| hypothetical protein SentesT_15920 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289825829|ref|ZP_06544997.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|16421875|gb|AAL22187.1| putative ABC superfamily transport protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|194403094|gb|ACF63316.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194409253|gb|ACF69472.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194455106|gb|EDX43945.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194713278|gb|ACF92499.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195633360|gb|EDX51774.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197212185|gb|ACH49582.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197241236|gb|EDY23856.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289161|gb|EDY28530.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197937227|gb|ACH74560.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199605213|gb|EDZ03758.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204319921|gb|EDZ05127.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205274000|emb|CAR39006.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205323170|gb|EDZ11009.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327638|gb|EDZ14402.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333933|gb|EDZ20697.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337868|gb|EDZ24632.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205343318|gb|EDZ30082.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205348536|gb|EDZ35167.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206710369|emb|CAR34727.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261248483|emb|CBG26320.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995517|gb|ACY90402.1| hypothetical protein STM14_4006 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159867|emb|CBW19386.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914345|dbj|BAJ38319.1| lipopolysaccharide ABC transporter substrate binding protein LptA
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320087763|emb|CBY97527.1| Lipopolysaccharide export system protein lptA Flags: Precursor
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321225259|gb|EFX50318.1| LptA, protein essential for LPS transport across the periplasm
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322615322|gb|EFY12243.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618319|gb|EFY15210.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622876|gb|EFY19720.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322626802|gb|EFY23599.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631371|gb|EFY28131.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322635362|gb|EFY32076.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322643361|gb|EFY39925.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647067|gb|EFY43568.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648870|gb|EFY45315.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322655062|gb|EFY51373.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657665|gb|EFY53933.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322664161|gb|EFY60359.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322667444|gb|EFY63606.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322674692|gb|EFY70784.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322675675|gb|EFY71748.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682311|gb|EFY78334.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322684914|gb|EFY80912.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323195881|gb|EFZ81052.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323198998|gb|EFZ84095.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323204302|gb|EFZ89311.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323207649|gb|EFZ92596.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323211298|gb|EFZ96142.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323214760|gb|EFZ99509.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323221240|gb|EGA05666.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224018|gb|EGA08311.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230332|gb|EGA14451.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233308|gb|EGA17402.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239345|gb|EGA23395.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323242404|gb|EGA26430.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246914|gb|EGA30880.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323254153|gb|EGA37973.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255270|gb|EGA39047.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262733|gb|EGA46289.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264043|gb|EGA47551.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323269429|gb|EGA52884.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326625068|gb|EGE31413.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|332990176|gb|AEF09159.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 184

 Score = 70.0 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 62/166 (37%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  +L  + L+ +  ++         + IHI +D   +        F GNV MTQ   
Sbjct: 8   LSLNLMLAGSLLAASIPAF--AVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   AS+ + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 167


>gi|297537427|ref|YP_003673196.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera sp. 301]
 gi|297256774|gb|ADI28619.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera sp. 301]
          Length = 221

 Score = 70.0 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 75/186 (40%), Gaps = 29/186 (15%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
           HL +  + L   +L        +S+        ++ I ++AD ++V DA Q + + GNV 
Sbjct: 11  HLLMSYVFLSLAMLGY------SSFALAEAADRDKPIDLEADSVKVDDAKQISTYSGNVI 64

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +TQ    ++ADK+ +      R+ S          N    + +      N Y++   + +
Sbjct: 65  LTQGTLIIRADKLIV------REDSAGFQHSTSLGN--PTTFKQKREGKNEYMEGSAQRI 116

Query: 129 VLNGDRADKVIL------KEKLNTFLGCKLIVNIDT-------SFASLQGCES-DQVQSI 174
             +G R DKV L      K   +   G  +  + ++          S+ G  +  +V +I
Sbjct: 117 EYDG-RMDKVQLYTKAWVKRGEDIVHGDYISYDANSEYAEVIGGTKSVDGVTTNGRVHAI 175

Query: 175 IRYDGR 180
           I+   +
Sbjct: 176 IQPKNK 181


>gi|298530339|ref|ZP_07017741.1| OstA family protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509713|gb|EFI33617.1| OstA family protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 176

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 58/154 (37%), Gaps = 12/154 (7%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN--- 89
           Y    +   ++   I +  +  K A     F G+V++ + DF L +DK+ +   +     
Sbjct: 20  YPAGIQAENDKGTEITSRDMTFKGAENLIVFSGDVYVRRPDFELWSDKLYVYLRSDADMD 79

Query: 90  -----RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                    + I ++     + IQ       +          I+ L  D      L E  
Sbjct: 80  ETAPEAGEDDDIEKIVARGQVRIQGEGREGRSGLLTYYPDTEIVELEQDPR----LIEGK 135

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           N+  G K+++N+  + + + G E  +V+ I   D
Sbjct: 136 NSVEGEKIVLNLKDNTSRVYGSEERRVRVIFHSD 169


>gi|317153185|ref|YP_004121233.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943436|gb|ADU62487.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 315

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 58/134 (43%), Gaps = 6/134 (4%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDV 101
            + I +D +   +  +   F GNV     + +L A++++  +   +  +   + I+R+  
Sbjct: 177 PVKITSDRMTYDENGKVVSFVGNVVAVHGELTLWANRLSAFFSSRSGKKFAVDSIDRIVA 236

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           E ++  Q G+            +++IL +  D     ILK+  N+  G  +   +  + +
Sbjct: 237 EGDVRAQKGKTEGSCGKLTYLVEEQILKMEEDP----ILKDGPNSLTGNVINFFVRENRS 292

Query: 162 SLQGCESDQVQSII 175
            +   +  +VQ+I 
Sbjct: 293 EVVSGQGKRVQAIF 306


>gi|156935724|ref|YP_001439640.1| lipopolysaccharide transport periplasmic protein LptA [Cronobacter
           sakazakii ATCC BAA-894]
 gi|156533978|gb|ABU78804.1| hypothetical protein ESA_03593 [Cronobacter sakazakii ATCC BAA-894]
          Length = 185

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 62/168 (36%), Gaps = 12/168 (7%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
           L+L  VL    L+         F + G+  + IHI++D   +        F GNV +TQ 
Sbjct: 8   LSLNLVLTSTLLAAG----FPAFALTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQG 63

Query: 73  DFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
              + ADK+ +        ++V +          +      +   A+  + + Q   +VL
Sbjct: 64  SIKINADKVVVTRPGGEKGKEVIDGYGNPATFYQMQDNGKPVKGHAAKMHYELQNDFVVL 123

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G+      L++  +   G K+   +          +  +V +++   
Sbjct: 124 TGNAY----LEQLDSNIKGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 167


>gi|288819046|ref|YP_003433394.1| hypothetical protein HTH_1749 [Hydrogenobacter thermophilus TK-6]
 gi|288788446|dbj|BAI70193.1| hypothetical protein HTH_1749 [Hydrogenobacter thermophilus TK-6]
 gi|308752629|gb|ADO46112.1| lipopolysaccharide transport periplasmic protein LptA
           [Hydrogenobacter thermophilus TK-6]
          Length = 149

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 53/132 (40%), Gaps = 12/132 (9%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           ++ I  +AD L  +    +  + G+V +++ +  + ADK+ I  +   +       + + 
Sbjct: 16  SQPILGEADSLTYE--KDRIIYTGHVKLSRGNAIITADKVVIYLDENRKA-----KKAEA 68

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           E ++    G     A     DFQ  ++ L G+   +    E  N     +++       A
Sbjct: 69  EGHVKYVEGNRRASADRAEYDFQSDVIKLFGNAKVE----EGKNFVEADQIVYYRKEDRA 124

Query: 162 SLQGCESDQVQS 173
            +   E  +V++
Sbjct: 125 -VAMSEGKRVRT 135


>gi|161506119|ref|YP_001573231.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|160867466|gb|ABX24089.1| hypothetical protein SARI_04307 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 184

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 62/166 (37%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  +L  + L+ +  ++         + IHI +D   +        F GNV MTQ   
Sbjct: 8   LSLNLMLAGSLLAASIPAF--AVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   AS+ + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LEQLDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|261211087|ref|ZP_05925376.1| LptA protein [Vibrio sp. RC341]
 gi|260839588|gb|EEX66199.1| LptA protein [Vibrio sp. RC341]
          Length = 165

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 58/154 (37%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +      
Sbjct: 14  ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFIGDVKLKQGSININADKLIVI----R 69

Query: 90  RDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              + KI  ++   ++   S        +   A+  Y   +   LV+     +K +L + 
Sbjct: 70  NATNGKIEEIEGYGDVATFSQLTDEGKTLYGEANELYYKVRDDELVM----INKAMLSQD 125

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I +           +V ++++ 
Sbjct: 126 DSEIRGRKIRYKISSQKLIADSEGKGRVSTVLQP 159


>gi|54310341|ref|YP_131361.1| hypotetical protein yhbN precursor [Photobacterium profundum SS9]
 gi|46914782|emb|CAG21559.1| hypothetical protein yhbN precursor [Photobacterium profundum SS9]
          Length = 165

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 52/144 (36%), Gaps = 6/144 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + I+I +D  E+        F GNV + Q    ++ADK+ I    T  +  + 
Sbjct: 20  ALSNDTEQPIYIDSDNQELDIQKNIVTFTGNVILRQGSIDIRADKVVI----TRPNGQDG 75

Query: 96  INRMDVERN--IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
              +D       F Q  +         +  +    +      D+ IL ++ +   G  + 
Sbjct: 76  QETIDAYGKPATFHQIMDDGKPIDGASLKMRYETAIDFLKMTDEAILIQEGSEIQGNVIT 135

Query: 154 VNIDTSFASLQGCESDQVQSIIRY 177
             ID      +  ++ +V +I++ 
Sbjct: 136 YKIDEQRLVAESGKTKRVTTILQP 159


>gi|326403863|ref|YP_004283945.1| hypothetical protein ACMV_17160 [Acidiphilium multivorum AIU301]
 gi|325050725|dbj|BAJ81063.1| hypothetical protein ACMV_17160 [Acidiphilium multivorum AIU301]
          Length = 323

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 54/142 (38%), Gaps = 18/142 (12%)

Query: 51  MLEVKDAVQKAFFKGNVFMTQED-FSLQADKMTIDYN-------------NTNRDVSNKI 96
            L+     +KA   G+  +  +D  S+ AD++T  +                +   ++++
Sbjct: 166 ALQYWSEARKAVAIGHAKVLGKDGRSVTADRLTGYFTAAPAAPKAGGTPPAGSTAEASQL 225

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
            ++  E ++ + +        +G       I VL G+    V +    N   G    VN+
Sbjct: 226 RKVVAEGHVVVTTQTDVATGDHGVYHPATGIAVLTGN----VHITHGPNELAGHIAQVNM 281

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
            T  A+L      +V+ +I  D
Sbjct: 282 KTGVATLLSAPGHRVEGLILPD 303



 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 37/130 (28%), Gaps = 24/130 (18%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKA-DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
             +A S            I I A + +      +    KGN    +   ++ AD++   Y
Sbjct: 20  GASAQSLGFGTAGGQPAPIDITAQNGISWNQKTRIVTAKGNARAVRGKVTVTADELVAHY 79

Query: 86  N-----------------------NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           +                             +++I ++D   ++ I +             
Sbjct: 80  SPKPASGAAKPTPAAKPDASAGGLGGLDSGASQITQLDAVGHVHIFTATEQAFGDLAVYH 139

Query: 123 FQKRILVLNG 132
             +  LVL G
Sbjct: 140 MARHELVLTG 149


>gi|325578770|ref|ZP_08148817.1| YhbN like protein [Haemophilus parainfluenzae ATCC 33392]
 gi|301155934|emb|CBW15404.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Haemophilus parainfluenzae T3T1]
 gi|325159594|gb|EGC71726.1| YhbN like protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 172

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 60/164 (36%), Gaps = 14/164 (8%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           +LL   L   + S     K   N+ I+I +D   +        F  NV +TQ    ++A+
Sbjct: 8   ILLLTALMMTSLSAF-ALKDDTNKPINIVSDNQSLDMENSVVTFTDNVVITQGSILIKAN 66

Query: 80  KMTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGD 133
           K+ I       + S K   ++   +             ++  A+  + D     L L G+
Sbjct: 67  KVVIT---RPPENSGKKETVEAFGSPVTFHQQLDDGKPVDGRANKVHYDLGTEFLTLTGN 123

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                 LK+  +   G ++  ++        G    +VQ+++  
Sbjct: 124 AE----LKQLDSKINGERITYDVKKQQLKANGNGKSRVQTVLIP 163


>gi|269467916|gb|EEZ79651.1| hypothetical protein Sup05_0950 [uncultured SUP05 cluster
           bacterium]
          Length = 178

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 58/173 (33%), Gaps = 20/173 (11%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
            +  L  A       +         +E + I ++  E++D    A + G+V +TQ    +
Sbjct: 7   TLLTLTTAAFLSICTTNAVALSTDRDEPLQINSESAEMRDREGYAIYSGSVRLTQGSIEI 66

Query: 77  QADKMTIDYNNTNRDVSN--KINRMDV------ERNIFIQSGEINVIASNGYVDFQKRIL 128
            AD + + +       +     ++         +  + +  G     A+       +  +
Sbjct: 67  DADHIEVFFPEQEITHAVIFGDDKRRAYFQQLPKDGVKLVRG----TANRIIYQADRDEI 122

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
            L GD     I  +  N   G +++ +        +     +VQSI     +P
Sbjct: 123 RLLGDA----IFCQDGNEQKGERIVYDTKKDIMIAKA----RVQSIFLPGKKP 167


>gi|258622781|ref|ZP_05717799.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258625807|ref|ZP_05720686.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258582045|gb|EEW06915.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258584969|gb|EEW09700.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 154

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 58/154 (37%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  N   
Sbjct: 3   ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFLGDVKLKQGSININADKLIVIRNAD- 61

Query: 90  RDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              + KI  ++   N+   S        +   A   Y   +   LV+     +K +L + 
Sbjct: 62  ---NGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYKVRDDELVM----INKAMLSQD 114

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I +           +V ++++ 
Sbjct: 115 DSEIRGSKIRYKISSQKLIADSDGKGRVSTVLQP 148


>gi|296104913|ref|YP_003615059.1| lipopolysaccharide export system protein LptA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295059372|gb|ADF64110.1| lipopolysaccharide export system protein LptA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 184

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 63/166 (37%), Gaps = 8/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  ++  A L+ +  +          + IHI++D   +        F GNV MTQ   
Sbjct: 8   LSLKVIIASAMLAASLPAL--AVTGDTEQPIHIESDTQSLDMQGNVVTFTGNVVMTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        +++ +          +      +   AS+ + +  K +++L G
Sbjct: 66  KINADKVVVTRPGGEQGKEIIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDLVILTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   +          +  +V +++   
Sbjct: 126 NAY----LEQLDSNITGDKITYLVKEQKMQASSEKGKRVTTVLVPS 167


>gi|186972769|pdb|2R19|A Chain A, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Orthorhombic Form
 gi|186972770|pdb|2R19|B Chain B, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Orthorhombic Form
 gi|186972771|pdb|2R1A|A Chain A, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972772|pdb|2R1A|B Chain B, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972773|pdb|2R1A|C Chain C, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972774|pdb|2R1A|D Chain D, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972775|pdb|2R1A|E Chain E, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972776|pdb|2R1A|F Chain F, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972777|pdb|2R1A|G Chain G, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972778|pdb|2R1A|H Chain H, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
          Length = 159

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 53/145 (36%), Gaps = 6/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
                 ++ IHI++D   +        F GNV +TQ    + ADK+ +        ++V 
Sbjct: 1   AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVI 60

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +   +      +      +   AS  + +  K  +VL G+      L++  +   G K+ 
Sbjct: 61  DGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY----LQQVDSNIKGDKIT 116

Query: 154 VNIDTSFASLQGCESDQVQSIIRYD 178
             +          +  +V +++   
Sbjct: 117 YLVKEQKMQAFSDKGKRVTTVLVPS 141


>gi|325982708|ref|YP_004295110.1| lipopolysaccharide transport periplasmic protein LptA [Nitrosomonas
           sp. AL212]
 gi|325532227|gb|ADZ26948.1| lipopolysaccharide transport periplasmic protein LptA [Nitrosomonas
           sp. AL212]
          Length = 176

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 60/176 (34%), Gaps = 30/176 (17%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKD---AVQK--AFFKGNVFMTQEDFSLQADK 80
            S  + S     +    + IH++AD   ++D         + F GNV +TQ    + ADK
Sbjct: 10  WSVCSVSAAWAERADREKPIHLEADRATIEDVNRKEGTRISIFTGNVILTQGTLRINADK 69

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI-------ASNGYVDFQKRILVLNGD 133
           + +      ++ S          N+     + + +       +     D +   + L   
Sbjct: 70  VIM------KEDSQGFRHATATGNLVSFRQKRDRMNEYVEGWSERAEYDSKTEKIEL--- 120

Query: 134 RADKVILKEKLNTFLGCKLIVNID--------TSFASLQGCESDQVQSIIRYDGRP 181
              +  L    +  LG  +  N++        +    ++     +V+  I+   +P
Sbjct: 121 -FRQARLIRGEDEVLGDYISYNMNNEFFQVIGSKERGVETGPDKRVRITIQPKNKP 175


>gi|260596170|ref|YP_003208741.1| lipopolysaccharide export system protein lptA [Cronobacter
           turicensis z3032]
 gi|260215347|emb|CBA27339.1| Lipopolysaccharide export system protein lptA [Cronobacter
           turicensis z3032]
          Length = 167

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 58/152 (38%), Gaps = 8/152 (5%)

Query: 31  ASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID--YN 86
           A+    F + G+  + IHI++D   +        F GNV +TQ    + ADK+ +     
Sbjct: 2   AAGFPAFALTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTRPSG 61

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +  ++V +          +      +   AS  + + Q   +VL G+      L++  + 
Sbjct: 62  DKGKEVIDGYGNPATFYQMQDNGKPVKGHASTMHYELQSDFVVLTGNAY----LEQLDSN 117

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G K+   +          +  +V +++   
Sbjct: 118 IKGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 149


>gi|322514083|ref|ZP_08067154.1| YhbN like protein [Actinobacillus ureae ATCC 25976]
 gi|322120100|gb|EFX92071.1| YhbN like protein [Actinobacillus ureae ATCC 25976]
          Length = 166

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 50/143 (34%), Gaps = 4/143 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   ++ I+I +    +        F  NV +TQ    + A K+TI      ++  + 
Sbjct: 22  ALKGDTDQPINIDSGSQSLDMNSNVVVFTDNVVITQGSIKVTAHKVTITRQEGKKETLDA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                  +        +N   ++ + +     L L G+      LK++ +     K+  +
Sbjct: 82  TGSPVTFQQTLDNGKSVNGKGNSVHYNLNSEFLTLIGNAE----LKQQGSFIKASKITYD 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I             +V++++  +
Sbjct: 138 IKKQQLKANSGNKSRVRTVLIPN 160


>gi|254851070|ref|ZP_05240420.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255744497|ref|ZP_05418449.1| LptA protein [Vibrio cholera CIRS 101]
 gi|262154679|ref|ZP_06028805.1| LptA protein [Vibrio cholerae INDRE 91/1]
 gi|262167555|ref|ZP_06035260.1| LptA protein [Vibrio cholerae RC27]
 gi|297581372|ref|ZP_06943295.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298500645|ref|ZP_07010449.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           cholerae MAK 757]
 gi|254846775|gb|EET25189.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255738022|gb|EET93415.1| LptA protein [Vibrio cholera CIRS 101]
 gi|262024008|gb|EEY42704.1| LptA protein [Vibrio cholerae RC27]
 gi|262030519|gb|EEY49157.1| LptA protein [Vibrio cholerae INDRE 91/1]
 gi|297534210|gb|EFH73048.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297540814|gb|EFH76871.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           cholerae MAK 757]
 gi|327485012|gb|AEA79419.1| LptA, protein essential for LPS transport across the periplasm
           [Vibrio cholerae LMA3894-4]
          Length = 164

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 56/154 (36%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +      
Sbjct: 14  ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFLGDVKLKQGSININADKLIVI----R 69

Query: 90  RDVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              + KI  ++   N+   S        +   A   Y   +   LV+     +K +L + 
Sbjct: 70  NAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYKVRDDELVM----INKAMLSQD 125

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I             +V ++++ 
Sbjct: 126 DSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 159


>gi|261493296|ref|ZP_05989822.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496562|ref|ZP_05992942.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307765|gb|EEY09088.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310940|gb|EEY12117.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 168

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/143 (13%), Positives = 48/143 (33%), Gaps = 4/143 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   ++ I+I +    +        F  NV +TQ    + A  + I      ++  + 
Sbjct: 22  ALKGDTDQPINIDSGSQSLDMTNNIVTFSDNVVITQGSIKVTAANVKITRQEGKKETIDA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                  +        +N   ++ + D     L L G+      LK++ +     K+  +
Sbjct: 82  TGSPVTFQQTLDNGKPVNGKGNSVHYDLNSEFLTLIGNAE----LKQQGSFIKANKITYD 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +             +V++++  +
Sbjct: 138 VKKQQLKATSGGKTRVKTVLIPN 160


>gi|260770980|ref|ZP_05879909.1| LptA protein [Vibrio furnissii CIP 102972]
 gi|260614217|gb|EEX39407.1| LptA protein [Vibrio furnissii CIP 102972]
 gi|315179026|gb|ADT85940.1| hypothetical protein/organic solvent tolerance protein [Vibrio
           furnissii NCTC 11218]
          Length = 163

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 54/151 (35%), Gaps = 14/151 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  +      + K
Sbjct: 20  ALSSDTQQPVYIDSDSQQLDMKSSRVTFVGDVKLKQGSININADKLVVIRDAK----TGK 75

Query: 96  INRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I  ++   N+   S        +   A   +       L + G    + +L +  +   G
Sbjct: 76  IETIEGYGNLTTFSQLTDDGKTLYGEAKELHYKMADDELTMIG----QAMLSQDDSEIRG 131

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            K+   I +         S +V ++++    
Sbjct: 132 SKIRYKISSQKLIADSNGSGRVSTVLQPQAA 162


>gi|254426833|ref|ZP_05040540.1| cell envelope biogenesis protein YhbN, putative [Alcanivorax sp.
           DG881]
 gi|196193002|gb|EDX87961.1| cell envelope biogenesis protein YhbN, putative [Alcanivorax sp.
           DG881]
          Length = 199

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/136 (24%), Positives = 57/136 (41%), Gaps = 12/136 (8%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
              I + AD    +       ++GNV + Q    L AD+M +   N        + R++ 
Sbjct: 30  EGPIQVTADSGRFEQDAGSGLYRGNVELIQGKRKLFADEMRLFTKNG------DLVRVEA 83

Query: 102 ERN-IFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
             + + ++ GE +N  A N   D   R LVL GD   +     + NTF G K+  ++D+ 
Sbjct: 84  TGSPVRMEEGEGLNAHAENLVYDINARTLVLTGDAYIE----HQGNTFEGAKVEYSLDSK 139

Query: 160 FASLQGCESDQVQSII 175
                     +V+ +I
Sbjct: 140 RVDASSEGDQRVRLVI 155


>gi|90580192|ref|ZP_01235999.1| hypothetical protein yhbN precursor [Vibrio angustum S14]
 gi|90438494|gb|EAS63678.1| hypothetical protein yhbN precursor [Vibrio angustum S14]
          Length = 168

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 54/151 (35%), Gaps = 6/151 (3%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
            ++     K    + I+I ++  E+      A F GNV + Q    + ADK+ +   N+N
Sbjct: 15  VSTSSWALKSDTKQPINISSNSQELDVQNNIATFTGNVRLRQGTIDIHADKVVVTRPNSN 74

Query: 90  RDVSNKI--NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                 +          I      I+  A     + +   L +     DK +L +     
Sbjct: 75  AKEQTIVAYGEPATFHQIMDDGKPIDGEALKMRYETKTEFLKMT----DKAVLNQDGTEM 130

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G  +   ID      +  +  +V ++I+ +
Sbjct: 131 KGNVITYKIDEQRLVAKSGDKQRVTTVIQPN 161


>gi|296273482|ref|YP_003656113.1| lipopolysaccharide transport periplasmic protein LptA [Arcobacter
           nitrofigilis DSM 7299]
 gi|296097656|gb|ADG93606.1| lipopolysaccharide transport periplasmic protein LptA [Arcobacter
           nitrofigilis DSM 7299]
          Length = 180

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 57/138 (41%), Gaps = 6/138 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           +EK+ I A   E  D    + F G+V M +    L++D++ +  +    +   +  +   
Sbjct: 16  SEKLIIDAKNFEAYDEKGLSIFTGDVKMVKSSDELESDRLEVYLSKKKPNTKREPLKYIA 75

Query: 102 ERNIFIQSGEINVI----ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             N+  +                 + +K   V+ G+   K + ++K     G K+++N  
Sbjct: 76  TGNVKFKVKTAGKSYEGKGDKVVYEPKKLKYVITGNGFLKEVTEDKR--LFGDKIVINQI 133

Query: 158 TSFASLQGCESDQVQSII 175
           T  A + G E+  V+ II
Sbjct: 134 TGEAKVTGSENKPVRFII 151


>gi|218550483|ref|YP_002384274.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           fergusonii ATCC 35469]
 gi|218358024|emb|CAQ90670.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia fergusonii ATCC 35469]
 gi|324115196|gb|EGC09160.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           fergusonii B253]
 gi|325498781|gb|EGC96640.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           fergusonii ECD227]
          Length = 185

 Score = 68.5 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 51/145 (35%), Gaps = 6/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
                  + IHI++D   +        F GNV +TQ    + ADK+ +        ++V 
Sbjct: 27  AVTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTRPGGEQGKEVI 86

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +          +      +   AS  + +  K  +VL G+      L++  +   G K+ 
Sbjct: 87  DGYGNPATFYQMQDNGKPVEGHASKMHYELAKDFVVLTGNAY----LQQVDSNIKGDKIT 142

Query: 154 VNIDTSFASLQGCESDQVQSIIRYD 178
             +          +  +V +++   
Sbjct: 143 YLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|146313270|ref|YP_001178344.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           sp. 638]
 gi|145320146|gb|ABP62293.1| OstA family protein [Enterobacter sp. 638]
          Length = 157

 Score = 68.5 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 53/144 (36%), Gaps = 6/144 (4%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVSN 94
                 + IHI++D   +        F GNV MTQ    + ADK+ +        +++ +
Sbjct: 1   MTGDTEQPIHIESDTQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIID 60

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      +   AS+ + +  K +++L G+      L++  +   G K+  
Sbjct: 61  GYGNPATFYQMQDNGKPVKGHASHMHYELAKDLVILTGNAY----LEQLDSNITGDKITY 116

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            +          +  +V +++   
Sbjct: 117 LVKEQKMQASSEKGKRVTTVLVPS 140


>gi|291279433|ref|YP_003496268.1| hypothetical protein DEFDS_1042 [Deferribacter desulfuricans SSM1]
 gi|290754135|dbj|BAI80512.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 151

 Score = 68.5 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 59/135 (43%), Gaps = 9/135 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I +  L      + + FKG+V    ++ ++++D M +  +N N+ V     ++    N
Sbjct: 24  VQITSKELSYDVNKKLSIFKGDVNAFYDNTTIKSDLMYVYLDNDNKPV-----KIVCNGN 78

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + I    +  I++N   D +K +L L G+    V + +  N   G K++         ++
Sbjct: 79  VQIVKDNMTSISNNAIFDLKKDVLTLEGN----VKIWQDKNYLEGDKVVYFNKEKRVEVK 134

Query: 165 GCESDQVQSIIRYDG 179
              + +V+ I   + 
Sbjct: 135 NKNNQKVKIIFSPEK 149


>gi|261342645|ref|ZP_05970503.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cancerogenus ATCC 35316]
 gi|288315293|gb|EFC54231.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cancerogenus ATCC 35316]
          Length = 184

 Score = 68.5 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 53/142 (37%), Gaps = 6/142 (4%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVSNKI 96
               + IHI++D   +        F GNV MTQ    + ADK+ +        +++ +  
Sbjct: 30  GDTEQPIHIESDAQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIIDGY 89

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                   +      +   AS+ + +  K +++L G+      L++  +   G K+   +
Sbjct: 90  GNPATFYQMQDNGKPVKGRASHMHYELAKDLVILTGNAY----LEQLDSNITGDKITYLV 145

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
                     +  +V +++   
Sbjct: 146 KEQKMQATSEKGKRVTTVLVPS 167


>gi|197335478|ref|YP_002155146.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           fischeri MJ11]
 gi|197316968|gb|ACH66415.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           fischeri MJ11]
          Length = 165

 Score = 68.5 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 61/169 (36%), Gaps = 13/169 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  ++L+  LL +  S A +S          + IHI ++         +  F G+V + Q
Sbjct: 3   LSHVSLLASLLFSASSWALSS-------DTEQPIHINSNSQNFDMQSNQVTFTGDVTLKQ 55

Query: 72  EDFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
               + ADK+ +        R+V     +      +      +   A+    + +   L 
Sbjct: 56  GSIEIFADKIVVIRPQGKEGREVLEAYGKPTRFSQLTDDGKTLKGKANKLRYELENEFLK 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +     D   L +  +   G  +  N+ T      G + D+V +I++  
Sbjct: 116 MT----DSAELTQDDSIIKGKVITYNMKTQKLIADGGKDDRVTTILQPS 160


>gi|153869737|ref|ZP_01999271.1| OstA-like protein [Beggiatoa sp. PS]
 gi|152073793|gb|EDN70725.1| OstA-like protein [Beggiatoa sp. PS]
          Length = 161

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 43/104 (41%), Gaps = 1/104 (0%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +++         + I I AD  ++ +    A ++GNV ++Q    + A+ +TI Y+  + 
Sbjct: 7   SNHALALSTDREQPIEIAADRAQIDNMKGIAIYEGNVIVSQGSIRIDAETLTIKYSKQHD 66

Query: 91  -DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
            + +  I +    +       +I   A     +  + +L L  +
Sbjct: 67  IEKAIAIGKPAHFKQRLDSGEDIKAKAKEMEYNALENMLNLRIN 110


>gi|253991151|ref|YP_003042507.1| lipopolysaccharide transport periplasmic protein LptA [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782601|emb|CAQ85765.1| protein yhbn precursor probable transporter [Photorhabdus
           asymbiotica]
          Length = 177

 Score = 68.1 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 58/173 (33%), Gaps = 23/173 (13%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             + + +F +    L+          K    + I+I +D   +      A F  NV + Q
Sbjct: 8   AFIASAIFAISLPALA---------LKDDTQKPIYIDSDKQALDMTGNTATFTENVIVKQ 58

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQK 125
               + ADK+ +    T  +  +K   ++   N             I    +    +  K
Sbjct: 59  GSIDIHADKVIV----TRPNGDSKKMIVEAFGNPVTFYQLQDNGKPIKGRGAKMRYEMDK 114

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++ L G+      L++  +   G ++   + T        +  +V +++   
Sbjct: 115 ELVTLTGNAY----LEQLDSNIKGDRITYLVPTQQMEAFSDKGKRVTTVLLPS 163


>gi|281356233|ref|ZP_06242726.1| OstA family protein [Victivallis vadensis ATCC BAA-548]
 gi|281317602|gb|EFB01623.1| OstA family protein [Victivallis vadensis ATCC BAA-548]
          Length = 861

 Score = 68.1 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/159 (15%), Positives = 56/159 (35%), Gaps = 25/159 (15%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN---------------TNRDV 92
            +D + +     +    GNV + +E+  +  D+MTI  +                   D 
Sbjct: 191 TSDSMLIDMNNNQILLIGNVRVDEENSGVDCDRMTIFIDRRSDQELAGANRTAPVNAEDT 250

Query: 93  SNKINRMDVERNIFIQS---------GEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              ++R+  + N+ +           G+    A +   D +   + L G+      +   
Sbjct: 251 LEGVSRILCDGNVVVSRKLTAEEAKEGDQKAFADHMVYDVKTASVTLTGEEKKNPRVIRG 310

Query: 144 LNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRYDGRP 181
             +  G ++++  +   A++ G CE   +Q       +P
Sbjct: 311 QESLTGQRIVMFREEQRATVTGDCEILVIQEPENPGDKP 349



 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/146 (12%), Positives = 48/146 (32%), Gaps = 35/146 (23%)

Query: 41  GNEK--IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID-------------- 84
           G++   + + +D+ ++      + F GNV + +   +L+ DKM +               
Sbjct: 346 GDKPGVMKVNSDIAQMDYRNNYSDFIGNVKVDEPRMTLECDKMRVTLRELAGGPAVESVG 405

Query: 85  --------YNNTNRDVSNKINRMDVERNIFIQSG--------EINVIASNGYVDFQKRIL 128
                    +        +++++     + +           +    AS    ++  R +
Sbjct: 406 DTASLSGLPDFGTTGGKRELDKIKCSGRVKMVRKDDAGKLMPDQKAEASFADFNYADRTV 465

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIV 154
            + G       L   L    G +L++
Sbjct: 466 RMYGGEPK---LTRGLEEMSGRELLI 488



 Score = 39.2 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 28/76 (36%), Gaps = 5/76 (6%)

Query: 95  KINRMDVERNIFIQSGE-----INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           +++R+   +++ +                       + +++ GD  +K  +        G
Sbjct: 771 ELSRILCLKDVELTRRTKTGEVQRAGGQKADYVVADKKIIMTGDDREKPWMSASGGRLKG 830

Query: 150 CKLIVNIDTSFASLQG 165
            ++IV +D+    + G
Sbjct: 831 KRIIVYVDSERMEVDG 846


>gi|146305907|ref|YP_001186372.1| OstA family protein [Pseudomonas mendocina ymp]
 gi|145574108|gb|ABP83640.1| OstA family protein [Pseudomonas mendocina ymp]
          Length = 181

 Score = 67.7 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 66/176 (37%), Gaps = 22/176 (12%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           + + L A L  A+A  +       N+ I I+AD  E+ D    A ++G+V +TQ    + 
Sbjct: 9   LILALGAALGSASAWALPS---DRNQPIRIQADSAELDDKQGVAVYRGDVIITQGTLKIT 65

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
            D +TI      +  S  I+      N  +   E         V    R +         
Sbjct: 66  GDTVTIT-----QTASGDIDVFTSVGN--LAYYEQKPAVDKEIVKAYGRTIQYFASNERI 118

Query: 138 VILKEK-----LNTFLGCKLIVN-----IDTSFASLQ--GCESDQVQSIIRYDGRP 181
           V++ +       NTF G K++ +     ++   A+         ++  +I+   +P
Sbjct: 119 VLIDQAKVIQEGNTFEGEKIVYDTRRQIVNAGRATGGNVSTPRPRIDMVIQPKNKP 174


>gi|242241053|ref|YP_002989234.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech703]
 gi|242133110|gb|ACS87412.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech703]
          Length = 202

 Score = 67.7 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 58/164 (35%), Gaps = 14/164 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A    A +          ++ IHI +D   +        F GNV +TQ    +QADK
Sbjct: 13  ILVASALFAVSLPALALTGDTDQPIHIDSDQQALDMQSNVVTFTGNVIVTQGSIKVQADK 72

Query: 81  MTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +    T  +       ++   N      +      +   A     +  K++++L G+ 
Sbjct: 73  VVV----TRPNGQQGHEIIEGYGNPATFYQMQDNGKPVKGHAQKMRYELDKQLVILTGNA 128

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L++  +   G ++   +          +  +V +++   
Sbjct: 129 Y----LEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVPS 168


>gi|262369716|ref|ZP_06063044.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315784|gb|EEY96823.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 197

 Score = 67.7 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 60/172 (34%), Gaps = 22/172 (12%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
            L   L  A +++        ++ I + AD     +      + GNV + Q    LQAD 
Sbjct: 26  TLALSLGVAVSTFALALPSDRSKAISLVADRATFNEKTGVTTYTGNVIIEQGTMKLQADS 85

Query: 81  MTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILVLNGD 133
           +       N + + +I+ +            +    G     A     + +  I+ L+G 
Sbjct: 86  IV-----ANLNQTRQISTITANGKPARFQQQVSTNKGIAKGQAQKIIYNAETGIITLSG- 139

Query: 134 RADKVILKEKLNTFLGCKLIVNIDT------SFASLQGCESDQVQSIIRYDG 179
                +L++   +  G  L  +++          +  G  S +VQ +I   G
Sbjct: 140 ---SALLEQDGASIRGNTLRYSMNKGDIEAIGTPNSSGSSSGRVQIVIPPSG 188


>gi|295097687|emb|CBK86777.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 184

 Score = 67.7 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 53/142 (37%), Gaps = 6/142 (4%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVSNKI 96
               + IHI++D   +        F GNV MTQ    + ADK+ +        +++ +  
Sbjct: 30  GDTEQPIHIESDTQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIIDGY 89

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                   +      +   AS+ + +  K +++L G+      L++  +   G K+   +
Sbjct: 90  GNPATFYQMQDNGKPVKGHASHMHYELAKDLVILTGNAY----LEQLDSNIKGDKITYLV 145

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
                     +  +V +++   
Sbjct: 146 KEQKMQASSEKGKRVTTVLVPS 167


>gi|294787870|ref|ZP_06753114.1| lipopolysaccharide transport periplasmic protein LptA [Simonsiella
           muelleri ATCC 29453]
 gi|294484163|gb|EFG31846.1| lipopolysaccharide transport periplasmic protein LptA [Simonsiella
           muelleri ATCC 29453]
          Length = 177

 Score = 67.7 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 53/152 (34%), Gaps = 13/152 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +   N+ I I+AD   +    Q   F GNV + Q   + + + + +  ++    +   
Sbjct: 23  ALESDRNQPISIEADQGSLDQKNQVTVFTGNVVIKQGSLNFRGNAVRVAQDSKGNQLIQG 82

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                         G +    +    D    ++ L G+     ++K   +   G  +  N
Sbjct: 83  EGNPVHFGQQLENKGYVEGSGNQVEYDSATGLVKLFGNA----MVKRGGDVARGAAITYN 138

Query: 156 IDTSFASL---------QGCESDQVQSIIRYD 178
           + T   ++          G ++ +V  II+ +
Sbjct: 139 MRTEVYTVMGSKMTGISSGTKNGRVSVIIQPN 170


>gi|260549528|ref|ZP_05823746.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter sp. RUH2624]
 gi|260407321|gb|EEX00796.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter sp. RUH2624]
          Length = 182

 Score = 67.3 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 61/169 (36%), Gaps = 18/169 (10%)

Query: 19  FVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           F+   A ++  A S  + F +    N++I + AD     D      + GNV + Q    L
Sbjct: 13  FLKQAAVITFVALSSASTFALPSDRNQQISLVADRATYNDKTGLTTYTGNVVIEQGTMKL 72

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILV 129
           QAD +       N +   +I  +  +         I    G           +    I+ 
Sbjct: 73  QADSIV-----ANLNSKREIQVITAKGRPAKFQQQINANKGVARGEGQTIVYNADTGIIT 127

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L+G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 128 LSGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|218710675|ref|YP_002418296.1| hypothetical protein VS_2755 [Vibrio splendidus LGP32]
 gi|218323694|emb|CAV20030.1| hypothetical protein VS_2755 [Vibrio splendidus LGP32]
          Length = 175

 Score = 67.3 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 53/148 (35%), Gaps = 14/148 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + ++I +D  ++     +  F G+V + Q   ++ ADK+ +    T   V+ +
Sbjct: 31  ALSSDSEQPVYIDSDSQQLDMKSNQVTFLGDVNLKQGSININADKVIV----TRNAVNGE 86

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I  +           +      +   A + +       L++        +L +  +   G
Sbjct: 87  IEEIQGFGKPATFSQLTDDGKTLYGEADDLHYQLIADRLIMT----KNAMLSQDGSIIRG 142

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
            K+   I +         S++V ++++ 
Sbjct: 143 SKITYQITSQKLVADSDSSERVSTVLQP 170


>gi|88811871|ref|ZP_01127124.1| OstA-like protein [Nitrococcus mobilis Nb-231]
 gi|88790755|gb|EAR21869.1| OstA-like protein [Nitrococcus mobilis Nb-231]
          Length = 189

 Score = 67.3 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 63/158 (39%), Gaps = 15/158 (9%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S  T      ++ I + A+  E+ +    + ++G+V +TQ    +  + M I Y      
Sbjct: 30  SSSTARDSDRDQPIKLSANQAEIDNVKGVSVYRGDVVLTQGTLRITGEIMHIYYAPD--- 86

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL--NGDRADKVI----LKEKLN 145
            S  ++ + VE +    S        + YV  +   +     G R  +++    L +  N
Sbjct: 87  -SRALDHIIVEGD--PASYRELPEGESEYVHAKAPRMEYYETGPRRIRLLQGATLWQGSN 143

Query: 146 TFLGCKLIVNIDTSFASLQG--CESDQVQSIIRYDGRP 181
           TF G +++ +I+           ++ ++   I Y  RP
Sbjct: 144 TFRGNQVVYDIEADQVEAHSGKDKTKRIHITI-YPNRP 180


>gi|254490069|ref|ZP_05103262.1| cell envelope biogenesis protein YhbN, putative [Methylophaga
           thiooxidans DMS010]
 gi|224464733|gb|EEF80989.1| cell envelope biogenesis protein YhbN, putative [Methylophaga
           thiooxydans DMS010]
          Length = 269

 Score = 67.3 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 65/181 (35%), Gaps = 32/181 (17%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L  V +L+   L  A  S          + I+I+AD  ++ D      +KG+  +TQ   
Sbjct: 7   LITVLLLMLPSLVWALPS-------DREQPINIEADHAQLDDREGVTQYKGDAILTQGTL 59

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIF-------IQSGEINVIASNGYVDFQKRI 127
            ++ D +T  Y+        +I +M  +  +             +   A        ++ 
Sbjct: 60  RIEGDIITFYYDENK-----QIEKMVAQGKLATYKQVHKPGEAPVRAKALQMEYFAGRQK 114

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL---------QGCESDQVQSIIRYD 178
           + L G       + +  + F G ++  +I+ +  +          +  E  +V  II+  
Sbjct: 115 IYLIGQG----HVWQSGDEFTGNRIEYDIERNVVTANSAPVSVGGEKQEKGRVHIIIQPP 170

Query: 179 G 179
           G
Sbjct: 171 G 171


>gi|148977772|ref|ZP_01814328.1| hypothetical protein VSWAT3_21295 [Vibrionales bacterium SWAT-3]
 gi|145962986|gb|EDK28256.1| hypothetical protein VSWAT3_21295 [Vibrionales bacterium SWAT-3]
          Length = 164

 Score = 67.3 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 56/154 (36%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           AA  +        + ++I +D  ++     +  F G+V + Q   ++ ADK+ +    T 
Sbjct: 14  AAPNVYALSSDSEQPVYIDSDSQQLDMKSNQVTFIGDVNLKQGSININADKVIV----TR 69

Query: 90  RDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
             V+ +I  +           +      +   A + +       L++        +L + 
Sbjct: 70  NAVNGEIEEIQGFGKPATFSQLTDDGKTLYGEADDLHYQLVADKLIMT----KNAMLSQD 125

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I +        E+ +V ++++ 
Sbjct: 126 GSIIRGSKITYQIGSQKLVADSGENKRVSTVLQP 159


>gi|332978296|gb|EGK15024.1| OstA family protein [Psychrobacter sp. 1501(2011)]
          Length = 200

 Score = 67.3 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 52/166 (31%), Gaps = 6/166 (3%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L  V +   A ++   + Y         + I + AD     +      + GNV +TQ   
Sbjct: 30  LPRVALCATAVIASMTSFYANALPSDAQQPIRLLADKATYSERTGVTSYSGNVTITQGTL 89

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIAS--NGYVDFQKRILVLNG 132
            L AD +T++ +      S             +   +            + Q  I+ L G
Sbjct: 90  KLAADNITVNLSEGRSINSAVATGRPATMQQVVTKEKGLARGQANKIDYNAQNGIVTLTG 149

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L +   +F G  +  ++           S +V+ I    
Sbjct: 150 NAK----LTQNGASFAGNVIRYSLKVGDVEATSGGSQRVELIFPPS 191


>gi|294634658|ref|ZP_06713191.1| lipopolysaccharide transport periplasmic protein LptA [Edwardsiella
           tarda ATCC 23685]
 gi|291091904|gb|EFE24465.1| lipopolysaccharide transport periplasmic protein LptA [Edwardsiella
           tarda ATCC 23685]
          Length = 185

 Score = 67.3 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 61/173 (35%), Gaps = 15/173 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
              L L  ++L A L  A+AS +       ++ IHI +    +      A F G+V +TQ
Sbjct: 5   ASTLKLRDLILAASLLTASASAL-AVTGDTDQPIHINSMQQSLDMQGNVATFTGDVIVTQ 63

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQK 125
               + ADK+ +    T  +       ++   N             +   +     +  K
Sbjct: 64  GTIKITADKVVV----TRPNGEQGKEIVEAYGNPVTFYQMQDNGKPVEGHSQKLRYELAK 119

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             ++L G+     +L +  +   G ++   +          +  +V +++   
Sbjct: 120 DYVILTGNA----VLTQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTTVLLPS 168


>gi|152978601|ref|YP_001344230.1| cell envelope biogenesis YhbN [Actinobacillus succinogenes 130Z]
 gi|150840324|gb|ABR74295.1| Cell envelope biogenesis YhbN [Actinobacillus succinogenes 130Z]
          Length = 170

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 27/163 (16%), Positives = 59/163 (36%), Gaps = 13/163 (7%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A +    +  +   K   ++ I+I +   E+        F  NV +TQ    ++A+K
Sbjct: 7   ILLAAVLLMTSLSVAALKGDTDKPINIDSGNQELDMENSVVTFTDNVVITQGSILIKANK 66

Query: 81  MTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + I       + S K   +D   +      +       +  A+  + D     L L G+ 
Sbjct: 67  VVIT---RPPENSGKKETVDAYGSPVTFHQMLDDGKPADGKANKVHYDLGTEFLTLTGNA 123

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                LK+  +   G  +  ++        G    +V++++  
Sbjct: 124 E----LKQLDSKINGDVITYDVKKQQLKATGSAKSRVRTVLIP 162


>gi|16762080|ref|NP_457697.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29143569|ref|NP_806911.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56415247|ref|YP_152322.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|161616328|ref|YP_001590293.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|224585115|ref|YP_002638914.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|25352006|pir||AE0905 conserved hypothetical protein STY3497 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504383|emb|CAD07835.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139204|gb|AAO70771.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129504|gb|AAV79010.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161365692|gb|ABX69460.1| hypothetical protein SPAB_04136 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|224469643|gb|ACN47473.1| hypothetical protein SPC_3388 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 172

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 56/160 (35%), Gaps = 7/160 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L   L  A+            + IHI +D   +        F GNV MTQ    + ADK
Sbjct: 1   MLAGSLLAASIPAF-AVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTIKINADK 59

Query: 81  MTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +        ++V +          +      +   AS+ + +  K  +VL G+     
Sbjct: 60  VVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTGNAY--- 116

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G K+   +          +  +V +++   
Sbjct: 117 -LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 155


>gi|149191633|ref|ZP_01869877.1| organic solvent tolerance protein [Vibrio shilonii AK1]
 gi|148834533|gb|EDL51526.1| organic solvent tolerance protein [Vibrio shilonii AK1]
          Length = 772

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 56/157 (35%), Gaps = 21/157 (13%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
               +      +  +  +       E I+I+AD LE      +A +KG+V + Q + ++ 
Sbjct: 31  SGQTMPPAEQCSVDTAQSSD--SNQEPINIEADSLEAISGQ-RATYKGDVVVVQGNKTIT 87

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           AD +T+               +  E N+ +  GEI  ++     +  K  + L  +   +
Sbjct: 88  ADNVTLHQKENI---------VVAEGNVVMNDGEIRAVSDKATNNLNKDEITLE-NTQYQ 137

Query: 138 VILK--EKLNTF---LGCKLIVNIDTSFASLQGCESD 169
            +         F    G KL   I+    S+  C   
Sbjct: 138 FLCTPGRGDAVFVSKTGKKL-YEIEDG--SITSCPEG 171


>gi|146281419|ref|YP_001171572.1| OstA family protein [Pseudomonas stutzeri A1501]
 gi|145569624|gb|ABP78730.1| OstA family protein [Pseudomonas stutzeri A1501]
          Length = 181

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 69/187 (36%), Gaps = 24/187 (12%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           + + ++ L + L A    +    L +              + I ++AD  E+ D    A 
Sbjct: 2   SCVKTLPLLLGLSAFWLGVSAWALPE-----------DREQPIRVQADSAELDDRQGVAV 50

Query: 63  FKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGY 120
           ++G+V +TQ    +  D +TI  + N + +V   I +            EI         
Sbjct: 51  YRGDVVITQGTMKITGDTVTITQDSNGDVEVFTSIGKPAYYEQKPAVDKEIVKAYGLTIQ 110

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN-----IDTSFASLQ--GCESDQVQS 173
                  +VL      KV+  ++ NTF G K++ +     ++   A+         +V  
Sbjct: 111 YFAANERIVLL--DQAKVV--QEGNTFEGEKIVYDTRRQIVNAGRATNTDVSTPRPRVDM 166

Query: 174 IIRYDGR 180
           +I+   R
Sbjct: 167 VIQPRKR 173


>gi|108757302|ref|YP_629320.1| hypothetical protein MXAN_1059 [Myxococcus xanthus DK 1622]
 gi|108461182|gb|ABF86367.1| hypothetical protein MXAN_1059 [Myxococcus xanthus DK 1622]
          Length = 208

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 49/152 (32%), Gaps = 20/152 (13%)

Query: 20  VLLKADLSQAAASYMTRFKVLG-------NEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
               A +  +A S  T  +  G        E + I  D +  +    +A   GNV +   
Sbjct: 25  GTPPAAVGGSAPSAGTGTRAPGPLGGKELTEPVQINGDNVTFQ--KSQATLTGNVKVKHR 82

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
              L+ D+MT +Y         ++ R+     +    G+          D    +LV+ G
Sbjct: 83  TLDLKCDRMTANYTP-----QREVTRVVCTGGVHAVDGDRMAKGERAEYDVPSGVLVVTG 137

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
                   ++      G K  V +      L+
Sbjct: 138 SPEA----RQGTTHMRGTK--VRLTLGNERLE 163


>gi|90413001|ref|ZP_01220999.1| hypothetical protein yhbN precursor [Photobacterium profundum 3TCK]
 gi|90326016|gb|EAS42455.1| hypothetical protein yhbN precursor [Photobacterium profundum 3TCK]
          Length = 167

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 50/144 (34%), Gaps = 6/144 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + I+I +D  E+        F GNV + Q    ++ADK+ I    T  +  + 
Sbjct: 20  ALSNDTEQPIYIDSDNQELDIQKNIVTFTGNVILRQGSIDIRADKVVI----TRPNGQDG 75

Query: 96  INRMDVERN--IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
              +D       F Q  +         +  +    +      D+ IL ++ +   G  + 
Sbjct: 76  QETIDAYGKPATFHQIMDDGKPIDGASLKMRYETAIDFLKMTDEAILIQEGSEIQGKVIT 135

Query: 154 VNIDTSFASLQGCESDQVQSIIRY 177
             ID      +     +V +I++ 
Sbjct: 136 YKIDEQRLVAESGNKKRVTTILQP 159


>gi|310818883|ref|YP_003951241.1| hypothetical protein STAUR_1610 [Stigmatella aurantiaca DW4/3-1]
 gi|309391955|gb|ADO69414.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 172

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 43/122 (35%), Gaps = 11/122 (9%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + + I A +  V        F GNV +      L+  KMT  Y       S ++ R++  
Sbjct: 38  DPVEITAGL--VTGGRDSTTFTGNVKVKHRTMDLRCQKMTAFYT-----SSREVTRVECT 90

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +  Q G+          +    +LV+ G        ++      G K+ + + +    
Sbjct: 91  GGVEAQDGDRYARGDRAEYNVSSGVLVVTGSPEA----RQGATYMTGTKVRLTLGSERVE 146

Query: 163 LQ 164
           ++
Sbjct: 147 VE 148


>gi|86147578|ref|ZP_01065888.1| hypothetical protein MED222_22853 [Vibrio sp. MED222]
 gi|85834617|gb|EAQ52765.1| hypothetical protein MED222_22853 [Vibrio sp. MED222]
          Length = 164

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 53/148 (35%), Gaps = 14/148 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + ++I +D  ++     +  F G+V + Q   ++ ADK+ +    T   V+ +
Sbjct: 20  ALSSDSEQPVYIDSDSQQLDMKSNQVTFLGDVNLKQGSININADKVIV----TRNAVNGE 75

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I  +           +      +   A + +       L++        +L +  +   G
Sbjct: 76  IEEIQGFGKPATFSQLTDDGKTLYGEADDLHYQLIADRLIMT----KNAMLSQDGSIIRG 131

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
            K+   I +         S++V ++++ 
Sbjct: 132 SKITYQITSQKLVADSDSSERVSTVLQP 159


>gi|293608599|ref|ZP_06690902.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829172|gb|EFF87534.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325121587|gb|ADY81110.1| conserved hypothetical protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 182

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 59/169 (34%), Gaps = 18/169 (10%)

Query: 19  FVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           F+   A ++  A S  + F +    N++I + AD     +      + GNV + Q    L
Sbjct: 13  FLKQAAVITFVALSSASTFALPSDRNQQISLVADRATYNEKTGLTTYTGNVVIEQGTMKL 72

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILV 129
           QAD +         +   +I  +  +         I    G           +    I+ 
Sbjct: 73  QADSIV-----ATLNSKREIQTITAKGRPSKFQQQISADKGVARGEGQTIVYNADTGIIT 127

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 128 LTGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|307824374|ref|ZP_07654600.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylobacter tundripaludum SV96]
 gi|307734754|gb|EFO05605.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylobacter tundripaludum SV96]
          Length = 184

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 57/154 (37%), Gaps = 19/154 (12%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +  G++ I I ++     D    + + GNV   Q    + +DK+ + + +   D    
Sbjct: 31  ALESDGDQPIIIDSNTATYDDVKATSTYTGNVISIQGSIRVNSDKLVVYFIDGEAD---- 86

Query: 96  INRMDVERNI-----FIQSGEINVIAS--NGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
             +M    N+         G+ ++      G    +K +L+L     DK  + +    + 
Sbjct: 87  --KMVFTGNLAKFKQTPNEGDQDITGEALTGEYYPKKNLLIL----IDKATVWQGSGAYS 140

Query: 149 GCKLIVNIDTS--FASLQGCESDQVQSIIRYDGR 180
              +  ++ TS   A  +     +V  +++   +
Sbjct: 141 SDLIEYDLKTSLVKAGEKESAGKRVHVVLQPKAK 174


>gi|169633848|ref|YP_001707584.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii SDF]
 gi|169796519|ref|YP_001714312.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AYE]
 gi|260557955|ref|ZP_05830167.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii ATCC 19606]
 gi|169149446|emb|CAM87332.1| putative lipopolysaccharide transport protein A (ABC superfamily,
           peri_bind) (LptA) [Acinetobacter baumannii AYE]
 gi|169152640|emb|CAP01635.2| putative lipopolysaccharide transport protein A (ABC superfamily,
           peri_bind) (LptA) [Acinetobacter baumannii]
 gi|260408465|gb|EEX01771.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii ATCC 19606]
          Length = 194

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 60/169 (35%), Gaps = 18/169 (10%)

Query: 19  FVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           F+   A ++  A S  + F +    N++I + AD     +      + GNV + Q    L
Sbjct: 25  FLKQAAVITFVALSSASTFALPSDRNQQISLVADRATYNEKTGLTTYTGNVVIEQGTMKL 84

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILV 129
           QAD +         +   +I  +  +         I    G           +    I+ 
Sbjct: 85  QADSIV-----ATLNSKREIQTITAKGRPSKFQQQISADKGIARGEGQTIVYNADTGIIT 139

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L+G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 140 LSGGAY----LYQDGSSIRGNTLKYSMNKGDVEAQGSSSNRVQIIIPPS 184


>gi|298369555|ref|ZP_06980872.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298282112|gb|EFI23600.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 174

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 60/153 (39%), Gaps = 14/153 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD-VSN 94
             +    + I I+AD   +  A Q   F GNV + Q   +L+A  + +  N+     ++ 
Sbjct: 21  ALQSDSKQPIQIEADQGSLDQAKQVTHFSGNVIIKQGTLNLRAANVRVSRNDKGEQFMAA 80

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
             + +   + +    G +N  A+N        I+ L G+      ++   +   G  +  
Sbjct: 81  DGSPVKFSQTLDDNQGVVNGQANNAEYSSATGIVKLTGNAK----VQRGGDVAQGAVITY 136

Query: 155 NIDT--------SFASLQ-GCESDQVQSIIRYD 178
           N+ T          +S + G +S +V  +I+  
Sbjct: 137 NMRTEVYNIIGGGKSSAKAGTKSGRVSVVIQPS 169


>gi|218662089|ref|ZP_03518019.1| hypothetical protein RetlI_22725 [Rhizobium etli IE4771]
          Length = 54

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           D+ +KVIL +  N F GCKL V++ T  A L+ C   +VQ  +    +P
Sbjct: 1   DQGNKVILSDGPNVFTGCKLTVHMQTGRAELESC-GGRVQIQLDPKSQP 48


>gi|262278511|ref|ZP_06056296.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258862|gb|EEY77595.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 194

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 59/182 (32%), Gaps = 23/182 (12%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
             +S         + FV L +  + A  S         +++I + AD     +      +
Sbjct: 19  LKHSSAFLKQAAVITFVALSSASTFALPS-------DRSQQISLVADRATYNEKTGLTTY 71

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIA 116
            GNV + Q    LQAD +         +   +I  +  +         I    G      
Sbjct: 72  TGNVVIEQGTMKLQADSIV-----ATLNSKREIQTITAKGRPSKFQQQISADKGVARGEG 126

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
                +    I+ L G       L +  ++  G  L  +++      QG  S++VQ II 
Sbjct: 127 QTIVYNADTGIITLAGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIP 182

Query: 177 YD 178
             
Sbjct: 183 PS 184


>gi|30248095|ref|NP_840165.1| putative signal peptide protein [Nitrosomonas europaea ATCC 19718]
 gi|30179980|emb|CAD83975.1| putative signal peptide protein [Nitrosomonas europaea ATCC 19718]
          Length = 205

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/195 (16%), Positives = 69/195 (35%), Gaps = 33/195 (16%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK-- 60
           A+ N       L   +       L++         +   ++ IH++AD   V+D  +K  
Sbjct: 19  AWPNRAIFSSFLSLFLIFFSSIVLAE---------RADRDKPIHLEADHATVEDYKRKGE 69

Query: 61  ---AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM----DVERNIFIQSGEIN 113
              + F GNV +TQ    L+ADK+ +  +      +     +         +   +  + 
Sbjct: 70  FRTSIFTGNVVLTQGTLVLRADKVIMKEDAAGYRYATAYGDLVSYRQKRDGV---NEYVE 126

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD---- 169
             +     D +   + L G       LK   +   G  +  +I + F  + G +      
Sbjct: 127 AWSKRAEYDDKTDKIELFGSAR----LKRGADEVEGDYISYDIASDFFQVSGRQQSENDK 182

Query: 170 ----QVQSIIRYDGR 180
               +V+++I+   +
Sbjct: 183 NSDHRVRAVIQPKAK 197


>gi|84387809|ref|ZP_00990824.1| hypothetical protein V12B01_07448 [Vibrio splendidus 12B01]
 gi|84377324|gb|EAP94192.1| hypothetical protein V12B01_07448 [Vibrio splendidus 12B01]
          Length = 164

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 56/154 (36%), Gaps = 14/154 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           AA  +        + ++I +D  ++     +  F G+V + Q   ++ ADK+ +    T 
Sbjct: 14  AAPNVYALSSDSEQPVYIDSDSQQLDMKSNQVTFLGDVNLKQGSININADKVIV----TR 69

Query: 90  RDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
             V+ +I  +           +      +   A + +       L++        +L + 
Sbjct: 70  NAVNGEIEEIQGFGKPATFSQLTDDGKTLYGEADDLHYQLVADKLIMT----KNAMLSQD 125

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   G K+   I +        E+ +V ++++ 
Sbjct: 126 GSIIRGSKITYQIGSQKLVADSGENKRVSTVLQP 159


>gi|261391880|emb|CAX49339.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           8013]
          Length = 176

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 59/159 (37%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +  N+  
Sbjct: 16  SASPAFALQGDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVTRNDKG 75

Query: 90  RD-VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  EQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAR----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVVIQPS 170


>gi|253997917|ref|YP_003049980.1| lipopolysaccharide transport periplasmic protein LptA [Methylovorus
           sp. SIP3-4]
 gi|313199982|ref|YP_004038640.1| lipopolysaccharide transport periplasmic protein lpta [Methylovorus
           sp. MP688]
 gi|253984596|gb|ACT49453.1| lipopolysaccharide transport periplasmic protein LptA [Methylovorus
           sp. SIP3-4]
 gi|312439298|gb|ADQ83404.1| lipopolysaccharide transport periplasmic protein LptA [Methylovorus
           sp. MP688]
          Length = 185

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 68/159 (42%), Gaps = 21/159 (13%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K   ++ I+++AD + V DA + + + GNV +TQ    ++ DK+ +  +      S    
Sbjct: 24  KADKDKPINLEADAVTVNDAKKTSIYTGNVILTQGTLIIRGDKLVVREDKEGFQHSTTYG 83

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL------KEKLNTFLGCK 151
                      + +  +   N Y++   + +  +G R DKV L      K+  +   G  
Sbjct: 84  -----NPQTPSTFKQKMEGKNEYMEGSGQRIEYDG-RMDKVQLYTKAWVKKGDDIVHGDY 137

Query: 152 LIVNIDTSFASLQGCES---------DQVQSIIRYDGRP 181
           ++ + +  +A + G  S          +V+++I+   +P
Sbjct: 138 IMYDANAEYAEVIGGGSQAATPATPTGRVRAVIQPKKKP 176


>gi|110833415|ref|YP_692274.1| hypothetical protein ABO_0554 [Alcanivorax borkumensis SK2]
 gi|110646526|emb|CAL16002.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 199

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 20/163 (12%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA++ +L+   L   AA             I + AD    + +     + GNV + Q   
Sbjct: 13  LAVLALLIAFPLGVQAAPMEGT--------IQVTADNGRFEQSAGSGVYSGNVELIQGKR 64

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVER-NIFIQSGE-INVIASNGYVDFQKRILVLNG 132
            L AD+M +         ++++ R++     + ++ GE +N  A N   + + R LVL G
Sbjct: 65  KLFADEMRMF------TQNSELVRVEATGTPVRMEEGEGLNAHAENLVYNIKARTLVLTG 118

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           D   +     + NTF G K+  ++D+           +V+ +I
Sbjct: 119 DAYIE----HQGNTFEGAKVEYSLDSKRVDASSEGDQRVRLVI 157


>gi|167855015|ref|ZP_02477789.1| hypothetical protein HPS_10230 [Haemophilus parasuis 29755]
 gi|219870361|ref|YP_002474736.1| hypothetical protein HAPS_0084 [Haemophilus parasuis SH0165]
 gi|167853863|gb|EDS25103.1| hypothetical protein HPS_10230 [Haemophilus parasuis 29755]
 gi|219690565|gb|ACL31788.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 167

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 54/143 (37%), Gaps = 4/143 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +   N  I I +    +        F  NV +TQ    L A+K+TI   +T +++   
Sbjct: 22  ALETDRNMPIKIDSGSQSLDIERNIVTFSDNVVITQGSIKLNAEKVTIIRRDTQKELIEA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                V +        +N  A++ + D     L+L G+      LK+  +     K+  +
Sbjct: 82  FGTPVVFQQTLDNGKIVNGTANSVHYDLDSEFLILRGNAE----LKQLDSAIKAEKITYD 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V++++  +
Sbjct: 138 VKKQNLKATSNDRQRVKTVLIPN 160


>gi|114332261|ref|YP_748483.1| OstA family protein [Nitrosomonas eutropha C91]
 gi|114309275|gb|ABI60518.1| OstA family protein [Nitrosomonas eutropha C91]
          Length = 183

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 60/163 (36%), Gaps = 30/163 (18%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQK-----AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
           +   ++ IH++AD   V+D  QK     + F GNV +TQ    L+ADK+ +      ++ 
Sbjct: 23  RADRDKPIHLEADRATVEDYKQKGEFRTSIFTGNVILTQGTLILRADKVVM------KED 76

Query: 93  SNKINRMDVERNIFIQSGEI-------NVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           S          N+     +           +     D +   + L G       LK   +
Sbjct: 77  STGYRHATAYGNLVSYRQKRDGVDEYVEAWSRRAEYDNKTDKIELFGSAR----LKRGTD 132

Query: 146 TFLGCKLIVNIDT------SFASLQGCESD--QVQSIIRYDGR 180
              G  +  +I +           +  ++   +V+++I+   +
Sbjct: 133 EVEGDYISYDIASDFFQVFGQPQAENDKNSDHRVRAVIQPKAK 175


>gi|255066043|ref|ZP_05317898.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sicca ATCC 29256]
 gi|261365378|ref|ZP_05978261.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           mucosa ATCC 25996]
 gi|255049588|gb|EET45052.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sicca ATCC 29256]
 gi|288566174|gb|EFC87734.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           mucosa ATCC 25996]
          Length = 176

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 58/159 (36%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A +     +    + I I+AD   +    Q   F GNV + Q   +++A  + +  N+  
Sbjct: 16  ATAPAYALQSDSKQPIQIEADQGSLDQNNQSTTFTGNVIIKQGTLNIRAGSVNVSRNDKG 75

Query: 90  RD-VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    + +   + +    G +N  A+N        ++ L G+      ++   +   
Sbjct: 76  EQFMKASGSPVRFSQTLDDNKGTVNGQANNVTYSSAINLVTLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSSKTGAKSAAKSGRVSVVIQPS 170


>gi|115378033|ref|ZP_01465213.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115364972|gb|EAU64027.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 166

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 43/122 (35%), Gaps = 11/122 (9%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + + I A +  V        F GNV +      L+  KMT  Y       S ++ R++  
Sbjct: 32  DPVEITAGL--VTGGRDSTTFTGNVKVKHRTMDLRCQKMTAFYT-----SSREVTRVECT 84

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +  Q G+          +    +LV+ G        ++      G K+ + + +    
Sbjct: 85  GGVEAQDGDRYARGDRAEYNVSSGVLVVTGSPEA----RQGATYMTGTKVRLTLGSERVE 140

Query: 163 LQ 164
           ++
Sbjct: 141 VE 142


>gi|227326632|ref|ZP_03830656.1| hypothetical protein PcarcW_04634 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 182

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 54/164 (32%), Gaps = 14/164 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
            L A    A +          N+ IHI +    +        F GNV + Q    ++ADK
Sbjct: 4   TLIASSLFAVSVSAVALTGDSNQPIHIDSAQQSLDMQGNTVTFTGNVVVKQGTIEVKADK 63

Query: 81  MTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +      +         N +    ++ N     G     A     +  K  LVL G+ 
Sbjct: 64  VVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGH----AQKIRYELAKDFLVLTGNA 119

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L+++ +   G ++   +          +  +V +++   
Sbjct: 120 Y----LEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTVLVPS 159


>gi|309378633|emb|CBX22704.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 171

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 60/160 (37%), Gaps = 10/160 (6%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY- 85
           + +AAS     +    + I I+AD   +    Q   F GNV + Q   ++ A ++ +   
Sbjct: 13  ALSAASPAFALQSDSRQPIQIEADRGSLDQTKQSTTFSGNVVIRQGTLNISASRVNVTRG 72

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
                 V  + + +   + +    G +   A+N         +VL G+      ++   +
Sbjct: 73  GKGGESVRAEGSPVRFSQTLDGGKGTVRGQANNIAYSSAGSTVVLTGNAK----VQRGGD 128

Query: 146 TFLGCKLIVNIDTSFASLQG-----CESDQVQSIIRYDGR 180
              G  +  N  T   ++ G      +S +V  +IR  G 
Sbjct: 129 VVEGAVITYNTQTEVYTVSGGAKSAAKSGRVSVVIRPAGA 168


>gi|296313583|ref|ZP_06863524.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           polysaccharea ATCC 43768]
 gi|296839816|gb|EFH23754.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           polysaccharea ATCC 43768]
          Length = 176

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 59/159 (37%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +  N+  
Sbjct: 16  SASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVTRNDKG 75

Query: 90  RD-VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  EQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  II+  
Sbjct: 132 GAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 170


>gi|325266392|ref|ZP_08133070.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Kingella denitrificans
           ATCC 33394]
 gi|324982185|gb|EGC17819.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Kingella denitrificans
           ATCC 33394]
          Length = 171

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 56/168 (33%), Gaps = 11/168 (6%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
             L A L+  +           N+ I I+AD   +    Q   F GNV + Q    ++A 
Sbjct: 8   AFLAAVLTAGSLQPAHALDSDRNQPISIEADQGSLDQKNQVTVFSGNVQIKQGSLQMKAQ 67

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKV 138
            + +  + +              R       G      +    +  + ++ L G+     
Sbjct: 68  SVRVSQDRSGNQTMLATGSPVYFRQQLDGGKGLAEGWGNRAEYNSAQHLVKLIGNAK--- 124

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGC------ESDQVQSIIRYDGR 180
            ++   +   G  +  N+ T   ++ G          +V+ II+ + +
Sbjct: 125 -VQRGGDLAQGEAISYNMKTEVYTVLGGNAVGNKNGRRVKVIIQPNNK 171


>gi|307129065|ref|YP_003881081.1| periplasmic component of an ABC-type LPS transporter complex
           [Dickeya dadantii 3937]
 gi|306526594|gb|ADM96524.1| periplasmic component of an ABC-type LPS transporter complex
           [Dickeya dadantii 3937]
          Length = 192

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 57/163 (34%), Gaps = 14/163 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A    A +          ++ IHI +D   +        F GNV +TQ     QADK
Sbjct: 13  ILIASSLFAVSVPALALTGDTDQPIHITSDQQALDMQGNVVTFTGNVIVTQGSIKAQADK 72

Query: 81  MTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +    T  +       ++   N      +      +   +     +  K++++L GD 
Sbjct: 73  VVV----TRPNGQQGHEVIEGYGNPATFYQMQDNGKPVKGHSQKMRYEMDKQLVILTGDA 128

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                L++  +   G ++   +          +  +V +++  
Sbjct: 129 Y----LEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVP 167


>gi|304386603|ref|ZP_07368891.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate binding protein [Neisseria
           meningitidis ATCC 13091]
 gi|304339432|gb|EFM05504.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate binding protein [Neisseria
           meningitidis ATCC 13091]
          Length = 176

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 58/159 (36%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +  N   
Sbjct: 16  SASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVTRNGKG 75

Query: 90  RD-VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  EQFMKADGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVVIQPS 170


>gi|256827967|ref|YP_003156695.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfomicrobium baculatum DSM 4028]
 gi|256577143|gb|ACU88279.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfomicrobium baculatum DSM 4028]
          Length = 175

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 67/177 (37%), Gaps = 23/177 (12%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            L+  +F+     L  A  +         +  + I +D +       +  F G+V++ ++
Sbjct: 3   SLILFLFLACATPLWAAQTAPAK------DVPVKITSDTMTYTQKGDQVVFTGSVYVIRQ 56

Query: 73  DFSLQADKMTI---------DYNNTNRDVSNKINRMDVERNIFIQSGEINVIAS--NGYV 121
           D  L +D +T+         +   +  D    I ++  + N+ I+  +     +      
Sbjct: 57  DIQLWSDTLTVLLEKKEGSGNATQSVADEQGSIKKIIAKGNVRIK-ADQGRTGTCGKATY 115

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  K +L +  +     +L E  N   G  + + I  S + + G +  +V++I    
Sbjct: 116 EADKDLLTMEDNP----MLMEGANKIQGEVIKLFIKESRSEVLGGK-GRVEAIFNTP 167


>gi|120602551|ref|YP_966951.1| OstA family protein [Desulfovibrio vulgaris DP4]
 gi|120562780|gb|ABM28524.1| OstA family protein [Desulfovibrio vulgaris DP4]
 gi|311233963|gb|ADP86817.1| OstA family protein [Desulfovibrio vulgaris RCH1]
          Length = 196

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 69/188 (36%), Gaps = 17/188 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M++ L    L + + A V   +    +Q  A+     K   +    + A  ++     Q 
Sbjct: 1   MASRLVPFLLSLTMAAAVAFPVPTACAQPKATANPAQK---SVPTTVTAQRMQYDANKQS 57

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK----------INRMDVERNIFIQSG 110
             F+G+V++ + DF L + K+T+    +    S            I R+  E+N+ +   
Sbjct: 58  VVFEGDVYVKRPDFELWSVKLTLHLGKSKEGKSGGDVPGGMDAGEIERIVAEKNVRMVRE 117

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
             N             ++++ G      +L +K N   G  +      + + + G  S  
Sbjct: 118 GRNGTCQKATYTTNDGLMIMEGSP----VLFDKENVVKGEVIYFYTRENRSEVHGGTSRP 173

Query: 171 VQSIIRYD 178
           V+++    
Sbjct: 174 VEAVFTSS 181


>gi|90022819|ref|YP_528646.1| alpha amylase domain-containing protein [Saccharophagus degradans
           2-40]
 gi|89952419|gb|ABD82434.1| OstA-like protein [Saccharophagus degradans 2-40]
          Length = 179

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/141 (15%), Positives = 51/141 (36%), Gaps = 8/141 (5%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             ++ +   AD LE+ D        GNV + Q    + ADK+ + YN             
Sbjct: 33  DRSQPLSTDADKLELDDKSGTTTLYGNVIIEQGSMRITADKVILHYNKNKLTHVIATGEP 92

Query: 100 DVERNIF-IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
                +       +   A       ++  L L  + +   ++++   +  G ++  ++  
Sbjct: 93  AHYSQVPRANQEPVQARAKRLEYHIEQETLTLLNNAS---LVQDGGTSLSGNRIDYDVKK 149

Query: 159 SF----ASLQGCESDQVQSII 175
           S     + ++  E  +V+ +I
Sbjct: 150 SLVKAGSDIEEGEKRRVRLVI 170


>gi|50119250|ref|YP_048417.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium atrosepticum SCRI1043]
 gi|49609776|emb|CAG73210.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 190

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 53/164 (32%), Gaps = 14/164 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
            L A    A +          N+ IHI +    +        F GNV + Q    ++ADK
Sbjct: 12  TLIASSLFAVSISTFAVTGDSNQPIHIDSAQQSLDMQGNTVTFTGNVVVKQGTIEVKADK 71

Query: 81  MTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +      +         N +    ++ N     G     A     +     LVL G+ 
Sbjct: 72  VVVTRPQGGQGSEVVEGYGNPVTFYQMQDNGKPVKGH----AQKIRYELATDFLVLTGNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L+++ +   G ++   +          +  +V +++   
Sbjct: 128 Y----LEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTVLVPS 167


>gi|223039879|ref|ZP_03610163.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter rectus RM3267]
 gi|222878888|gb|EEF13985.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter rectus RM3267]
          Length = 158

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 61/134 (45%), Gaps = 3/134 (2%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E++ + AD     +  Q + FKGNV + +   +L A  + + Y +  R+    +   + +
Sbjct: 23  EQVEVTADEFYADEGKQISEFKGNVNIKKGKDTLTA-NLAVIYFDKKRNPLKYVASGNAK 81

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +FI++   +   +    +  + +  +NG+     I  +K     G K+ VN ++   +
Sbjct: 82  FRVFIKNKTYDGSGNELIYEPAQNLYTINGNGFLHEIQTDKK--VYGEKITVNQNSGTYN 139

Query: 163 LQGCESDQVQSIIR 176
           + G + + V+ I +
Sbjct: 140 VNGSKKEPVKFIFQ 153


>gi|157372598|ref|YP_001480587.1| lipopolysaccharide transport periplasmic protein LptA [Serratia
           proteamaculans 568]
 gi|157324362|gb|ABV43459.1| Cell envelope biogenesis YhbN [Serratia proteamaculans 568]
          Length = 179

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/164 (14%), Positives = 54/164 (32%), Gaps = 14/164 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL   L  AA++     K   ++ + I +    +      + F  NV + Q    ++ADK
Sbjct: 12  LLIGSLILAASAPAWALKSDSSQPVSIDSLKQSLDMQSNVSTFTDNVVIKQGTIDIKADK 71

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +    T          ++   N             +   A     D   +++ L G+ 
Sbjct: 72  VVV----TRPGGDQNKTYIEAFGNPVTFYQMQDSGKPVKGHAQKVRYDVASQLVTLTGNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L++  +   G ++   +          +  +V +++   
Sbjct: 128 Y----LEQLDSNVKGDRITYLVQQQQMQAFSDKGKRVTTVLVPS 167


>gi|261378335|ref|ZP_05982908.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           cinerea ATCC 14685]
 gi|269145440|gb|EEZ71858.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           cinerea ATCC 14685]
          Length = 176

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 58/159 (36%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +  N   
Sbjct: 16  SASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVTRNGKG 75

Query: 90  RD-VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  EQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  II+  
Sbjct: 132 GAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 170


>gi|313667761|ref|YP_004048045.1| hypothetical protein NLA_4160 [Neisseria lactamica ST-640]
 gi|313005223|emb|CBN86656.1| hypothetical outer membrane protein [Neisseria lactamica 020-06]
          Length = 171

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/160 (18%), Positives = 59/160 (36%), Gaps = 10/160 (6%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY- 85
           + +A S     +    + I I+AD   +    Q   F GNV + Q   ++ A ++ +   
Sbjct: 13  ALSATSPAFALQSDSRQPIQIEADRGSLDQTKQSTTFSGNVVIRQGTLNISASRVNVTRG 72

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
                 V  + + +   + +    G +   A+N         +VL G+      ++   +
Sbjct: 73  GKGGESVRAEGSPVRFSQTLDGGKGTVRGQANNIAYSSAGSTVVLTGNAK----VQRGGD 128

Query: 146 TFLGCKLIVNIDTSFASLQG-----CESDQVQSIIRYDGR 180
              G  +  N  T   ++ G      +S +V  +IR  G 
Sbjct: 129 VVEGAVITYNTQTEVYTVSGGAKSAAKSGRVSVVIRPAGA 168


>gi|184157548|ref|YP_001845887.1| hypothetical protein ACICU_01228 [Acinetobacter baumannii ACICU]
 gi|213156368|ref|YP_002318788.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB0057]
 gi|215483982|ref|YP_002326207.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB307-0294]
 gi|239503718|ref|ZP_04663028.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB900]
 gi|301346196|ref|ZP_07226937.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB056]
 gi|301510175|ref|ZP_07235412.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB058]
 gi|301594401|ref|ZP_07239409.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB059]
 gi|332853949|ref|ZP_08435069.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013150]
 gi|332870205|ref|ZP_08439100.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013113]
 gi|332874282|ref|ZP_08442201.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6014059]
 gi|183209142|gb|ACC56540.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|193076934|gb|ABO11667.2| putative transport protein [Acinetobacter baumannii ATCC 17978]
 gi|213055528|gb|ACJ40430.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB0057]
 gi|213988138|gb|ACJ58437.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB307-0294]
 gi|322507862|gb|ADX03316.1| Putative lipopolysaccharide transport protein A [Acinetobacter
           baumannii 1656-2]
 gi|323517459|gb|ADX91840.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii TCDC-AB0715]
 gi|332728305|gb|EGJ59686.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013150]
 gi|332732372|gb|EGJ63629.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013113]
 gi|332737507|gb|EGJ68415.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6014059]
          Length = 182

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 60/169 (35%), Gaps = 18/169 (10%)

Query: 19  FVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           F+   A ++  A S  + F +    N++I + AD     +      + GNV + Q    L
Sbjct: 13  FLKQAAVITFVALSSASTFALPSDRNQQISLVADRATYNEKTGLTTYTGNVVIEQGTMKL 72

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILV 129
           QAD +         +   +I  +  +         I    G           +    I+ 
Sbjct: 73  QADSIV-----ATLNSKREIQTITAKGRPSKFQQQISADKGIARGEGQTIVYNADTGIIT 127

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L+G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 128 LSGGAY----LYQDGSSIRGNTLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|329118332|ref|ZP_08247041.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327465556|gb|EGF11832.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 188

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 51/146 (34%), Gaps = 11/146 (7%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              + I I+AD  E+    +   F GNV + Q   +++A  + +  ++  +         
Sbjct: 40  DRKQPIEIEADQGELDQKNRSTTFSGNVSIKQGTLNIRAASVHVVRSDDGQQTMKATGSP 99

Query: 100 DVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
                      G ++  AS         ++ L+G+      +    +   G  +  N  T
Sbjct: 100 VRFGQTLDGGKGTVSGEASQVDYSSATNVVRLSGNAK----VTRGGDKAEGAVITYNTRT 155

Query: 159 SFASLQGCE------SDQVQSIIRYD 178
              ++ G +        +V  +I+ D
Sbjct: 156 EVYTVSGSKPASGKGGKRVSVVIQPD 181


>gi|257454874|ref|ZP_05620125.1| lipopolysaccharide transport periplasmic protein LptA
           [Enhydrobacter aerosaccus SK60]
 gi|257447807|gb|EEV22799.1| lipopolysaccharide transport periplasmic protein LptA
           [Enhydrobacter aerosaccus SK60]
          Length = 179

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 50/151 (33%), Gaps = 6/151 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           AA++         NE I + AD     +      + GNV +TQ    + AD +T++   T
Sbjct: 22  AASNVANALPSDANEPIRLLADKATYSERSGVTSYTGNVTITQGTLKMAADNLTVNLTPT 81

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIAS--NGYVDFQKRILVLNGDRADKVILKEKLNT 146
               S             +   +            + +  ++ L G+      L +   +
Sbjct: 82  RAIESAVATGRPATIQQIVTQEKGLAKGQANRIDYNVKTGLVTLTGNAR----LTQNGGS 137

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           F G  +  ++       +   + +V+ +   
Sbjct: 138 FSGNVIHYSLKVGDIEAKAGNNQRVELVFPP 168


>gi|255322559|ref|ZP_05363704.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter showae RM3277]
 gi|255300467|gb|EET79739.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter showae RM3277]
          Length = 158

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 59/134 (44%), Gaps = 3/134 (2%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E++ I AD     +  Q + FKGNV + +   +L A  + + Y +  R+    +   + +
Sbjct: 23  EQVEITADEFYADEGKQISEFKGNVNIKKGKDTLTA-NLVVIYFDKKRNPLKYVASGNAK 81

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +FI++   +   S    +    +  +NG+     I  +K     G K+ VN ++   +
Sbjct: 82  FRVFIKNKTYDGSGSELVYEPAPNLYTINGNGFLHEIETDKK--VYGEKITVNQNSGTYN 139

Query: 163 LQGCESDQVQSIIR 176
           +   + + V+ I +
Sbjct: 140 VNSGKKEPVKFIFQ 153


>gi|325205431|gb|ADZ00884.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M04-240196]
          Length = 176

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 58/159 (36%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           ++S     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +  N   
Sbjct: 16  SSSPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVTRNGKG 75

Query: 90  RD-VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  EQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  II+  
Sbjct: 132 GAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 170


>gi|284008687|emb|CBA75343.1| organic solvent tolerance protein [Arsenophonus nasoniae]
          Length = 204

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 51/151 (33%), Gaps = 18/151 (11%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I I +    +        F GNV + Q    ++ADK+ +         +  
Sbjct: 46  ALKSDSQQPIQIDSVKQSLDLEKNITTFTGNVVIKQGSIDVRADKVVVT------RPNGD 99

Query: 96  INRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
             +M VE      +          I   +     + +K +++L G+      L++  +  
Sbjct: 100 AKKMVVEAYGTPATFYQLQDDGKPIKGHSDKIRYEMEKELVILTGNAY----LEQLDSNI 155

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G K+   + T        +  +V +I+   
Sbjct: 156 KGDKITYLVPTQQMEAFSDKGKRVTTILLPS 186


>gi|271498864|ref|YP_003331889.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech586]
 gi|270342419|gb|ACZ75184.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech586]
          Length = 192

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 50/148 (33%), Gaps = 14/148 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + IHI +D   +        F GNV +TQ     QADK+ +    T  +    
Sbjct: 28  ALTGDTEQPIHITSDQQALDMQGNVVTFTGNVIVTQGSIKAQADKVVV----TRPNGQQG 83

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N      +      +   A     +  K+++ L G+      L++  +   G
Sbjct: 84  HEIIEGYGNPATFYQMQDNGKPVKGHAQKIRYEMDKQLVTLTGNAY----LEQLDSNVKG 139

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
            ++   +          +  +V +++  
Sbjct: 140 DRITYLVQQQQMEAFSDKGKRVTTVLVP 167


>gi|78356812|ref|YP_388261.1| hypothetical protein Dde_1769 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219217|gb|ABB38566.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 179

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 70/176 (39%), Gaps = 21/176 (11%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           ++ VLL   + QAA +         +    I +  +      Q   F+ +V++ + +F L
Sbjct: 10  MIMVLLACLVLQAAPAT-----AAEDIPTSITSKTMTYDANAQLIIFEQDVYVQRGEFEL 64

Query: 77  QADKMTIDYNNTNRDVS------------NKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
            AD +++  +      +             +INR+  E N+ ++    +           
Sbjct: 65  WADSISVYLDKNASAAAKQNDAEGPAIDAGQINRLVAEGNVRMKQLTKSGECRKATYKVS 124

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           + +LV+ GD     +L+++ N+  G ++   ++ + + + G     V ++     R
Sbjct: 125 EGLLVMEGDP----VLRDEGNSIGGQEIRFYVNENRSEVLGAPGKPVNAVFSAPKR 176


>gi|303256247|ref|ZP_07342263.1| lipopolysaccharide transport periplasmic protein LptA
           [Burkholderiales bacterium 1_1_47]
 gi|302860976|gb|EFL84051.1| lipopolysaccharide transport periplasmic protein LptA
           [Burkholderiales bacterium 1_1_47]
          Length = 197

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 60/179 (33%), Gaps = 30/179 (16%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
               LL    + A  +          + I I +D  +  D  Q A + G+V + Q    +
Sbjct: 10  CALGLLSFGTAHAETA-------DSEQPIQIFSDKFDGDDVKQVAIYTGDVAVHQGTLEI 62

Query: 77  QADKMTIDYNNT-----------NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
             +K+ +  +              + V+ K  R      +      ++        D ++
Sbjct: 63  HGNKLVLTVDPQGYRHAVMTPLKGKLVTFKQRRDQKTPGV---EEWMHGKGDELTYDEKR 119

Query: 126 RILVLNGDRADKVILKEKL---NTFLGCKLIVNIDTSFASLQG----CESDQVQSIIRY 177
            +L+L      +V   E     +   G K+  N+  S A + G      S +V ++I  
Sbjct: 120 NVLILT--HRAEVARSENGVLKDESKGDKITYNLTNSTAIIDGNKAKGPSGRVSTVIAP 176


>gi|260767120|ref|ZP_05876065.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
 gi|260617875|gb|EEX43049.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
 gi|315181263|gb|ADT88177.1| organic solvent tolerance protein [Vibrio furnissii NCTC 11218]
          Length = 786

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 49/133 (36%), Gaps = 17/133 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             + I+++AD LE  +   +A + GNV + Q    ++AD +T+   +           + 
Sbjct: 52  NEQPINVEADKLEAINGE-RATYSGNVVVIQGKKQIRADNVTLHQKDNV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL----GCKLIVNI 156
            E N+    G++   +     +     + L  +   K + ++            K +  I
Sbjct: 102 AEGNVNFSDGQVKATSDKATNNLTTDQMTLE-NTKYKFLCEQGRGEAAYISKTGKAVYEI 160

Query: 157 DTSFASLQGCESD 169
           +    S+  C   
Sbjct: 161 EDG--SITSCPEG 171


>gi|319786673|ref|YP_004146148.1| lipopolysaccharide transport periplasmic protein LptA
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465185|gb|ADV26917.1| lipopolysaccharide transport periplasmic protein LptA
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 174

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQ-KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                 N+ + I +   E       +  F GNV + Q    + A +  I       +   
Sbjct: 29  GKSSDRNQPMTIDSGASECSQGGNMQCVFTGNVEIVQGSLRINAARAEIIQRGEQIEQVI 88

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
              +    +        +N  A     + +K +L L G+   +V      N   G +++ 
Sbjct: 89  LTGKQATMQQDMDDGSTMNARADRIVYEPKKELLTLTGNY--QVESPRGSN--SGQRMVY 144

Query: 155 NIDTSFASLQGCESDQVQSIIRY 177
           N+ +      G +  +V+++I+ 
Sbjct: 145 NMASGQMQ-SGGDGTRVRTVIQP 166


>gi|118594084|ref|ZP_01551431.1| OstA-like protein [Methylophilales bacterium HTCC2181]
 gi|118439862|gb|EAV46489.1| OstA-like protein [Methylophilales bacterium HTCC2181]
          Length = 195

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 60/148 (40%), Gaps = 13/148 (8%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +++    K    + I I++D + + D    + +KG+V +TQ    ++AD++ +  +N   
Sbjct: 35  SNHAKAEKGDREQPIEIESDTMTMDDTKNLSIYKGDVILTQGTLIIKADELIVREDNQGF 94

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA-----DKVILKEKLN 145
             S          N    S +      + Y++   + +  +G           I+K   +
Sbjct: 95  QHSTS------TGN--PTSFKQKREGVDEYIEGIGQRIEYDGHMDKVHIYKNAIVKRGND 146

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQS 173
           T +G  +I + +   A     +S+  +S
Sbjct: 147 TVMGDYIIYDANAEVAQAMSRQSNGSES 174


>gi|251791371|ref|YP_003006092.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya zeae
           Ech1591]
 gi|247539992|gb|ACT08613.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya zeae
           Ech1591]
          Length = 189

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 51/148 (34%), Gaps = 14/148 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + IHI +D   +        F GNV +TQ     QADK+ +    T  +    
Sbjct: 28  ALTGDTEQPIHITSDQQALDMQGNVVTFTGNVLVTQGSIKAQADKVVV----TRPNGQQG 83

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N      +      +   A     +  K++++L GD      L++  +   G
Sbjct: 84  HEVIEGYGNPATFYQMQDNGKPVKGHAQKMRYEMDKQLVILTGDAY----LEQLDSNVKG 139

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
            ++   +          +  +V +++  
Sbjct: 140 DRITYLVQQQQMEAFSDKGKRVTTVLVP 167


>gi|261250137|ref|ZP_05942713.1| LptA protein [Vibrio orientalis CIP 102891]
 gi|260939253|gb|EEX95239.1| LptA protein [Vibrio orientalis CIP 102891]
          Length = 165

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 59/154 (38%), Gaps = 15/154 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +S         ++ ++I +D  ++     K  F G+V + Q   ++ ADK+ +  +  + 
Sbjct: 15  SSQALALSTDQDQPVYIDSDSQQLDMQSNKVTFLGDVKLKQGSININADKVIVTRDPKD- 73

Query: 91  DVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                I  ++   ++   S        +   A   Y    +  L +     DK +L +  
Sbjct: 74  ---GSIQEIEGYGDLATFSQLTDDGKTLYGEAKELYYVMAEDQLTM----IDKAMLSQDD 126

Query: 145 NTFLGCKLIVNIDTSFASLQGC-ESDQVQSIIRY 177
           +   G K+   I +      G  + D+V ++++ 
Sbjct: 127 SVIRGTKIRYKISSQKLIADGKEKGDRVSTVLQP 160


>gi|299770837|ref|YP_003732863.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter sp. DR1]
 gi|298700925|gb|ADI91490.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter sp. DR1]
          Length = 182

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 60/169 (35%), Gaps = 18/169 (10%)

Query: 19  FVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           F+   A ++  A S  + F +    N++I + AD     +      + GNV + Q    L
Sbjct: 13  FLKQAAVITFVALSSASTFALPSDRNQQISLVADRATYNEKTGLTTYTGNVVIEQGTMKL 72

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILV 129
           QAD +         +   +I  +  +         I    G           +    I+ 
Sbjct: 73  QADSIV-----ATLNSKREIQTITAKGRPSKFQQQISADKGVARGEGQTIVYNADTGIIT 127

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           LNG       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 128 LNGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|225075757|ref|ZP_03718956.1| hypothetical protein NEIFLAOT_00773 [Neisseria flavescens
           NRL30031/H210]
 gi|224952923|gb|EEG34132.1| hypothetical protein NEIFLAOT_00773 [Neisseria flavescens
           NRL30031/H210]
          Length = 176

 Score = 65.0 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 64/166 (38%), Gaps = 14/166 (8%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A ++  AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +T+
Sbjct: 10  ALVAVFAASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSVTV 69

Query: 84  DY-NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
              + + + +    + +   + +    G +N  A+         ++ L G+      ++ 
Sbjct: 70  SRNDKSEQLMKATGSPVKFSQELDGGKGVVNGQANTVTYSSAAGLVTLTGNAK----VQR 125

Query: 143 KLNTFLGCKLIVNIDTSFASLQGC---------ESDQVQSIIRYDG 179
             +   G  +  N  T   ++ G          +S +V  +I+  G
Sbjct: 126 GGDVAEGAVITYNTKTEVYTINGSAKSGVKSATKSGRVSVVIQPSG 171


>gi|15676270|ref|NP_273404.1| hypothetical protein NMB0355 [Neisseria meningitidis MC58]
 gi|121635509|ref|YP_975754.1| hypothetical protein NMC1813 [Neisseria meningitidis FAM18]
 gi|218768869|ref|YP_002343381.1| putative outer membrane hypothetical protein [Neisseria
           meningitidis Z2491]
 gi|254805609|ref|YP_003083830.1| hypothetical protein NMO_1685 [Neisseria meningitidis alpha14]
 gi|7225577|gb|AAF40798.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120867215|emb|CAM10984.1| putative outer membrane hypothetical protein [Neisseria
           meningitidis FAM18]
 gi|121052877|emb|CAM09229.1| putative outer membrane hypothetical protein [Neisseria
           meningitidis Z2491]
 gi|254669151|emb|CBA07831.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|254670189|emb|CBA05301.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|308388563|gb|ADO30883.1| hypothetical protein NMBB_0396 [Neisseria meningitidis alpha710]
 gi|316984361|gb|EFV63335.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           meningitidis H44/76]
 gi|319411110|emb|CBY91514.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           WUE 2594]
 gi|325128940|gb|EGC51794.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis N1568]
 gi|325130884|gb|EGC53614.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis OX99.30304]
 gi|325132909|gb|EGC55586.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M6190]
 gi|325134936|gb|EGC57568.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M13399]
 gi|325136929|gb|EGC59526.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M0579]
 gi|325138894|gb|EGC61444.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis ES14902]
 gi|325141004|gb|EGC63510.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis CU385]
 gi|325143040|gb|EGC65392.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis 961-5945]
 gi|325145150|gb|EGC67432.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M01-240013]
 gi|325198956|gb|ADY94412.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis G2136]
 gi|325199549|gb|ADY95004.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis H44/76]
 gi|325202826|gb|ADY98280.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M01-240149]
 gi|325203467|gb|ADY98920.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M01-240355]
 gi|325208819|gb|ADZ04271.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis NZ-05/33]
          Length = 176

 Score = 65.0 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 58/159 (36%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNT 88
           +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  SASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVTRGGKG 75

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              V  + + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVVIQPS 170


>gi|290476794|ref|YP_003469705.1| putative ABC transporter periplasmic binding protein [Xenorhabdus
           bovienii SS-2004]
 gi|289176138|emb|CBJ82943.1| putative transport protein (ABC superfamily, peri_bind)
           [Xenorhabdus bovienii SS-2004]
          Length = 177

 Score = 65.0 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 51/149 (34%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I + +D   +      A F  NV + Q    + ADK+ +    T  +   K
Sbjct: 23  ALKEDTKQPITLNSDRQSLDLTGNVATFTDNVSVKQGSIDIHADKVVV----TRPEGDAK 78

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N      +      I   AS    +  K ++ L G+      L++  +   G
Sbjct: 79  KTVIEAYGNPATFYQLQDDGKPIKGHASKMRYEMDKELMTLTGNAY----LEQLDSNIKG 134

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            K+   + T        +  +V +++   
Sbjct: 135 DKITYLVPTQQMEAFSDKGKRVTTVLLPS 163


>gi|326560124|gb|EGE10514.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 46P47B1]
 gi|326565403|gb|EGE15580.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 103P14B1]
 gi|326573391|gb|EGE23359.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 101P30B1]
 gi|326577178|gb|EGE27072.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis O35E]
          Length = 175

 Score = 65.0 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+ + +L++  +  + ++  A                 N+ I + AD     +      +
Sbjct: 5   FVITKYLFLSCIVSIPMIASA------------LPSDTNQPIRLLADRATYSERTGVTTY 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIASNGY 120
            G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A+   
Sbjct: 53  SGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGQPATIQQVVTQEKGLAKGQANRID 112

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +    I+ L G+      L +  ++F G  +  ++             +V+ +    
Sbjct: 113 YNAVSGIVTLTGNAK----LTQAGSSFSGNTIRYSLSVGDVEANAGGGQRVELVFPPS 166


>gi|261868144|ref|YP_003256066.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391915|ref|ZP_06636249.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261413476|gb|ACX82847.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952449|gb|EFE02568.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 172

 Score = 65.0 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 55/148 (37%), Gaps = 13/148 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   N+ I+I +D   +    +   F  NV +TQ    ++A+K+ I       + S K
Sbjct: 23  ALKDDTNQPINIVSDNQSLDMTSRVVIFTDNVVITQGSIVVKANKVIIT---RPEENSKK 79

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
            + ++   N      +      ++  A+  + D     L L G+      LK+  +   G
Sbjct: 80  KDTVEAFGNPVTFHQVMDDGKPVDGKANKVFYDLGTEFLTLTGNAE----LKQLDSKING 135

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
             +  ++        G    +V +++  
Sbjct: 136 NVITYDVKKQQLKANGSSGSRVTTVLIP 163


>gi|326575712|gb|EGE25635.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis CO72]
          Length = 175

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/178 (13%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+ + +L++  +  + ++  A                 N+ I + AD     +      +
Sbjct: 5   FVITKYLFLSCIVSIPMIASA------------LPSDTNQPIRLLADRATYSERTGVTTY 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIASNGY 120
            G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A+   
Sbjct: 53  SGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGQPATIQQVVTQEKGLAKGQANRID 112

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +    I+ L G+      L +  ++F G  +  ++             +V+ +    
Sbjct: 113 YNAVSGIVTLTGNAK----LTQAGSSFSGNTIRYSLSVGDIEANAGGGQRVELVFPPS 166


>gi|315633785|ref|ZP_07889075.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Aggregatibacter segnis
           ATCC 33393]
 gi|315477827|gb|EFU68569.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Aggregatibacter segnis
           ATCC 33393]
          Length = 172

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 54/148 (36%), Gaps = 13/148 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   N+ I+I +D   +    +   F  NV +TQ    ++A K+ I       + S +
Sbjct: 23  ALKEDTNQPINIVSDNQSLDMNNRVVTFTDNVVITQGSIIVKASKVVIT---RPEENSKQ 79

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
            ++++   N      +      ++  A+    D     L L GD      LK+  +   G
Sbjct: 80  KDKVEAFGNPVTFHQVMDDGKPVDGKANKVVYDLGTEFLTLTGDAE----LKQLDSKING 135

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
             +  ++             +V++++  
Sbjct: 136 SVITYDVAKQQLKANANSGARVKTVLIP 163


>gi|289548635|ref|YP_003473623.1| lipopolysaccharide transport periplasmic protein LptA [Thermocrinis
           albus DSM 14484]
 gi|289182252|gb|ADC89496.1| lipopolysaccharide transport periplasmic protein LptA [Thermocrinis
           albus DSM 14484]
          Length = 152

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 49/126 (38%), Gaps = 12/126 (9%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI 107
           +AD L  +    K  + G+V   + D  L ADK+ I  +   +         + E N+  
Sbjct: 22  EADSLLYE--GNKIIYTGHVKFVRGDGVLTADKVIIYLDEKKKA-----KWAEAEGNVRY 74

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
              +    A+    DFQK IL L G+   +    E  N     ++I       A +   +
Sbjct: 75  HDSKRKARANRATYDFQKEILTLTGNARVE----EGPNFVEADEIIYYKKEDRA-VAVSK 129

Query: 168 SDQVQS 173
             +V++
Sbjct: 130 GQRVRT 135


>gi|254509104|ref|ZP_05121206.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus 16]
 gi|219547985|gb|EED25008.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus 16]
          Length = 147

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 56/145 (38%), Gaps = 7/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN- 94
                  + ++I +D  ++     K  F G+V + Q   ++ ADK+ +  N  +  + + 
Sbjct: 2   ALSTDQQQPVYIDSDSQQLDMQSNKVTFLGDVKLKQGSININADKIVVTRNPNDGSIESI 61

Query: 95  -KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
               ++     +      +   A        K  L +      K +L +  +T  G ++ 
Sbjct: 62  DGFGKLATFSQLTDDGKTLYGEAEELEYSLAKDQLTM----RIKAMLSQDDSTIRGNQIR 117

Query: 154 VNIDTSFASLQG-CESDQVQSIIRY 177
            +I +   +  G  + D+V ++++ 
Sbjct: 118 YHISSQKLTADGQSKGDRVSTVLQP 142


>gi|189218964|ref|YP_001939605.1| hypothetical protein Minf_0952 [Methylacidiphilum infernorum V4]
 gi|189185822|gb|ACD83007.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 178

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/153 (12%), Positives = 61/153 (39%), Gaps = 8/153 (5%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            L++   +       Q             +  + + ++  ++   + + FF GNV     
Sbjct: 14  FLISYYLLFGFNLFGQFPEENPPELLTNPDATV-VTSNTFKLDQNIHQGFFSGNVITIAN 72

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           +F +++++MT+ ++ +     ++I R+  +    +   +    A+       +  L+L G
Sbjct: 73  NFKMRSNEMTVFFDESG----SEIKRLIAKGEALLVQEKRTAKAAQMEYIVAEDKLILTG 128

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
           +     +++E  +   G  + +  +++   + G
Sbjct: 129 NPE---VIEENKDHVTGNVITIFRNSNQMFVDG 158


>gi|327479596|gb|AEA82906.1| OstA family protein [Pseudomonas stutzeri DSM 4166]
          Length = 169

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 59/150 (39%), Gaps = 13/150 (8%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINR 98
              + I ++AD  E+ D    A ++G+V +TQ    +  D +TI  + N + +V   I +
Sbjct: 16  DREQPIRVQADSAELDDRQGVAVYRGDVVITQGTMKITGDTVTITQDSNGDVEVFTSIGK 75

Query: 99  MDVERNIFIQSGEI-NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN-- 155
                       EI                +VL  D+A  V   ++ NTF G K++ +  
Sbjct: 76  PAYYEQKPAVDKEIVKAYGLTIQYFAANERIVLL-DQAKVV---QEGNTFEGEKIVYDTR 131

Query: 156 ---IDTSFASLQ--GCESDQVQSIIRYDGR 180
              ++   A+         +V  +I+   R
Sbjct: 132 RQIVNAGRATNTDVSTPRPRVDMVIQPRKR 161


>gi|148652634|ref|YP_001279727.1| cell envelope biogenesis YhbN [Psychrobacter sp. PRwf-1]
 gi|148571718|gb|ABQ93777.1| Cell envelope biogenesis YhbN [Psychrobacter sp. PRwf-1]
          Length = 157

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 48/146 (32%), Gaps = 6/146 (4%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                   + IH+ AD     +      + GNV +TQ    L AD +T++ +N+   +S 
Sbjct: 7   NALPSDAQQPIHLLADKATYSERTGVTSYSGNVTITQGTLKLAADNITVNLSNSRSILSA 66

Query: 95  KINRMDVERNIFIQSGEINVIAS--NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
                       +   +            + Q  I+ L G+      L +   +F G  +
Sbjct: 67  VATGRPATMQQVVTKEKGLARGQANKIDYNAQNGIVTLTGNAK----LTQNGASFAGNVI 122

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
             ++           S +V+ +    
Sbjct: 123 RYSLKVGDVEATAGGSQRVELVFPPS 148


>gi|257465175|ref|ZP_05629546.1| hypothetical protein AM202_01600 [Actinobacillus minor 202]
 gi|257450835|gb|EEV24878.1| hypothetical protein AM202_01600 [Actinobacillus minor 202]
          Length = 168

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/159 (13%), Positives = 55/159 (34%), Gaps = 6/159 (3%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +L   L  + +++    K   ++ I+I +    +        F   V +TQ    + A 
Sbjct: 8   AILTTLLGVSLSAH--ALKSDTDQPINIDSGSQSLDMNTNTVIFSDGVVITQGSIKVNAS 65

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
           K+TI      ++  +        +        +N   ++ + D     L L G+      
Sbjct: 66  KVTIVRQEGKKETIDATGAPVTFQQTLDDGKPVNGKGNSVHYDLNSEFLTLIGNAE---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           LK+  +     ++  ++             +V++++  +
Sbjct: 122 LKQLDSYIKAERITYDVKKQQLKATSGGKSRVKTVLIPN 160


>gi|294084813|ref|YP_003551573.1| hypothetical protein SAR116_1246 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664388|gb|ADE39489.1| hypothetical secreted protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 268

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 47/137 (34%), Gaps = 9/137 (6%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKA-DMLEVKDAVQ 59
           ++  L    L+  LL +   LL    +Q   +            + I+A D LE      
Sbjct: 4   LNFLLRHFALFALLLVMSPGLLSIANAQDKQAETQT------APVTIEASDFLEWDQNKG 57

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
               +G+    Q D  + AD++  +Y+        +IN M    N+F   GE     +  
Sbjct: 58  LYLAEGDAIAVQRDMRISADRLEANYDPEQAG--REINLMTATGNVFFIDGENTATGARL 115

Query: 120 YVDFQKRILVLNGDRAD 136
             D       + G  A 
Sbjct: 116 VYDLVSSTYSVFGKNAK 132



 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 33/85 (38%), Gaps = 6/85 (7%)

Query: 93  SNKINRMDVERNIFIQS-GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           +  +  +D   N ++++             DF   I +L G+    V L E  N   G +
Sbjct: 186 NGDLQTLDAIGNAYVRTVDNQTATGDKVNYDFNTSIAILTGN----VELIEGQNVMRGSR 241

Query: 152 LIVNIDTSFAS-LQGCESDQVQSII 175
             V+ ++  +  L   +  +V  I+
Sbjct: 242 AEVDFNSGVSRLLSDGQGGRVTGIM 266


>gi|15838011|ref|NP_298699.1| hypothetical protein XF1410 [Xylella fastidiosa 9a5c]
 gi|9106422|gb|AAF84219.1|AE003972_4 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 176

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 12/164 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDFS 75
            +F LL A LS AA S         N+ + I +   E       KA + GNV + Q    
Sbjct: 10  FLFPLLFAPLSAAAKSS------DRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSLE 63

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
             AD   +   N + D    I +    +        ++  A N     ++ I++L G+  
Sbjct: 64  AHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY- 122

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            KV   +  N   G ++I N  T      G +  +V++ I+  G
Sbjct: 123 -KVESPKGNN--TGQRMIYNTQTGDMR-SGNDGTRVRTTIQPKG 162


>gi|262376229|ref|ZP_06069459.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter lwoffii SH145]
 gi|262308830|gb|EEY89963.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter lwoffii SH145]
          Length = 188

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 58/172 (33%), Gaps = 23/172 (13%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           + L   +   + +         N+ I + AD     +      + GNV + Q    LQA+
Sbjct: 17  MTLATVVGLGSIAAF-ALPSDRNQPITLLADRATFNERTGVTTYSGNVIIEQGTMKLQAN 75

Query: 80  KMTIDYNNTNRDVSNKINRMDVER-------NIFIQSGEINVIASNGYVDFQKRILVLNG 132
            +  + NN       +I+ +            +    G     A     + +  I+ L+G
Sbjct: 76  SIVANLNN-----KRQISLITATGSPAQFQQKVDPAKGLAKGQAQKIVYNAETGIITLSG 130

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDT------SFASLQGCESDQVQSIIRYD 178
           +      L++   +  G  L  +++          +  G  S +VQ +I   
Sbjct: 131 NA----FLQQDGASIRGATLKYSMNKGDIEAIGTPNKTGSSSGRVQIVIPPS 178


>gi|226951452|ref|ZP_03821916.1| OstA-like protein [Acinetobacter sp. ATCC 27244]
 gi|294650975|ref|ZP_06728315.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate-binding protein [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226837800|gb|EEH70183.1| OstA-like protein [Acinetobacter sp. ATCC 27244]
 gi|292823076|gb|EFF81939.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate-binding protein [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 163

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 53/156 (33%), Gaps = 16/156 (10%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           +++         N+++ + AD     D      + GNV + Q    LQAD +        
Sbjct: 7   SSATSFALPSDRNQQLTLVADRATYNDKTGVTTYTGNVVIEQGTMKLQADSIV-----AT 61

Query: 90  RDVSNKINRMDVER-------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
            +   +I  +  +         I    G     A     +    IL L G       L +
Sbjct: 62  LNSKREIQTITAKGQLAKFQQQIDANRGLARGEAQQIVYNADTGILTLTGRAY----LYQ 117

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             ++  G  L  +++      QG  S++VQ II   
Sbjct: 118 DGSSIRGESLKYSMNKGDVEAQGSSSNRVQIIIPPS 153


>gi|253686681|ref|YP_003015871.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753259|gb|ACT11335.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 190

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 56/165 (33%), Gaps = 15/165 (9%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L+ + L   + S         N+ I I +    +        F GNV + Q    ++AD
Sbjct: 12  TLIASSLFAVSVSAF-AVTGDSNQPIRIDSAQQSLDMQGNTVTFTGNVVVKQGTIEVKAD 70

Query: 80  KMTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           K+ +      +         N +    ++ N     G     A     +  K +LVL G+
Sbjct: 71  KVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGH----AQKIRYELAKDLLVLTGN 126

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                 L+++ +   G ++   +          +  +V +++   
Sbjct: 127 AY----LEQQDSNVKGDRITYLVKQQQMEATSEKGKRVTTVLVPS 167


>gi|260914442|ref|ZP_05920911.1| YhbN like protein [Pasteurella dagmatis ATCC 43325]
 gi|260631543|gb|EEX49725.1| YhbN like protein [Pasteurella dagmatis ATCC 43325]
          Length = 168

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 63/164 (38%), Gaps = 14/164 (8%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           ++L A L  A+ S +   K    + I+I +D   +        F  NV +TQ    ++A+
Sbjct: 8   IILLATLVMASLSAL-ALKNDTQQPINIVSDNQSLDMDNHIVTFTDNVVITQGSILIKAN 66

Query: 80  KMTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGD 133
           K+ I       + S K + ++   N             +N  A+  + D     L L G+
Sbjct: 67  KVVIT---RPPEKSGKKDTVEAFGNPVTFQQTLDNGKPVNGKANKVHYDLTTEFLTLTGN 123

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                 LK+  +      +  ++       +G  + +V++++  
Sbjct: 124 AE----LKQLDSKINSSMISYDVKKQQLKAKGSGNSRVKTVLIP 163


>gi|149190589|ref|ZP_01868858.1| hypothetical protein VSAK1_01949 [Vibrio shilonii AK1]
 gi|148835587|gb|EDL52555.1| hypothetical protein VSAK1_01949 [Vibrio shilonii AK1]
          Length = 165

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 54/148 (36%), Gaps = 14/148 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + ++I +D  ++     +  F+G+V + Q   ++ ADK+ +    T    +  
Sbjct: 20  ALSTDSEQPVYIDSDSQQLDMKSNQVTFEGDVKLKQGSININADKVIV----TREAETGT 75

Query: 96  INRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I  ++   ++   S        +   A   +   +   L +     +K +L +  +   G
Sbjct: 76  IQVIEGFGDLATFSQLTDDGKTLYGEAKQLHYSLKNDQLTMT----NKAMLSQDDSIIRG 131

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
             +   I +      G    +V ++++ 
Sbjct: 132 SVIKYRISSQKLIADGDSKGRVSTVLQP 159


>gi|331001308|ref|ZP_08324934.1| lipopolysaccharide transport periplasmic protein LptA
           [Parasutterella excrementihominis YIT 11859]
 gi|329569035|gb|EGG50831.1| lipopolysaccharide transport periplasmic protein LptA
           [Parasutterella excrementihominis YIT 11859]
          Length = 197

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 61/179 (34%), Gaps = 30/179 (16%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
               LL    + A  +          + I I +D  +  D  Q A + G+V + Q    +
Sbjct: 10  CALGLLSFGTAHAETA-------DSEQPIQIFSDKFDGDDVKQVAIYTGDVAVHQGTLEI 62

Query: 77  QADKMTIDYNNT-----------NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
             +K+ +  +              + V+ K  R      +      ++   +    D ++
Sbjct: 63  HGNKLVLTVDPQGYRHAVMTPLKGKLVTFKQRRDQKTPGV---EEWMHGKGNELTYDEKR 119

Query: 126 RILVLNGDRADKVILKEKL---NTFLGCKLIVNIDTSFASLQG----CESDQVQSIIRY 177
            +L+L      +V   E     +   G K+  N+  S A + G      S +V ++I  
Sbjct: 120 NVLILT--HRAEVARSENGVLKDESKGDKITYNLTNSTAIIDGNKAKGPSGRVSTVIAP 176


>gi|15602037|ref|NP_245109.1| hypothetical protein PM0172 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720391|gb|AAK02256.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 170

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 57/155 (36%), Gaps = 15/155 (9%)

Query: 31  ASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A+ +  F +  +  + I++ +D   +        F  NV +TQ    ++A K+ I     
Sbjct: 15  ATALPAFALKSDTKQPINVVSDNQSLDMDNSVVTFTDNVVITQGSILIKASKVIIT---R 71

Query: 89  NRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
             + S K + ++                 +   A+  + D  +  L L G+      LK+
Sbjct: 72  PPENSGKKDTIEAFGKPVTFYQKLDDGKPVEGHANQVHYDLTQEFLTLTGNAE----LKQ 127

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             +      +  +++    +    +  +V++++  
Sbjct: 128 LDSKINSDVITYDVNKQQLNANSTQGSRVRTVLIP 162


>gi|317494039|ref|ZP_07952455.1| lipopolysaccharide transport periplasmic protein LptA
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917812|gb|EFV39155.1| lipopolysaccharide transport periplasmic protein LptA
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 209

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 57/168 (33%), Gaps = 16/168 (9%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L  ++    L+ +  +          + IHI +    +        F G+V +TQ    +
Sbjct: 10  LSLIVAGTLLTASVPAL--ALTGDTEQPIHIDSAQQSLDMQGNTVTFTGDVVVTQGTIKI 67

Query: 77  QADKMTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
            ADK+ +   N  +         N +    ++ N    SG           +  K  ++L
Sbjct: 68  NADKVVVIRPNGAQGKEVVEGYGNPVTFYQMQDNGKPVSGH----GQKLRYELDKDFVIL 123

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G+      L++  ++  G K+   +          +  +V +++   
Sbjct: 124 TGNA----FLQQVDSSIKGDKITYLVKQQQMEAFSDKGKRVTTVLIPS 167


>gi|149910595|ref|ZP_01899233.1| hypothetical protein PE36_14611 [Moritella sp. PE36]
 gi|149806323|gb|EDM66298.1| hypothetical protein PE36_14611 [Moritella sp. PE36]
          Length = 166

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 61/170 (35%), Gaps = 24/170 (14%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L+  LL ++ + A  S          E + + A   EV     +  F  NV +TQ    +
Sbjct: 8   LLLTLLMSNSALALESDFA-------ENVVVNAKRQEVFIKENRVIFYDNVVVTQGTILI 60

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNI------FIQSGEINVIASNGYVDFQKRILVL 130
            ADK+T+               M    N+           +IN  ++    +  K+ L L
Sbjct: 61  HADKLTVL-----SPGGKGTEVMIATGNVATFYQELDDGKKINAESNEIRYELGKKRLTL 115

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC--ESDQVQSIIRYD 178
                    L++  +   G K+I  ID      +    ESD+V +I   +
Sbjct: 116 T----KNARLRQADSEVKGNKIIYQIDKQEMIAESGNNESDRVITIFTPE 161


>gi|240949437|ref|ZP_04753778.1| hypothetical protein AM305_10851 [Actinobacillus minor NM305]
 gi|240296186|gb|EER46842.1| hypothetical protein AM305_10851 [Actinobacillus minor NM305]
          Length = 168

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/159 (13%), Positives = 55/159 (34%), Gaps = 6/159 (3%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +L   L  + +++    K   ++ I+I +    +        F   V +TQ    + A 
Sbjct: 8   AILTTLLGVSLSAH--ALKSDTDQPINIDSGSQSLDMNTNTVTFSDGVVITQGSIKVNAS 65

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
           K+TI      ++  +        +        +N   ++ + D     L L G+      
Sbjct: 66  KVTIVRQEGKKETIDATGAPVTFQQTLDDGKPVNGKGNSVHYDLNSEFLTLIGNAE---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           LK+  +     ++  ++             +V++++  +
Sbjct: 122 LKQLDSYIKAERITYDVKKQQLKATSGGKSRVKTVLIPN 160


>gi|157165382|ref|YP_001467170.1| cell envelope biogenesis protein YhbN [Campylobacter concisus
           13826]
 gi|112801410|gb|EAT98754.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter concisus 13826]
          Length = 158

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 59/142 (41%), Gaps = 4/142 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF-SLQADKMTIDYNNTNRDVSN 94
            F  L  E++ I ++     +  Q + F GNV + +  +  L+A+K+ + ++   + V  
Sbjct: 14  GFTFLNAEQVEITSNDFFADENKQISEFVGNVNIKKGSYDELKANKVVVHFDKKRQPVKY 73

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
            +   +    IF++    +        +  K+   + G+     +  +  N + G K++V
Sbjct: 74  -VATGNARAKIFMKDKHYDGKGDTLTYEPAKQTYTVTGNGYLHEVETD-KNVY-GDKIVV 130

Query: 155 NIDTSFASLQGCESDQVQSIIR 176
           N      S+   E   V+ I +
Sbjct: 131 NQKDGTYSVNSDEKKPVKFIFQ 152


>gi|270263245|ref|ZP_06191515.1| lipopolysaccharide transport periplasmic protein LptA [Serratia
           odorifera 4Rx13]
 gi|270042933|gb|EFA16027.1| lipopolysaccharide transport periplasmic protein LptA [Serratia
           odorifera 4Rx13]
          Length = 161

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 53/156 (33%), Gaps = 14/156 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           AA++     K   N+ + I +    +      + F  NV + Q    ++ADK+ +     
Sbjct: 2   AASAPAWALKSDSNQPVSIDSLKQSLDMQSNVSTFTDNVVIKQGTIDIKADKVVVTRPGG 61

Query: 89  NRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
           ++  +     ++   N             +   A     D   +++ L G+      L++
Sbjct: 62  DQSKTY----IEAFGNPVTFYQMQDSGKPVKGHAQKVRYDVASQLVTLTGNAY----LEQ 113

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   G ++   +          +  +V +++   
Sbjct: 114 LDSNVKGDRITYLVQQQQMQAFSDKGKRVTTVLVPS 149


>gi|261819637|ref|YP_003257743.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium wasabiae WPP163]
 gi|261603650|gb|ACX86136.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium wasabiae WPP163]
          Length = 190

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 54/165 (32%), Gaps = 15/165 (9%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L+ + L   + S         N+ I I +    +        F GNV + Q    ++AD
Sbjct: 12  TLIASSLFAVSVSAF-AVTGDSNQPIRIDSAQQSLDMQGNTVTFTGNVVVKQGTIEVKAD 70

Query: 80  KMTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           K+ +      +         N +    ++ N     G     A     +     LVL G+
Sbjct: 71  KVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGH----AQKIRYELATDFLVLTGN 126

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                 L+++ +   G ++   +          +  +V +++   
Sbjct: 127 AY----LEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTVLVPS 167


>gi|251793140|ref|YP_003007868.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter aphrophilus NJ8700]
 gi|247534535|gb|ACS97781.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter aphrophilus NJ8700]
          Length = 173

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 57/149 (38%), Gaps = 13/149 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   N+ I+I +D   +  + +   F  NV +TQ    ++A+K+ I       + S K
Sbjct: 23  ALKDDTNQPINIVSDNQSLDMSNRVVTFTDNVVITQGSIVVKANKVIIT---RPEENSKK 79

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
            + ++   N      +      ++  A+  + D     L L G+      LK+  +   G
Sbjct: 80  KDTVEAFGNPVTFHQMMDDGKPVDGKANKVFYDLGTEFLTLTGNAE----LKQLDSKING 135

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +  ++        G    +V++++   
Sbjct: 136 NVITYDVKKQQLKANGSSGSRVKTVLIPS 164


>gi|319945406|ref|ZP_08019666.1| cell envelope biogenesis protein YhbN [Lautropia mirabilis ATCC
           51599]
 gi|319741192|gb|EFV93619.1| cell envelope biogenesis protein YhbN [Lautropia mirabilis ATCC
           51599]
          Length = 219

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 61/146 (41%), Gaps = 6/146 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN-KI 96
           K   ++ I+I+++ LE  DA + + F GNV +T+    +  D+M +     N   +    
Sbjct: 33  KADRDKPINIESNRLEYNDATKVSTFIGNVVLTKGTIRITGDRMVLTQVGRNAQTARVNG 92

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD-RADKVILKEKLNTFLGCKLIVN 155
           N+    +        I+ +A   + D +   + L G  R  +    + ++   G  ++ +
Sbjct: 93  NQASFRQKRDGMEQYIHGVADQIFYDTRTEQVTLTGRARLQRQNCNQPVDEITGGHIVYS 152

Query: 156 IDTSFASLQGC----ESDQVQSIIRY 177
             T   S+ G        +V+ +I+ 
Sbjct: 153 ASTETFSVDGQQRGERPGRVRIVIQP 178


>gi|330501874|ref|YP_004378743.1| OstA family protein [Pseudomonas mendocina NK-01]
 gi|328916160|gb|AEB56991.1| OstA family protein [Pseudomonas mendocina NK-01]
          Length = 179

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 57/154 (37%), Gaps = 19/154 (12%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             ++ I I+AD  E+ D    A ++G+V +TQ    +  D +TI      +  S  I+  
Sbjct: 28  DRDQPIRIQADSAELDDKQGVAVYRGDVIITQGTLKITGDTVTIT-----QTASGDIDVF 82

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK-----LNTFLGCKLIV 154
               N  +   E         V    + +         V++ +       NTF G K++ 
Sbjct: 83  TSVGN--LAYYEQKPAVDKDIVKAYGKTIQYFASNERIVLIDQAKVIQEGNTFEGEKIVY 140

Query: 155 N-----IDTSFASLQ--GCESDQVQSIIRYDGRP 181
           +     ++   A+         ++  +I+   +P
Sbjct: 141 DTRRQIVNAGRATGGNVSTPRPRIDMVIQPKNKP 174


>gi|315636941|ref|ZP_07892165.1| OstA family protein [Arcobacter butzleri JV22]
 gi|315478771|gb|EFU69480.1| OstA family protein [Arcobacter butzleri JV22]
          Length = 164

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/137 (18%), Positives = 48/137 (35%), Gaps = 8/137 (5%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN-- 104
           I A   +  D    + F GNV +   +  L A ++ + +    +  +    R +      
Sbjct: 24  IDAQDFQADDKKGISIFTGNVKIKMGEDKLNAQRVDVFFETDKKTNNKTPLRYEATGKAD 83

Query: 105 --IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT-FLGCKLIVNIDTSFA 161
             I  +               QK    + G+     I ++  +    G  + VN  +  A
Sbjct: 84  FEIVTKDKHYIGNGDKIIYSPQKEEYTIIGNGF---IHEQNDDRKIYGDTIYVNQLSGEA 140

Query: 162 SLQGCESDQVQSIIRYD 178
            ++G E+  V+ II  D
Sbjct: 141 KVKGSENKPVKFIINVD 157


>gi|261379304|ref|ZP_05983877.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           subflava NJ9703]
 gi|284797744|gb|EFC53091.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           subflava NJ9703]
          Length = 176

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 57/161 (35%), Gaps = 15/161 (9%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A ++  AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +T+
Sbjct: 10  ALVAVFAASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSVTV 69

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK-- 141
             N+ +  +      M    +         +    G V+ Q    V+    A+ V L   
Sbjct: 70  SRNDKSEQL------MKATGS--PVKFSQELDGGKGVVNGQANT-VMYSSAANLVTLSGN 120

Query: 142 ----EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                  +   G  +  N  T   ++ G     V+S  +  
Sbjct: 121 AKVQRGGDVAEGAVITYNTKTEVYTINGSAKSGVKSAAKSG 161


>gi|34558351|ref|NP_908166.1| hypothetical protein WS2067 [Wolinella succinogenes DSM 1740]
 gi|34484070|emb|CAE11066.1| conserved hypothetical protein [Wolinella succinogenes]
          Length = 181

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 61/147 (41%), Gaps = 17/147 (11%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I A      +A +     G+V + + D  L  DK+T+ +++ NR +     + + + N
Sbjct: 24  VEITAKHFVADEAKKTTLITGDVVVVRGDDRLITDKLTVFFDDKNRPL-----KYEAQGN 78

Query: 105 I--FIQSGEINVI---ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
           +   I   +   +   ++N   D  K    L G+   + I K   NT  G K+I+N  + 
Sbjct: 79  VKFAITLADGRKLKGYSNNALYDAPKNEYHLLGNAFMEEIGK--SNTVKGEKIIINRVSG 136

Query: 160 FASLQGCESDQVQSII-----RYDGRP 181
           FA++ G      + I          RP
Sbjct: 137 FANVVGDSQKPAKLIFIFEEDESKKRP 163


>gi|240116369|ref|ZP_04730431.1| hypothetical protein NgonPID1_09066 [Neisseria gonorrhoeae PID18]
 gi|240128868|ref|ZP_04741529.1| hypothetical protein NgonS_09638 [Neisseria gonorrhoeae SK-93-1035]
 gi|260439812|ref|ZP_05793628.1| hypothetical protein NgonDG_01757 [Neisseria gonorrhoeae DGI2]
 gi|268602036|ref|ZP_06136203.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268687250|ref|ZP_06154112.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043082|ref|ZP_06568805.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268586167|gb|EEZ50843.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268627534|gb|EEZ59934.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012688|gb|EFE04671.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 176

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 57/159 (35%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNT 88
           A S     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  ATSPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVIIRQGTLNISASRVNVTRGGKG 75

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              V  + + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          ++ +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSTKSGAKSASKTGRVSVVIQPS 170


>gi|238756129|ref|ZP_04617450.1| hypothetical protein yruck0001_2840 [Yersinia ruckeri ATCC 29473]
 gi|238705668|gb|EEP98064.1| hypothetical protein yruck0001_2840 [Yersinia ruckeri ATCC 29473]
          Length = 165

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 54/156 (34%), Gaps = 14/156 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           AA+          ++ I+I +D   +      A F  NV + Q    ++AD+M I     
Sbjct: 2   AASVPALALTGDTDQPINITSDKQALDMTGNTATFTDNVIVKQGSIEIKADRMVISRPGG 61

Query: 89  NRDVS------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
           ++  +      N +    ++ N     G           +  K  ++L GD      L++
Sbjct: 62  DQSKTVIEGFGNPVTFYQMQDNGKPVKGH----GQKLRYEVAKEFVILTGDAY----LEQ 113

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   G K+   +          +  +V +++   
Sbjct: 114 LDSNIKGDKITYLVKEQQMEAFSDKGKRVTTVLLPS 149


>gi|157737226|ref|YP_001489909.1| OstA family protein [Arcobacter butzleri RM4018]
 gi|157699080|gb|ABV67240.1| OstA family protein [Arcobacter butzleri RM4018]
          Length = 164

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/137 (18%), Positives = 48/137 (35%), Gaps = 8/137 (5%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN-- 104
           I A   +  D    + F GNV +   +  L A ++ + +    +  +    R +      
Sbjct: 24  IDAQDFQADDKKGISIFTGNVKIKMGEDKLNAQRVDVFFETDKKTNNKTPLRYEATGKAD 83

Query: 105 --IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT-FLGCKLIVNIDTSFA 161
             I  +               QK    + G+     I ++  +    G  + VN  +  A
Sbjct: 84  FEIVTKDKHYVGNGDKIIYSPQKEEYTIIGNGF---IHEQNDDRKIYGDTIYVNQLSGEA 140

Query: 162 SLQGCESDQVQSIIRYD 178
            ++G E+  V+ II  D
Sbjct: 141 KVKGSENKPVKFIINVD 157


>gi|300718611|ref|YP_003743414.1| ABC transporter substrate-binding protein [Erwinia billingiae
           Eb661]
 gi|299064447|emb|CAX61567.1| ABC transporter, solute-binding protein [Erwinia billingiae Eb661]
          Length = 182

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 53/149 (35%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ +++ ++   +      A F GNV +TQ    + ADK+ +    T  D  +K
Sbjct: 26  ALTGDSDKPVNVDSENQALDMQGNVATFTGNVIVTQGSIKITADKVVV----TRPDGDSK 81

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +D   N      +      +   A   + +  K  + L G+      L++  +   G
Sbjct: 82  KTIVDAYGNPATFYQMQDNGKPVKGHAQKMHYELAKDFVELTGNAY----LEQLDSNVKG 137

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   +        G    +V +I+   
Sbjct: 138 DRITYLVKDQKMQAYGSSGKRVTTILVPS 166


>gi|289207553|ref|YP_003459619.1| lipopolysaccharide transport periplasmic protein LptA
           [Thioalkalivibrio sp. K90mix]
 gi|288943184|gb|ADC70883.1| lipopolysaccharide transport periplasmic protein LptA
           [Thioalkalivibrio sp. K90mix]
          Length = 174

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 55/142 (38%), Gaps = 17/142 (11%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I AD  E+ D    + + G+V + + D +L+ADK+ +      R    +   M+   
Sbjct: 37  PVEITADRAEMDDRRGVSTYTGDVVVIRGDMTLEADKVYV------RSRDRRPYEMEAHG 90

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL------GCKLIVNID 157
                                +   +L     D+VIL ++ +         G +++ +++
Sbjct: 91  EPARLESPDPETGEMRIATALRIDYLL---NEDRVILTDQAHVITAAEEARGKRIVYDLE 147

Query: 158 TSFASLQGCESD--QVQSIIRY 177
           T     +  E+D  +V+  I+ 
Sbjct: 148 TDVIEAERGEADDERVRIRIQP 169


>gi|7388537|sp|Q52784|YNTX_RHIET RecName: Full=Uncharacterized protein in rpoN-linked probable
           transport protein 5'region
 gi|1046229|gb|AAA80298.1| unknown [Rhizobium leguminosarum bv. phaseoli]
          Length = 54

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
            +KVIL +  N F GCKL V++ T  A L+ C   +VQ  +    +P
Sbjct: 1   GNKVILSDGPNVFTGCKLTVHMQTGQAELESC-GGRVQIQLDPKSQP 46


>gi|167625608|ref|YP_001675902.1| cell envelope biogenesis YhbN [Shewanella halifaxensis HAW-EB4]
 gi|167355630|gb|ABZ78243.1| Cell envelope biogenesis YhbN [Shewanella halifaxensis HAW-EB4]
          Length = 185

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 48/144 (33%), Gaps = 17/144 (11%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           +++ I A   E      +  F G V +TQ    + ADK+ +         +     +   
Sbjct: 28  QEVKIAAASQEADIKNNQVIFFGPVEVTQGSIKMNADKLRVFSKEDKSGKT-----LVAT 82

Query: 103 RN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
            N      I          A     +   R L L GD      L +  +   G ++  NI
Sbjct: 83  GNPATYTQIMDDGRPATASAKEIRYELATRTLTLVGDAT----LAQDGSQVTGNRIKYNI 138

Query: 157 DTSF--ASLQGCESDQVQSIIRYD 178
                 A   G   D+V +II+ +
Sbjct: 139 SLQQLIAESSGKGDDRVITIIQPE 162


>gi|37527891|ref|NP_931236.1| hypothetical protein plu4039 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787327|emb|CAE16411.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 177

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 50/149 (33%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I I +    +      A F  +V + Q    ++ADK+ +    T  D  +K
Sbjct: 23  ALKDDTQKPISIDSAKQALDMTGNTATFTEDVIVKQGSIDIRADKVVV----TRPDGDSK 78

Query: 96  INRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N             I    +    +  K ++ L G+      L++  +   G
Sbjct: 79  KMVIEAFGNPVTFYQLQDNGKPIKGRGAKMRYEMDKELVTLTGNAY----LEQLDSNIKG 134

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   + T        +  +V +++   
Sbjct: 135 DRITYLVPTQQMEAFSDKGKRVTTVLLPS 163


>gi|319639071|ref|ZP_07993828.1| hypothetical protein HMPREF0604_01452 [Neisseria mucosa C102]
 gi|317399649|gb|EFV80313.1| hypothetical protein HMPREF0604_01452 [Neisseria mucosa C102]
          Length = 176

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 61/156 (39%), Gaps = 5/156 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A ++  AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +T+
Sbjct: 10  ALVAVFAASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSVTV 69

Query: 84  DY-NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
              + + + +    + +   + +    G +N  A+         ++ L+G+      ++ 
Sbjct: 70  SRNDKSEQLMKATGSPVKFSQELDGGKGVVNGQANTVTYSSAANLVTLSGNAK----VQR 125

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   G  +  N  T   ++ G     V+S  +  
Sbjct: 126 GGDVAEGAVITYNTKTEVYTINGSAKSGVKSAAKSG 161


>gi|258544361|ref|ZP_05704595.1| lipopolysaccharide transport periplasmic protein LptA/YhbN
           [Cardiobacterium hominis ATCC 15826]
 gi|258520441|gb|EEV89300.1| lipopolysaccharide transport periplasmic protein LptA/YhbN
           [Cardiobacterium hominis ATCC 15826]
          Length = 160

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 42/120 (35%), Gaps = 16/120 (13%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            I++KAD  E       A + GNV +TQ + +L+ DK+ I      R    KI+ ++   
Sbjct: 33  PINLKADSGEYDANAGIATYTGNVVVTQGEMNLKGDKIVI------RLQEGKIHSIESWG 86

Query: 104 N------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
                  +  +   I+              +    +      +K+  N      +  ++ 
Sbjct: 87  KPTTFHYVPAKEPPIDGSGQYMKYTVPTSTV----EIDKNAHVKQDKNETRADHITYDLK 142



 Score = 40.0 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 20/50 (40%), Gaps = 4/50 (8%)

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
            IN+ A +G  D    I    G+    V++ +      G K+++ +    
Sbjct: 33  PINLKADSGEYDANAGIATYTGN----VVVTQGEMNLKGDKIVIRLQEGK 78


>gi|319940820|ref|ZP_08015159.1| hypothetical protein HMPREF9464_00378 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805702|gb|EFW02483.1| hypothetical protein HMPREF9464_00378 [Sutterella wadsworthensis
           3_1_45B]
          Length = 198

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 56/155 (36%), Gaps = 19/155 (12%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN---RDVSN 94
               ++ I + AD  +  +  Q A + GNV + Q    +   ++ +           V+ 
Sbjct: 23  STDRDQAIEVHADRFDGDEVKQTAVYTGNVIVDQGSMQITGARLEVRITPKGYRQATVTG 82

Query: 95  KINRMDVERNIFIQSGEIN---VIASNGYVDFQKRILVLNGDRADKVILKEKLN-----T 146
           + +R   +R+   ++         AS    D +   + L G       L    N      
Sbjct: 83  EPSRFRQQRDPDPKNPINEWMHARASKIVYDEETDTVTLIG----AAYLSRTENGKERDM 138

Query: 147 FLGCKLIVNIDTSFASLQGC----ESDQVQSIIRY 177
             G +++ ++  + + ++G     E  +V +II  
Sbjct: 139 TEGERIVYDMRNARSKVEGSTVKGEKQRVTTIIAP 173


>gi|240124201|ref|ZP_04737157.1| hypothetical protein NgonP_09739 [Neisseria gonorrhoeae PID332]
 gi|240126403|ref|ZP_04739289.1| hypothetical protein NgonSK_09399 [Neisseria gonorrhoeae SK-92-679]
 gi|268682827|ref|ZP_06149689.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684988|ref|ZP_06151850.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268623111|gb|EEZ55511.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268625272|gb|EEZ57672.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
          Length = 176

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 56/159 (35%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNT 88
           A S     +      I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  ATSPAFALQSDSRRPIQIEADQGSLDQANQSTTFSGNVIIRQGTLNISASRVNVTRGGKG 75

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              V  + + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----MQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          ++ +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSTKSGAKSASKTGRVSVVIQPS 170


>gi|149200199|ref|ZP_01877222.1| hypothetical protein LNTAR_24611 [Lentisphaera araneosa HTCC2155]
 gi|149136736|gb|EDM25166.1| hypothetical protein LNTAR_24611 [Lentisphaera araneosa HTCC2155]
          Length = 162

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 52/130 (40%), Gaps = 11/130 (8%)

Query: 37  FKVLGNEKIHIKADMLEV--KDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
            K    E++ I +D L+   +D  + A F+ NV +T+    + A KMT   N       N
Sbjct: 28  DKKANVEEVIITSDTLDFFNQDKKRMAIFEHNVHVTRGKMIMTAKKMTCYLN-----AKN 82

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
           +I+ +  E ++ I   +    +       +++ ++L      K ++    N     ++ +
Sbjct: 83  EIHLIIAEGDVIITEEDKKSTSEKVAYSPKEKKIIL----IRKPVIYMNENKIEARRITI 138

Query: 155 NIDTSFASLQ 164
             ++      
Sbjct: 139 YQESGEVFFD 148


>gi|326560507|gb|EGE10889.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 7169]
 gi|326565763|gb|EGE15925.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis BC1]
          Length = 175

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+ + +L++  +  V ++  A                 N+ I + AD     +      +
Sbjct: 5   FVITKYLFLACIVSVPMIASA------------LPSDANQPIRLLADRATYSERTGVTTY 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIASNGY 120
            G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A+   
Sbjct: 53  SGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGRPATIQQVVTQEKGLAKGQANRID 112

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +    I+ L G+      L +  ++F G  +  ++             +V+ +    
Sbjct: 113 YNAVSGIVTLIGNAK----LTQAGSSFSGNTIRYSLSVGDVEANAGGGQRVELVFPPS 166


>gi|326564160|gb|EGE14396.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 12P80B1]
 gi|326570414|gb|EGE20454.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis BC8]
 gi|326571099|gb|EGE21123.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis BC7]
          Length = 175

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+ + +L++  +  + ++  A                 N+ I + A+     +      +
Sbjct: 5   FVITKYLFLSCIVSIPMIASA------------LPSDTNQPIRLLANRATYSERTGVTTY 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIASNGY 120
            G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A+   
Sbjct: 53  SGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGQPATIQQVVTQEKGLAKGQANRID 112

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +    I+ L G+      L +  ++F G  +  ++             +V+ +    
Sbjct: 113 YNAVSGIVTLTGNAK----LTQAGSSFSGNTIRYSLSVGDVEANAGGGQRVELVFPPS 166


>gi|241760827|ref|ZP_04758918.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           flavescens SK114]
 gi|241318724|gb|EER55276.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           flavescens SK114]
          Length = 176

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 5/150 (3%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNT 88
           AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +T+   + +
Sbjct: 16  AASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSVTVSRNDKS 75

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            + +    + +   + +    G +N  A+         ++ L G+      ++   +   
Sbjct: 76  EQLMKATGSPVKFSQELDGGKGVVNGQANTVTYSSAASLVTLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G  +  N  T   ++ G     V+S  +  
Sbjct: 132 GAVITYNTKTEVYTINGSAKSGVKSAAKSG 161


>gi|28899442|ref|NP_799047.1| ABC transporter [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840279|ref|ZP_01992946.1| cell envelope biogenesis protein YhbN [Vibrio parahaemolyticus
           AQ3810]
 gi|260363389|ref|ZP_05776241.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus K5030]
 gi|260879324|ref|ZP_05891679.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AN-5034]
 gi|260895717|ref|ZP_05904213.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus Peru-466]
 gi|260900290|ref|ZP_05908685.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AQ4037]
 gi|28807678|dbj|BAC60931.1| putative ABC superfamily transport protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746058|gb|EDM57188.1| cell envelope biogenesis protein YhbN [Vibrio parahaemolyticus
           AQ3810]
 gi|308087415|gb|EFO37110.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus Peru-466]
 gi|308093097|gb|EFO42792.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AN-5034]
 gi|308107556|gb|EFO45096.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AQ4037]
 gi|308111173|gb|EFO48713.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus K5030]
 gi|328471421|gb|EGF42316.1| ABC transporter [Vibrio parahaemolyticus 10329]
          Length = 164

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 54/149 (36%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +      +  
Sbjct: 20  ALKSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPK----TEA 75

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I ++           +      ++  A+          L + G       L +  NT  G
Sbjct: 76  IKQIQAFGKPATFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDGNTIKG 131

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   I          ++++V +I++ +
Sbjct: 132 SSIRYQIGQQKLVADSSKNERVTTILQPN 160


>gi|269137857|ref|YP_003294557.1| putative lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Edwardsiella tarda
           EIB202]
 gi|267983517|gb|ACY83346.1| putative lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Edwardsiella tarda
           EIB202]
 gi|304557910|gb|ADM40574.1| LptA [Edwardsiella tarda FL6-60]
          Length = 185

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 49/146 (33%), Gaps = 14/146 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
              ++ IHI +    +      A F G+V +TQ    + ADK+ +    T  +       
Sbjct: 31  GDTDQPIHINSMQQSLDMQGNVATFTGDVIVTQGTIKITADKVVV----TRPNGQQGSEI 86

Query: 99  MDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           ++   N             +   +     +  K  ++L G    K  LK+  +   G ++
Sbjct: 87  VEAYGNPVTFYQMQDNGKPVEGHSQQLRYELAKDYVILTG----KAFLKQLDSNIEGDRI 142

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
              +          +  +V +++   
Sbjct: 143 TYLVKQQQMEAFSDKGKRVTTVLLPS 168


>gi|226943409|ref|YP_002798482.1| LPS transport protein LptA [Azotobacter vinelandii DJ]
 gi|226718336|gb|ACO77507.1| LPS transport protein LptA [Azotobacter vinelandii DJ]
          Length = 184

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 62/160 (38%), Gaps = 15/160 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN- 89
           A+         ++ I ++AD  E+ D    A + G+V +TQ    +  +K+TI  ++   
Sbjct: 23  AASAWALSSDRDQPIRVQADSAELDDKQGVAVYHGDVVITQGTLKITGNKVTITQDDNGD 82

Query: 90  -RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            +  ++  N    E+        +           +   +VL     DK  + +  NTF 
Sbjct: 83  IKVFTSVGNPAYYEQKPAPDKSVVKAYGQTIQYFAENERIVL----IDKARVIQDGNTFE 138

Query: 149 GCKLIVN-----IDTSF---ASLQGCESDQVQSIIRYDGR 180
           G K++ +     ++      A +   +  ++  +I+   +
Sbjct: 139 GEKIVYDTQRQIVNAGRATGAKVTSPK-PRIDMVIQPKKK 177


>gi|224826290|ref|ZP_03699392.1| lipopolysaccharide transport periplasmic protein LptA [Lutiella
           nitroferrum 2002]
 gi|224601391|gb|EEG07572.1| lipopolysaccharide transport periplasmic protein LptA [Lutiella
           nitroferrum 2002]
          Length = 173

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 56/164 (34%), Gaps = 10/164 (6%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           + L       +A+     K   ++ I I A+   +        ++GNV +TQ    + AD
Sbjct: 7   LTLAVLAGLCSATAALAEKADQSKPIEINANSGTLDQLKGHTVWEGNVVVTQGTLRVNAD 66

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKV 138
           ++ +  ++          ++   R       E I   AS           VL G+   K 
Sbjct: 67  RVVVTRDDKGNQTVQATGKVVTFRQKMDGKDEYIEGQASRLDYTGITNTAVLTGNARVK- 125

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCES-----DQVQSIIRY 177
                 +  +G  +  N  +    ++G  +      ++  I++ 
Sbjct: 126 ---RGEDLVIGDVITYNTQSQTYQVKGGAATGPNKGRITVILQP 166


>gi|323498691|ref|ZP_08103681.1| hypothetical protein VISI1226_21881 [Vibrio sinaloensis DSM 21326]
 gi|323316247|gb|EGA69268.1| hypothetical protein VISI1226_21881 [Vibrio sinaloensis DSM 21326]
          Length = 165

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 54/149 (36%), Gaps = 15/149 (10%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  +  +      
Sbjct: 20  ALSSDQQQPVYIDSDSQQLDMQSNQVTFLGDVKLKQGSININADKIVVTRDPKD----GS 75

Query: 96  INRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I  +D   N+   S        +   A           L +        +L +  +T  G
Sbjct: 76  IKNIDGFGNLATFSQLTDDGKTLYGEAKELQYSLANDQLTM----RYSAMLSQDDSTIRG 131

Query: 150 CKLIVNIDTSFASLQG-CESDQVQSIIRY 177
            ++  +I +      G  + D+V ++++ 
Sbjct: 132 NQIRYHISSQKLVADGKSKGDRVSTVLQP 160


>gi|332974674|gb|EGK11591.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Kingella kingae ATCC
           23330]
          Length = 171

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 59/174 (33%), Gaps = 24/174 (13%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +L A L+  ++ ++        + I I+AD   +    Q   F GNV +TQ    ++A 
Sbjct: 8   AVLAAILA-TSSLHVHALDSDRKQPIAIEADQGSLDQKNQVTVFSGNVLVTQGSLHMKAQ 66

Query: 80  KMTIDYNNTNRDVSNKINRMDVERN-IFI------QSGEINVIASNGYVDFQKRILVLNG 132
              +  +            M    N ++         G      S    D  + ++ L G
Sbjct: 67  NARVSQDKNGNQT------MVATGNPVYFRQQLEGNKGIAEGWGSRAEYDSARNLVKLIG 120

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC------ESDQVQSIIRYDGR 180
           +      ++   +   G  +  N  T   ++ G       +  +V  II+   +
Sbjct: 121 NAK----VQRGGDMAQGEAISYNTQTEIYTVLGGNAVGNKKGRRVTVIIQPSQK 170


>gi|283476808|emb|CAY72646.1| LPS export porin complex, periplasmic chaparone precursor [Erwinia
           pyrifoliae DSM 12163]
          Length = 183

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 52/149 (34%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 N+ ++I ++   +      A F GNV +TQ    + ADK+ +    T     +K
Sbjct: 27  ALTGDSNKPVNIDSENQALDMQGNVATFTGNVVVTQGSIKITADKVVV----TRPGGDSK 82

Query: 96  INRMDVERNI------FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +D   N+            +   A   + +    ++ L G+      L++  +   G
Sbjct: 83  KTIVDAYGNLATFYQMQDNGKPVQGHAQKMHYELASDLVELTGNAY----LEQLDSNVKG 138

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   +        G    +V +++   
Sbjct: 139 DRITYLVKEQKMQAFGNTGRRVTTVLVPS 167


>gi|161870714|ref|YP_001599887.1| hypothetical protein NMCC_1787 [Neisseria meningitidis 053442]
 gi|161596267|gb|ABX73927.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 156

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 56/152 (36%), Gaps = 14/152 (9%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD-VSNK 95
            +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +  N+     +   
Sbjct: 3   LQSDSRQPIQIEADQGSLNQANQSTTFSGNVVIRQGTLNISAARVNVTRNDKGEQFMKAD 62

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
            + +   + +    G +   A+N         +VL G+      ++   +   G  +  N
Sbjct: 63  GSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRGGDVAEGAVITYN 118

Query: 156 IDTSFASLQG---------CESDQVQSIIRYD 178
             T   ++ G          +S +V  II+  
Sbjct: 119 TKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 150


>gi|293394217|ref|ZP_06638517.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Serratia odorifera DSM
           4582]
 gi|291423195|gb|EFE96424.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Serratia odorifera DSM
           4582]
          Length = 168

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 55/165 (33%), Gaps = 16/165 (9%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           ++    L+ +A +     K   ++ + I +    +      + F  NV + Q    ++AD
Sbjct: 1   MIASTVLAVSAPAL--ALKSDSDQPVSIDSLKQALDMQSNVSTFTDNVVIKQGTIEIKAD 58

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGD 133
           K+ +    T          ++                 +   A     D   +++ L G+
Sbjct: 59  KVVV----TRPGGDQNKTYIEAFGKPVTFYQMQDNGKPVKGHAQKVRYDVAPQLVTLTGN 114

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                 L++  +   G ++   +          + ++V++++   
Sbjct: 115 AY----LEQLDSNVKGDRITYLVQQQQMQAYSDKGNRVKTVLVPS 155


>gi|152992814|ref|YP_001358535.1| hypothetical protein SUN_1224 [Sulfurovum sp. NBC37-1]
 gi|151424675|dbj|BAF72178.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 157

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 57/141 (40%), Gaps = 16/141 (11%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM-DV 101
           EK+ + +D ++ +D  ++  F GNV + Q D  L  DK+ + ++  N        RM + 
Sbjct: 19  EKVEVTSDSMKAEDLKKEVHFIGNVKIKQLDSWLHGDKVIVYFDENNET------RMYEA 72

Query: 102 ERN-------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +  + G     A N          VL G      +L ++     G  +++
Sbjct: 73  VGKDNVVTFEVKEKKGFYKGSALNVKYYPLTSKYVLTGKAVIDDLLNKRH--IDGDVIVL 130

Query: 155 NIDTSFASLQGCESDQVQSII 175
           ++ T  A+++G     V+ I 
Sbjct: 131 DMTTGNATVKGSRKKPVKFIF 151


>gi|323491750|ref|ZP_08096927.1| hypothetical protein VIBR0546_01084 [Vibrio brasiliensis LMG 20546]
 gi|323314006|gb|EGA67093.1| hypothetical protein VIBR0546_01084 [Vibrio brasiliensis LMG 20546]
          Length = 165

 Score = 62.3 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 57/154 (37%), Gaps = 15/154 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +S          + ++I +D  ++     K  F G+V + Q   ++ ADK+ +  +  + 
Sbjct: 15  SSQALALSTDQEQPVYIDSDSQQLDMQSNKVTFIGDVKLKQGSININADKVIVTRDPKD- 73

Query: 91  DVSNKINRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                I  ++   ++   S        +   A   Y       L +     D+ +L +  
Sbjct: 74  ---GSIQEIEGYGDLATFSQLTDDGKTLYGEAKELYYVMVDDQLTM----IDQAMLSQDD 126

Query: 145 NTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
           +   G K+   I +      G  + D+V ++++ 
Sbjct: 127 SVIRGTKIRYKISSQKLIADGKDKGDRVSTVLQP 160


>gi|59801934|ref|YP_208646.1| hypothetical protein NGO1606 [Neisseria gonorrhoeae FA 1090]
 gi|194099432|ref|YP_002002534.1| hypothetical protein NGK_1909 [Neisseria gonorrhoeae NCCP11945]
 gi|239999670|ref|ZP_04719594.1| hypothetical protein Ngon3_09347 [Neisseria gonorrhoeae 35/02]
 gi|240014847|ref|ZP_04721760.1| hypothetical protein NgonD_09444 [Neisseria gonorrhoeae DGI18]
 gi|240017293|ref|ZP_04723833.1| hypothetical protein NgonFA_09052 [Neisseria gonorrhoeae FA6140]
 gi|240081067|ref|ZP_04725610.1| hypothetical protein NgonF_07107 [Neisseria gonorrhoeae FA19]
 gi|240113277|ref|ZP_04727767.1| hypothetical protein NgonM_06831 [Neisseria gonorrhoeae MS11]
 gi|240118657|ref|ZP_04732719.1| hypothetical protein NgonPID_09413 [Neisseria gonorrhoeae PID1]
 gi|240121366|ref|ZP_04734328.1| hypothetical protein NgonPI_06299 [Neisseria gonorrhoeae PID24-1]
 gi|254494386|ref|ZP_05107557.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268595483|ref|ZP_06129650.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597178|ref|ZP_06131345.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599357|ref|ZP_06133524.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268604370|ref|ZP_06138537.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|293398420|ref|ZP_06642598.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           gonorrhoeae F62]
 gi|59718829|gb|AAW90234.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934722|gb|ACF30546.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226513426|gb|EEH62771.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548872|gb|EEZ44290.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550966|gb|EEZ45985.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583488|gb|EEZ48164.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268588501|gb|EEZ53177.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|291610891|gb|EFF39988.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           gonorrhoeae F62]
 gi|317164933|gb|ADV08474.1| hypothetical protein NGTW08_1514 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 176

 Score = 62.3 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 56/159 (35%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNT 88
           A S     +      I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  ATSPAFALQSDSRRPIQIEADQGSLDQANQSTTFSGNVIIRQGTLNISASRVNVTRGGKG 75

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              V  + + +   + +    G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          ++ +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSTKSGAKSASKTGRVSVVIQPS 170


>gi|238918525|ref|YP_002932039.1| lipopolysaccharide transport periplasmic protein LptA,
           [Edwardsiella ictaluri 93-146]
 gi|238868093|gb|ACR67804.1| lipopolysaccharide transport periplasmic protein LptA, putative
           [Edwardsiella ictaluri 93-146]
          Length = 185

 Score = 62.3 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 49/146 (33%), Gaps = 14/146 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
              ++ IHI +    +      A F G+V +TQ    + ADK+ I    T  +       
Sbjct: 31  GDTDQPIHINSMQQSLDMQGNVATFTGDVIVTQGTIKITADKVVI----TRPNGQQGSEI 86

Query: 99  MDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           ++   N             +   +     +  K  ++L G    K  LK+  +   G ++
Sbjct: 87  VEAYGNPVTFYQMQDNGKPVEGHSQQLRYELAKDYVILTG----KAFLKQLDSNIEGDRI 142

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
              +          +  +V +++   
Sbjct: 143 TYLVKQQQMEAFSDKGKRVTTVLLPS 168


>gi|126668777|ref|ZP_01739725.1| hypothetical protein MELB17_07229 [Marinobacter sp. ELB17]
 gi|126626760|gb|EAZ97409.1| hypothetical protein MELB17_07229 [Marinobacter sp. ELB17]
          Length = 193

 Score = 62.3 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 58/152 (38%), Gaps = 18/152 (11%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
            F +  N  I++ A+   + DA   A + G+V + Q D  L A ++ +  +       N 
Sbjct: 37  AFDLDSNIPINVAANSARLDDAKGVATYTGDVELVQGDTKLFAQEVVLYRD------ING 90

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD-----KVILKEKLNTFLGC 150
           +NR++                  G  D +   +  +            ++++  N F G 
Sbjct: 91  LNRIEATG--TPAHYVQPTANGKGETDAKALTITWSAAEKQLTFERDAVIRQTGNIFRGE 148

Query: 151 KLIVN----IDTSFASLQ-GCESDQVQSIIRY 177
            ++ +    + T+  S + G  S +V+  I+ 
Sbjct: 149 LILYDTVNRVVTAQGSTEAGSGSGRVEMTIQP 180


>gi|330993406|ref|ZP_08317341.1| hypothetical protein SXCC_03304 [Gluconacetobacter sp. SXCC-1]
 gi|329759436|gb|EGG75945.1| hypothetical protein SXCC_03304 [Gluconacetobacter sp. SXCC-1]
          Length = 420

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 35/95 (36%), Gaps = 4/95 (4%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           ++     +  I+ +D   +I I++    V    G       I  L G+    V +    N
Sbjct: 321 DDRPAPGAGTIDHVDAFGHIVIRTRTETVTGDRGVYVPDTGIARLVGN----VHITRGEN 376

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              G   IVN+ T  A+L      +V  ++  +  
Sbjct: 377 QVSGTSAIVNMHTDIATLTDNPGSRVSGLVIPNQA 411



 Score = 41.2 bits (95), Expect = 0.060,   Method: Composition-based stats.
 Identities = 6/51 (11%), Positives = 21/51 (41%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
           +++    ++++ R++   ++   +        +   D  + ILV+ G    
Sbjct: 193 DSSGPGGASEVYRLEALGHVHAFNTSDQAWGDHAVYDVDQAILVMTGQHLK 243


>gi|260779440|ref|ZP_05888331.1| LptA protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604530|gb|EEX30830.1| LptA protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 165

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 56/149 (37%), Gaps = 15/149 (10%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ ++I +D  ++     K  F G+V + Q   ++ ADK+ +  +  +      
Sbjct: 20  ALSTDQDQPVYIDSDSQQLDMQSNKVTFLGDVKLKQGSININADKVIVTRDPKD----GS 75

Query: 96  INRMDVERNIFIQS------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           I  ++   ++   S        +   A   Y       L +     D+ +L +  +   G
Sbjct: 76  IQEIEGYGDLATFSQLTDDGKTLYGEAKELYYVMVDDQLTM----IDEAMLSQDDSVIRG 131

Query: 150 CKLIVNIDTSFASLQGC-ESDQVQSIIRY 177
            K+   I +      G  + D+V ++++ 
Sbjct: 132 TKIRYKISSQKLIADGKEKGDRVSTVLQP 160


>gi|238022120|ref|ZP_04602546.1| hypothetical protein GCWU000324_02026 [Kingella oralis ATCC 51147]
 gi|237866734|gb|EEP67776.1| hypothetical protein GCWU000324_02026 [Kingella oralis ATCC 51147]
          Length = 176

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 47/150 (31%), Gaps = 11/150 (7%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +    + I I AD   +    Q   F GNV +TQ   +++A+ + +  +       N 
Sbjct: 24  ALESDRQQPISIDADQGSLDQKNQVTVFTGNVIITQGTLNMRANTVRVVQDQNGNQTMNA 83

Query: 96  INRMDVERNIFIQSGEINVI-ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                  R     +  I                + L G+      ++   +   G  +  
Sbjct: 84  QGSPVYFRQELDNNKGIAEGWGDRAEYASANHTVKLVGNAK----VRRGGDVATGNAISY 139

Query: 155 NIDTSFASLQGCES------DQVQSIIRYD 178
           N  T   ++ G  +       +V  +I+  
Sbjct: 140 NTQTEVYTVLGGNATGSKNNPRVHIVIQPS 169


>gi|152986998|ref|YP_001350369.1| hypothetical protein PSPA7_5033 [Pseudomonas aeruginosa PA7]
 gi|150962156|gb|ABR84181.1| cell envelope biogenesis protein YhbN [Pseudomonas aeruginosa PA7]
          Length = 175

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 73/186 (39%), Gaps = 24/186 (12%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+N++ L   L A    +L + L+ A  S          + I ++AD  E+ D    A +
Sbjct: 3   FVNTLPLVFGLTA----VLGSSLAWALPS-------DREQPIRVQADSAELDDKQGVAVY 51

Query: 64  KGNVFMTQEDFSLQADKMTIDYNN-TNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYV 121
           +G+V +TQ    L  + +T+  +   + +V   + R            ++          
Sbjct: 52  RGDVVVTQGSTRLTGNTVTLKRDKNGDVEVVTSVGRPAYYEQKPAPDKDVTKAYGLTIQY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN-----IDTSFASLQ--GCESDQVQSI 174
              +  +VL      KVI  ++ NTF G K++ +     ++   A+         ++  +
Sbjct: 112 FVTQNRVVLI--DQAKVI--QEGNTFEGEKIVYDTQRQIVNAGRATGSQVTSPRPRIDMV 167

Query: 175 IRYDGR 180
           I+   +
Sbjct: 168 IQPKKK 173


>gi|197287453|ref|YP_002153325.1| lipopolysaccharide transport periplasmic protein LptA [Proteus
           mirabilis HI4320]
 gi|227358285|ref|ZP_03842626.1| cell envelope biogenesis YhbN [Proteus mirabilis ATCC 29906]
 gi|194684940|emb|CAR47125.1| putative organic solvent tolerance protein [Proteus mirabilis
           HI4320]
 gi|227161621|gb|EEI46658.1| cell envelope biogenesis YhbN [Proteus mirabilis ATCC 29906]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 48/149 (32%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I + ++   +        F  NV + Q    ++ADK+ +    T     +K
Sbjct: 23  ALKDDTQQPIVVNSEKQSLNLEKNITTFTQNVVVKQGSIDIRADKVVV----TRPGGDSK 78

Query: 96  INRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N             I         +  K ++ L G    K  L++  +   G
Sbjct: 79  KIVIEAFGNPVTFYQLQDDGKPIKGRGDKMTYEMDKELVTLTG----KAYLEQLDSNITG 134

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            K+   + T        +  QV +++   
Sbjct: 135 DKITYLVPTQQMEAFSGKGKQVTTVLLPS 163


>gi|259907013|ref|YP_002647369.1| lipopolysaccharide transport periplasmic protein LptA [Erwinia
           pyrifoliae Ep1/96]
 gi|224962635|emb|CAX54090.1| ABC superfamily (Bind_prot) transport protein [Erwinia pyrifoliae
           Ep1/96]
          Length = 179

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 52/149 (34%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 N+ ++I ++   +      A F GNV +TQ    + ADK+ +    T     +K
Sbjct: 23  ALTGDSNKPVNIDSENQALDMQGNVATFTGNVVVTQGSIKITADKVVV----TRPGGDSK 78

Query: 96  INRMDVERNI------FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +D   N+            +   A   + +    ++ L G+      L++  +   G
Sbjct: 79  KTIVDAYGNLATFYQMQDNGKPVQGHAQKMHYELASDLVELTGNAY----LEQLDSNVKG 134

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   +        G    +V +++   
Sbjct: 135 DRITYLVKEQKMQAFGNTGRRVTTVLVPS 163


>gi|269960368|ref|ZP_06174742.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834979|gb|EEZ89064.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 164

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 53/147 (36%), Gaps = 14/147 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +      +  I 
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPK----TESIK 77

Query: 98  RMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           ++           +      ++  A+          L + G       L +  NT  G  
Sbjct: 78  QIQAFGKPAKFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDGNTIKGSS 133

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   I          + ++V +I++ +
Sbjct: 134 IRYQIGQQKLVADSSKDERVTTILQPN 160


>gi|258542095|ref|YP_003187528.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633173|dbj|BAH99148.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636230|dbj|BAI02199.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639285|dbj|BAI05247.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642339|dbj|BAI08294.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645394|dbj|BAI11342.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648449|dbj|BAI14390.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651502|dbj|BAI17436.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654493|dbj|BAI20420.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-12]
          Length = 775

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 40/110 (36%), Gaps = 3/110 (2%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYM---TRFKVLGNEKIHIKADMLEVKDAV 58
           S    +  L      L+F L K   +Q     M   T      +E    +AD ++  D  
Sbjct: 15  STLSAATALGSMAACLLFSLPKHAHAQFRPQVMHLDTGRPTSPDEPATFQADKVDYNDVE 74

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ 108
               + GNV + Q D  L+AD++  D +         +  +  + ++   
Sbjct: 75  HTVTWTGNVQVWQGDHVLRADRIVYDRDTGVMAARGNVATIQPDGSVLYT 124



 Score = 40.0 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 26/75 (34%), Gaps = 11/75 (14%)

Query: 107 IQSGEINVI--ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
             S +      A     +  +  +   G+    V + +  +     +++ + DT   + +
Sbjct: 54  PTSPDEPATFQADKVDYNDVEHTVTWTGN----VQVWQGDHVLRADRIVYDRDTGVMAAR 109

Query: 165 GCESDQVQSIIRYDG 179
           G       + I+ DG
Sbjct: 110 GNV-----ATIQPDG 119


>gi|296115072|ref|ZP_06833714.1| hypothetical protein GXY_04809 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978409|gb|EFG85145.1| hypothetical protein GXY_04809 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 488

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 49/143 (34%), Gaps = 16/143 (11%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN------------RDVSNKIN 97
           D +E       +  +G+  +T  D       + + Y+                  +  I+
Sbjct: 341 DTVEYHSRDHMSVSRGDATLTTNDGRQMRADILVGYDRPKTARPPHTQAGHDAGGAGAID 400

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R+D   +I I++    V    G       I  + G+    V +   LN   G   IVN+ 
Sbjct: 401 RVDAFGHILIRTQSEAVTGDRGVYVPDSAIARIVGN----VHISRGLNQISGAAAIVNMR 456

Query: 158 TSFASLQGCESDQVQSIIRYDGR 180
           T  A+L      +V  ++  +  
Sbjct: 457 TGIATLTDTPGSRVSGLVVPNQA 479



 Score = 43.5 bits (101), Expect = 0.014,   Method: Composition-based stats.
 Identities = 6/51 (11%), Positives = 21/51 (41%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
           +++  +  +++ R++   ++ I +            D  + +LV+ G    
Sbjct: 279 DSSPGNGGSEVYRLEAVGHVHIFTNTDQAWGDRAVYDMDQAVLVMTGKNMK 329


>gi|237809671|ref|YP_002894111.1| lipopolysaccharide transport periplasmic protein LptA [Tolumonas
           auensis DSM 9187]
 gi|237501932|gb|ACQ94525.1| lipopolysaccharide transport periplasmic protein LptA [Tolumonas
           auensis DSM 9187]
          Length = 172

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 61/170 (35%), Gaps = 14/170 (8%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L +   +   +LL +  +QA  S          + + + +   E +    K  F  +V +
Sbjct: 3   LTLSHASFGLLLLLSVSAQAKQSDYQ-------QPVVVDSVSQEAELNENKVTFLQDVTI 55

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
           TQ    + ADK+ +  +    D      R      I      +N  AS      + R++ 
Sbjct: 56  TQGSIIIHADKVVVLRHEKGNDEMIATGRPATFFQILDNGKPVNASASELRYQLKDRLVT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRY 177
           L G    K  LK+  N   G  +  +I      A   G +  +V++I   
Sbjct: 116 LTG----KAELKQDDNQVNGDVIRYDIQKQQMIAQSSG-KGSRVKTIFLP 160


>gi|153834589|ref|ZP_01987256.1| cell envelope biogenesis protein YhbN [Vibrio harveyi HY01]
 gi|148869032|gb|EDL68077.1| cell envelope biogenesis protein YhbN [Vibrio harveyi HY01]
          Length = 164

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 53/147 (36%), Gaps = 14/147 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +      +  I 
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPK----TESIK 77

Query: 98  RMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           ++           +      ++  A+          L + G       L +  NT  G  
Sbjct: 78  QIQAFGKPATFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDGNTIKGSS 133

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   I          + ++V +I++ +
Sbjct: 134 IRYQIGQQKLVADSSKDERVTTILQPN 160


>gi|304569749|ref|YP_003858612.1| hypothetical protein DVU4008 [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 175

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/167 (16%), Positives = 60/167 (35%), Gaps = 17/167 (10%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           +    +Q  A+     K   +    + A  ++     Q   F+G+V++ + DF L + K+
Sbjct: 1   MPTACAQPKATANPAQK---SVPTTVTAQRMQYDANKQSVVFEGDVYVKRPDFELWSVKL 57

Query: 82  TIDYNNTNRDVSNK----------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
           T+    +    S            I R+  E+N+ +     N             ++++ 
Sbjct: 58  TLHLGKSKEGKSGGDVPGGMDAGEIERIVAEKNVRMVREGRNGTCQKATYTTNDGLMIME 117

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G      +L +K N   G  +      + + + G  S  V+++    
Sbjct: 118 GSP----VLFDKENVVKGEVIYFYTRENRSEVHGGTSRPVEAVFTSS 160


>gi|94501784|ref|ZP_01308297.1| hypothetical protein RED65_07609 [Oceanobacter sp. RED65]
 gi|94426092|gb|EAT11087.1| hypothetical protein RED65_07609 [Oceanobacter sp. RED65]
          Length = 173

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 56/150 (37%), Gaps = 6/150 (4%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            + +        ++I I +D   +     +  + GNV + Q    ++ADK+TI  + T  
Sbjct: 17  VAAVQALPEDTQQEIRIASDKAFLDKPKGELIYTGNVRLNQGSLKIEADKVTIIRDETGL 76

Query: 91  DVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                  +      +  Q  E             + + L L  +      L+++ N F G
Sbjct: 77  KQVVAEGKPARYEQVLNQDQEKTKAYGETIIYLTKSKQLTLLKNAG----LQKQGNEFSG 132

Query: 150 CKLIVNIDTSFASLQGC-ESDQVQSIIRYD 178
            +++  ID      +   E  +++ +I+ +
Sbjct: 133 ERIVYLIDQQKVKAESPQEDQRIRMVIQPE 162


>gi|296113133|ref|YP_003627071.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis RH4]
 gi|295920827|gb|ADG61178.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis RH4]
          Length = 155

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 53/147 (36%), Gaps = 7/147 (4%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
           +      N+ I + AD     +      + G V + Q    + AD +T++ +  NR + +
Sbjct: 4   SALPSDTNQPIRLLADRATYSERTGVTTYSGKVTIEQGTLKIAADNLTVNLDTNNRSIKS 63

Query: 95  KI---NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
            +       +++ +  + G     A+    +    I+ L G+      L +  ++F G  
Sbjct: 64  AVATGQPATIQQVVTQEKGLAKGQANRIDYNAVSGIVTLTGNAK----LTQAGSSFSGNT 119

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  ++             +V+ +    
Sbjct: 120 IRYSLSVGDVEANAGGGQRVELVFPPS 146


>gi|260775522|ref|ZP_05884419.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608703|gb|EEX34868.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio coralliilyticus ATCC BAA-450]
          Length = 789

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 54/136 (39%), Gaps = 17/136 (12%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            I+++AD LE  +  + A + GNV + Q    ++AD +T+          + I  +  E 
Sbjct: 64  PINVEADSLEAINGDK-ATYSGNVTVVQGKKRMKADNVTLH-------QQDNI--VVAEG 113

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTS 159
           N+    GE+  I+           + L  +   K + +             K +  I+  
Sbjct: 114 NVTFSDGELKTISDKAVNKLNTEEVTLE-NTNYKFLCEPGRGEAVYVSKTGKAVYEIEDG 172

Query: 160 --FASLQGCESDQVQS 173
              +  +G +S ++++
Sbjct: 173 TITSCPEGDKSWRMKA 188


>gi|157803764|ref|YP_001492313.1| hypothetical protein A1E_02940 [Rickettsia canadensis str. McKiel]
 gi|157785027|gb|ABV73528.1| hypothetical protein A1E_02940 [Rickettsia canadensis str. McKiel]
          Length = 145

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER- 103
           +HI +D L +    QKA + GNV +  ++  L+ +++ I Y     D    I+ + V   
Sbjct: 33  LHITSDTLIIDKTKQKAEYLGNVVVYFDNAILRTEELYIFYK--TIDEKQTIDHIIVPTK 90

Query: 104 -NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
            N+  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 91  LNVERKINNELLLADSAKYFFDNKQLILIGN----VILQRDDNVLKTNKLIYYVD 141


>gi|104780311|ref|YP_606809.1| hypothetical protein PSEEN1095 [Pseudomonas entomophila L48]
 gi|95109298|emb|CAK13995.1| conserved hypothetical protein; OstA family [Pseudomonas
           entomophila L48]
          Length = 174

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 69/178 (38%), Gaps = 19/178 (10%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L+  + +LL   ++  +AS         ++ I I+AD   + D    A + G+V +TQ  
Sbjct: 3   LVKTIPLLLSLGVALGSASAF-ALPNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGS 61

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             ++ + +T+      R  S  I+ +    N  +   E    A+         + +    
Sbjct: 62  MMIKGNTVTMT-----RAASGDIDVVTSVGN--LAYFEQQQSAAKPDKMKGWAVTIQYQA 114

Query: 134 RADKVILKEK------LNTFLGCKLIVNIDTSFASLQ-----GCESDQVQSIIRYDGR 180
           + D VIL ++       NT  G K++ N  T  A+            ++  +I+   +
Sbjct: 115 QKDMVILTDRAKVENEGNTTEGEKIVYNTKTQVATAGRGGNVTAPRQRIDMVIQPKKK 172


>gi|317178290|dbj|BAJ56079.1| hypothetical protein HPF16_1482 [Helicobacter pylori F16]
          Length = 185

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMNAQ--KTDNKGLKKER-ELLEITGNKFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|258541777|ref|YP_003187210.1| hypothetical protein APA01_06810 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632855|dbj|BAH98830.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635912|dbj|BAI01881.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638967|dbj|BAI04929.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642021|dbj|BAI07976.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645076|dbj|BAI11024.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648131|dbj|BAI14072.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651184|dbj|BAI17118.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654175|dbj|BAI20102.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 368

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/164 (13%), Positives = 53/164 (32%), Gaps = 25/164 (15%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN------ 89
             K+   + +    D +E     + +  +GN  +T  D       + + Y+         
Sbjct: 201 AMKLTTPQDVLTARDSMEYYSQQRISIGRGNATVTTNDQRQIRADVLVGYSAPPDQNAQP 260

Query: 90  ---------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
                             S K+ +++   ++++ +    V    G       I  + G+ 
Sbjct: 261 QQQASNTNSNSSDPLSSGSGKLEKVNAFGHVWVHTQTEIVTGERGVYVPDTGIARIVGN- 319

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              V +    N   G   I+N+ T  A++      +V  ++  +
Sbjct: 320 ---VHITRGPNQIQGAAAIINMHTGIATMTERPGSRVSGLVVPN 360



 Score = 44.2 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 8/50 (16%), Positives = 19/50 (38%)

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
           +     +N+I R++   ++ I +            D  + +LV+ G    
Sbjct: 154 DDQDSGANEIFRLEAIGHVHIFTQTDQAWGDKAVYDMDQAVLVMTGKAMK 203


>gi|71065485|ref|YP_264212.1| OstA-like protein [Psychrobacter arcticus 273-4]
 gi|71038470|gb|AAZ18778.1| possible OstA-like protein [Psychrobacter arcticus 273-4]
          Length = 189

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 47/152 (30%), Gaps = 6/152 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A   Y        N+ I + AD     +      + G V +TQ  F + AD +T++ +  
Sbjct: 33  ALPLYSHALPSDANQPIKLLADKATYSERTGVTSYSGTVVITQGTFKMTADNITVNLSQG 92

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIAS--NGYVDFQKRILVLNGDRADKVILKEKLNT 146
               S             +   +            +    I+ L G+      L +   +
Sbjct: 93  RSITSAVATGRPATMQQVVTQEKGLAKGQANKIDYNAVTGIVTLTGNAK----LVQNGAS 148

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           F G  +  ++           + +V+ +   +
Sbjct: 149 FAGNVIRYSLKAGDVEATAGGNQRVELVFPPN 180


>gi|33151776|ref|NP_873129.1| hypothetical protein HD0587 [Haemophilus ducreyi 35000HP]
 gi|6969426|gb|AAF33770.1|AF219259_3 YhbN [Haemophilus ducreyi]
 gi|33147997|gb|AAP95518.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 167

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 49/142 (34%), Gaps = 4/142 (2%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    ++I+I A    +        F  NV +TQ    + A+K+ I      ++  + 
Sbjct: 22  ALKSDAEKQINIDAGSQSLDINTNTVIFSDNVIITQGSIKVTANKVKITRQTGKKETLDA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                  +        +    +  + D     L L G+      LK++ +     K+  +
Sbjct: 82  TGSPVTFQQTLDNGKPVKGKGNTVHYDLNSEFLTLTGNAE----LKQQGSFIQADKITYD 137

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
           +     +     + +V++I+  
Sbjct: 138 VKKQKLTAGSGNNSRVKTILIP 159


>gi|145639331|ref|ZP_01794937.1| hypothetical protein CGSHiII_01234 [Haemophilus influenzae PittII]
 gi|145271634|gb|EDK11545.1| hypothetical protein CGSHiII_01234 [Haemophilus influenzae PittII]
 gi|309751205|gb|ADO81189.1| Lipooligosaccharide transporter, periplasmic binding protein LptA
           [Haemophilus influenzae R2866]
          Length = 172

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 52/155 (33%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 +   A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGKPVEGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|329114152|ref|ZP_08242914.1| LPS-assembly protein LptD [Acetobacter pomorum DM001]
 gi|326696228|gb|EGE47907.1| LPS-assembly protein LptD [Acetobacter pomorum DM001]
          Length = 777

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 40/110 (36%), Gaps = 3/110 (2%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYM---TRFKVLGNEKIHIKADMLEVKDAV 58
           S    +  L      L+F L K   +Q     M   T      +E    +AD ++  D  
Sbjct: 17  STLSAATALGSMAACLLFNLPKHAHAQFRPQVMHLDTGRPTSPDEPATFQADKVDYNDVE 76

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ 108
               + GNV + Q D  L+AD++  D +         +  +  + ++   
Sbjct: 77  HTVTWTGNVQVWQGDHVLRADRIVYDRDTGVIAARGNVATIQPDGSVLYT 126



 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 26/75 (34%), Gaps = 11/75 (14%)

Query: 107 IQSGEINVI--ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
             S +      A     +  +  +   G+    V + +  +     +++ + DT   + +
Sbjct: 56  PTSPDEPATFQADKVDYNDVEHTVTWTGN----VQVWQGDHVLRADRIVYDRDTGVIAAR 111

Query: 165 GCESDQVQSIIRYDG 179
           G       + I+ DG
Sbjct: 112 GNV-----ATIQPDG 121


>gi|71897587|ref|ZP_00679832.1| OstA-like protein [Xylella fastidiosa Ann-1]
 gi|71732490|gb|EAO34543.1| OstA-like protein [Xylella fastidiosa Ann-1]
          Length = 176

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 61/165 (36%), Gaps = 12/165 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDFS 75
            +F LL   LS  A S         N+ + I +   E       KA + GNV + Q    
Sbjct: 10  FLFPLLFTPLSATAKSS------DRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSLE 63

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
             AD   +   N + D    I +    +        ++  A N     ++ I++L G+  
Sbjct: 64  AHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY- 122

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            KV   +  N   G ++I N  T      G +  +V++ I+    
Sbjct: 123 -KVESPKGNN--TGQRMIYNTQTGDMR-SGNDGTRVRTTIQPKSA 163


>gi|254447024|ref|ZP_05060491.1| cell envelope biogenesis protein YhbN [gamma proteobacterium
           HTCC5015]
 gi|198263163|gb|EDY87441.1| cell envelope biogenesis protein YhbN [gamma proteobacterium
           HTCC5015]
          Length = 171

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 56/155 (36%), Gaps = 13/155 (8%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            +     +      I + AD  E + A   A + GNV++ Q    ++ADKM +  +    
Sbjct: 18  PTASLALENDSTAPIKVSADKAEFQQAKGSAIYTGNVYLQQGSIEIRADKMELIADQGVL 77

Query: 91  ------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                   S    R  +++     S      A   +++     + L G+      L +  
Sbjct: 78  KEAYVFGGSEDKQRALLKQKNEDGSWTEGQ-AEQIHIEQASGDIELKGNAR----LDDGN 132

Query: 145 NTFLGCKLIVN--IDTSFASLQGCESDQVQSIIRY 177
           +T  G  +  N    T  A   G  SD+V+ I + 
Sbjct: 133 STIKGPLIHYNSRQQTVEAQSDGDNSDRVEMIFKP 167


>gi|217969306|ref|YP_002354540.1| lipopolysaccharide transport periplasmic protein LptA [Thauera sp.
           MZ1T]
 gi|217506633|gb|ACK53644.1| lipopolysaccharide transport periplasmic protein LptA [Thauera sp.
           MZ1T]
          Length = 180

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 61/155 (39%), Gaps = 13/155 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN--RDVSNK 95
           K   ++ ++I+AD L V D  +   F+G+V +TQ   +++ DK+ +  +       V+  
Sbjct: 24  KADRDQPVNIEADRLTVDDRNKVHIFEGSVVLTQGTLTIRGDKLVVTQDAAGFQNGVATA 83

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +               V      +++  R         ++  +    +   G  +  +
Sbjct: 84  AGKGLATFRQRRDGSAEYVEGEAERIEYDSRTE--KARLFNRAKVSSGGDQVSGHYIEYD 141

Query: 156 IDT-------SFASLQGCESDQVQSIIRY--DGRP 181
             T       +  S QG  + +V+++I+   DG+P
Sbjct: 142 AITENYLATNAPGSRQGAPAGRVRAVIQPKSDGQP 176


>gi|148826239|ref|YP_001290992.1| hypothetical protein CGSHiEE_06300 [Haemophilus influenzae PittEE]
 gi|148716399|gb|ABQ98609.1| hypothetical protein CGSHiEE_06300 [Haemophilus influenzae PittEE]
          Length = 172

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKADVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 ++  A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGNVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|323493623|ref|ZP_08098744.1| LPS assembly outer membrane complex protein LptD [Vibrio
           brasiliensis LMG 20546]
 gi|323312146|gb|EGA65289.1| LPS assembly outer membrane complex protein LptD [Vibrio
           brasiliensis LMG 20546]
          Length = 788

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 10/87 (11%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            ++++AD LE  +  + A ++GNV + Q    +QAD +T+          + I  +  E 
Sbjct: 55  PVNVEADSLEAINGDK-ATYRGNVVVVQGKKRMQADNVTLH-------QQDNI--VVAEG 104

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVL 130
           N+    GE+  I+     +     + L
Sbjct: 105 NVTFSDGEVKTISDKATNNLTTEEVTL 131


>gi|208435447|ref|YP_002267113.1| hypothetical protein HPG27_1505 [Helicobacter pylori G27]
 gi|208433376|gb|ACI28247.1| hypothetical protein HPG27_1505 [Helicobacter pylori G27]
          Length = 185

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+    +L    +  A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCFLVCCFGIL---SVMSAQKTENKGLKKER-ELLEITGNKFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGGEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|187479587|ref|YP_787612.1| hypothetical protein BAV3117 [Bordetella avium 197N]
 gi|115424174|emb|CAJ50727.1| putative exported protein [Bordetella avium 197N]
          Length = 201

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 61/183 (33%), Gaps = 19/183 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M+ F  +  L   LL    +   A   QA     +           I +D L+  D  ++
Sbjct: 1   MTDFPFAQRLMSALLLTAAMCAPALAQQAKPEDPSTL---------ILSDSLQYDDVKRQ 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNT----NRDVSNKINRMDVERNIFIQSGEINVIA 116
           + F GNV +T+   +L ADK+ +  +          +NK   + + +        I    
Sbjct: 52  SVFTGNVALTRGLMTLNADKLEVREDQKGNQFGTATANKGKLVRIRQERPDTFEIIEGEG 111

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQG-----CESDQ 170
                D       L G       +  K  +T  G ++  N  T     +G         +
Sbjct: 112 LRADYDGTNSQFDLIGQAVVTRYICGKPFDTIRGDRVRYNEKTGIYQAEGGPNSAAPGGR 171

Query: 171 VQS 173
           V+S
Sbjct: 172 VRS 174


>gi|162147901|ref|YP_001602362.1| organic solvent tolerance protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786478|emb|CAP56060.1| Organic solvent tolerance protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 363

 Score = 61.2 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 35/94 (37%), Gaps = 4/94 (4%)

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 S K+ +++   ++F+++    V    G       I  + G+    V +    N 
Sbjct: 251 KDPLTSSGKLEKVNAFGHVFVRTQTETVTGDRGVYVPDTGIARIVGN----VHITRGQNQ 306

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             G   IVN+ T  A++      +V  +I  +  
Sbjct: 307 INGAAAIVNMHTGIATMTERAGSRVSGLIVPNEA 340



 Score = 42.7 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 37/92 (40%), Gaps = 4/92 (4%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV----ILK 141
           +N     SN++ R++   ++ I +            D  + ++++ G     V    +L 
Sbjct: 122 SNGTDSGSNEVYRLNAIGHVHIFTDTDQAWGDKAIYDIDQSVMIMTGKAMKMVTPQDVLT 181

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
            + +     +  ++I    A++   +  Q+++
Sbjct: 182 ARDSMEYYSQTRISIGRGNATVTTNDGRQIRA 213


>gi|209542518|ref|YP_002274747.1| OstA family protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530195|gb|ACI50132.1| OstA family protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 362

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 35/94 (37%), Gaps = 4/94 (4%)

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                 S K+ +++   ++F+++    V    G       I  + G+    V +    N 
Sbjct: 250 KDPLTSSGKLEKVNAFGHVFVRTQTETVTGDRGVYVPDTGIARIVGN----VHITRGQNQ 305

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             G   IVN+ T  A++      +V  +I  +  
Sbjct: 306 INGAAAIVNMHTGIATMTERAGSRVSGLIVPNEA 339



 Score = 42.7 bits (99), Expect = 0.023,   Method: Composition-based stats.
 Identities = 12/91 (13%), Positives = 36/91 (39%), Gaps = 4/91 (4%)

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV----ILKE 142
           N     SN++ R++   ++ I +            D  + ++++ G     V    +L  
Sbjct: 122 NGTDSGSNEVYRLNAIGHVHIFTDTDQAWGDKAIYDIDQSVMIMTGKAMKMVTPQDVLTA 181

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
           + +     +  ++I    A++   +  Q+++
Sbjct: 182 RDSMEYYSQTRISIGRGNATVTTNDGRQIRA 212


>gi|91225584|ref|ZP_01260658.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           12G01]
 gi|269968003|ref|ZP_06182041.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           40B]
 gi|91189704|gb|EAS75978.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           12G01]
 gi|269827360|gb|EEZ81656.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           40B]
          Length = 164

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 53/147 (36%), Gaps = 14/147 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K    + ++I +D  +V     +  F+G+V + Q   ++ AD++ +  +      +  I 
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVVFEGDVSLKQGSINIDADRIVVTRDPK----TEAIK 77

Query: 98  RMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           ++           +      ++  A+          L + G       L +  NT  G  
Sbjct: 78  QIQAFGKPAKFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDNNTIKGSS 133

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   I          + ++V +I++ +
Sbjct: 134 IRYQIGKQKLVADSSKEERVTTILQPN 160


>gi|28198547|ref|NP_778861.1| hypothetical protein PD0639 [Xylella fastidiosa Temecula1]
 gi|182681227|ref|YP_001829387.1| lipopolysaccharide transport periplasmic protein LptA [Xylella
           fastidiosa M23]
 gi|28056631|gb|AAO28510.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182631337|gb|ACB92113.1| lipopolysaccharide transport periplasmic protein LptA [Xylella
           fastidiosa M23]
 gi|307579674|gb|ADN63643.1| lipopolysaccharide transport periplasmic protein LptA [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 176

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 61/162 (37%), Gaps = 12/162 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDFS 75
            +F LL   LS  A S         N+ + I +   E       KA + GNV + Q    
Sbjct: 10  FLFPLLFTPLSATAKSS------DRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSLE 63

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
             AD   +   N + D    I +    +        ++  A N     ++ I++L G+  
Sbjct: 64  AHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY- 122

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            KV   +  N   G ++I N  T      G +  +V++ I+ 
Sbjct: 123 -KVESPKGNN--TGQRMIYNTQTGDMR-SGNDGTRVRTTIQP 160


>gi|308185355|ref|YP_003929488.1| hypothetical protein HPSJM_08105 [Helicobacter pylori SJM180]
 gi|308061275|gb|ADO03171.1| hypothetical protein HPSJM_08105 [Helicobacter pylori SJM180]
          Length = 185

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+    +L    +  A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCFLVCCFGIL---SVMSAQKTDNKGLKKER-ELLEITGNQFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|262393178|ref|YP_003285032.1| LptA protein [Vibrio sp. Ex25]
 gi|262336772|gb|ACY50567.1| LptA protein [Vibrio sp. Ex25]
          Length = 164

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 52/147 (35%), Gaps = 14/147 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +      +  I 
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPK----TEAIK 77

Query: 98  RMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           ++           +      ++  A           L + G       L +  NT  G  
Sbjct: 78  QIQAFGKPAKFSQLMDDGKTLSGQAVELDYRISTDELTMKGQAQ----LAQDNNTIKGSS 133

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   I          + ++V +I++ +
Sbjct: 134 IRYQIGKQKLVADSSKEERVTTILQPN 160


>gi|320538915|ref|ZP_08038591.1| periplasmic LPS-binding protein [Serratia symbiotica str. Tucson]
 gi|320031075|gb|EFW13078.1| periplasmic LPS-binding protein [Serratia symbiotica str. Tucson]
          Length = 179

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/164 (11%), Positives = 56/164 (34%), Gaps = 14/164 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL A +    ++     K   N+ + I +    +      + F  NV + Q    ++ADK
Sbjct: 12  LLIASVILVTSAPALALKSDANQPVAIDSLKQSLDMQNNVSTFTDNVVIKQGTIDIRADK 71

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDR 134
           + + +   +++ +     ++   +             +   A     D   +++ L G+ 
Sbjct: 72  VVVTHPGGDQNKTY----IEAFGDPVTFHQMQDSGKPVKGHAQKVRYDVATQLVTLTGNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L++  +     ++   +          +  +V +++   
Sbjct: 128 Y----LEQLDSNVKSDRITYLVQQQQMQAFSDKGKRVTTVLVPS 167


>gi|226329335|ref|ZP_03804853.1| hypothetical protein PROPEN_03240 [Proteus penneri ATCC 35198]
 gi|225202521|gb|EEG84875.1| hypothetical protein PROPEN_03240 [Proteus penneri ATCC 35198]
          Length = 177

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/171 (13%), Positives = 54/171 (31%), Gaps = 23/171 (13%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           ++  +  +    ++          K    + I + ++   +        F  NV + Q  
Sbjct: 10  IIGTLLAISVPAMA---------LKDDTQQPIVVNSEKQSLDLEKNVTTFTQNVVIKQGS 60

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRI 127
             ++ADK+ +    T     +K   ++   N             I         +  K +
Sbjct: 61  IDIRADKVVV----TRPGGDSKKIVIEAFGNPVTFYQLQDDGKPIKGRGDKMTYEMDKEL 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           + L G    K  L++  +   G K+   + T        +  QV +++   
Sbjct: 117 MTLTG----KAYLEQLDSNITGDKITYLVPTQQMEAFSGKGKQVTTVLLPS 163


>gi|92114346|ref|YP_574274.1| OstA-like protein [Chromohalobacter salexigens DSM 3043]
 gi|91797436|gb|ABE59575.1| OstA-like protein [Chromohalobacter salexigens DSM 3043]
          Length = 174

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 56/152 (36%), Gaps = 15/152 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +   ++ I I AD L++ D    A + G+V M Q    L A ++ I+  N   +VS  
Sbjct: 24  ALESDASQPIEIAADQLDLDDNAGTAVYTGDVDMQQGSMRLTAARVEIE-RNAQGEVSTV 82

Query: 96  INRMDVERNIFIQ---SGEINVI---ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                     +++   S +  V             +R + L     D+  L +  +TF G
Sbjct: 83  TAHGSGSERAYLEQKPSPDEPVAKGWGDTVIYHAGERRVEL----IDRAQLHQGGDTFNG 138

Query: 150 CKLIVNID----TSFASLQGCESDQVQSIIRY 177
             +   +D     + +   G    +V+  +  
Sbjct: 139 AYVEYFLDRRQVQARSDDDGEGDQRVRMTLTP 170


>gi|319776610|ref|YP_004139098.1| hypothetical protein HICON_01500 [Haemophilus influenzae F3047]
 gi|319897384|ref|YP_004135581.1| hypothetical protein HIBPF11260 [Haemophilus influenzae F3031]
 gi|317432890|emb|CBY81256.1| conserved hypothetical protein [Haemophilus influenzae F3031]
 gi|317451201|emb|CBY87434.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 172

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIIIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER-NIFIQSGEINVI-----ASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++     +       N       A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQKLDNGTPVDGKANKVHYDLGSEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|296533702|ref|ZP_06896255.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296265976|gb|EFH12048.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 132

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 35/92 (38%), Gaps = 4/92 (4%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
              N    ++++R++   N+ I++    V    G       +  L G     V +    N
Sbjct: 11  AAGNPAEGSQLDRVEAFGNVEIRTPSEVVRGDRGVYSETTGMSRLLG----GVRITRGDN 66

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
              G + IVN+ +  A L      +VQ +I  
Sbjct: 67  QLNGQEAIVNMRSGVARLVAAPGQRVQGLIIP 98


>gi|213585574|ref|ZP_03367400.1| hypothetical protein SentesTyph_31632 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 140

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 54/139 (38%), Gaps = 8/139 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+L  +L  + L+ +  ++         + IHI +D   +        F GNV MTQ   
Sbjct: 8   LSLNLMLAGSLLAASIPAF--AVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTI 65

Query: 75  SLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
            + ADK+ +        ++V +          +      +   AS+ + +  K  +VL G
Sbjct: 66  KINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTG 125

Query: 133 DRADKVILKEKLNTFLGCK 151
           +      L++  +   G K
Sbjct: 126 NAY----LEQLDSNITGDK 140


>gi|71274806|ref|ZP_00651094.1| OstA-like protein [Xylella fastidiosa Dixon]
 gi|71900940|ref|ZP_00683054.1| OstA-like protein [Xylella fastidiosa Ann-1]
 gi|170729946|ref|YP_001775379.1| hypothetical protein Xfasm12_0758 [Xylella fastidiosa M12]
 gi|71164538|gb|EAO14252.1| OstA-like protein [Xylella fastidiosa Dixon]
 gi|71729299|gb|EAO31416.1| OstA-like protein [Xylella fastidiosa Ann-1]
 gi|167964739|gb|ACA11749.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 176

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 61/162 (37%), Gaps = 12/162 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDFS 75
            +F LL   LS  A S         N+ + I +   E       KA + GNV + Q    
Sbjct: 10  FLFPLLFTPLSATAKSS------DRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSLE 63

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
             AD   +   N + D    I +    +        ++  A N     ++ I++L G+  
Sbjct: 64  AHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY- 122

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            KV   +  N   G ++I N  T      G +  +V++ I+ 
Sbjct: 123 -KVESPKGNN--TGQRMIYNTQTGDMR-SGNDGTRVRTTIQP 160


>gi|145627881|ref|ZP_01783682.1| hypothetical protein CGSHi22121_02550 [Haemophilus influenzae
           22.1-21]
 gi|144979656|gb|EDJ89315.1| hypothetical protein CGSHi22121_02550 [Haemophilus influenzae
           22.1-21]
          Length = 159

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 52/155 (33%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 4   ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 60

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 +   A+  + D     L L  +      LK+ 
Sbjct: 61  AEKSGKKETVEAFGTPVTFHQQLDNGKPVEGKANKVHYDLGNEFLTLTNNAE----LKQL 116

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 117 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 151


>gi|310766225|gb|ADP11175.1| lipopolysaccharide transport periplasmic protein LptA [Erwinia sp.
           Ejp617]
          Length = 179

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 52/149 (34%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 N+ +++ ++   +      A F GNV +TQ    + ADK+ +    T     +K
Sbjct: 23  ALTGDSNKPVNVDSENQALDMQGNVATFTGNVVVTQGSIKITADKVVV----TRPGGDSK 78

Query: 96  INRMDVERNI------FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +D   N+            +   A   + +    ++ L G+      L++  +   G
Sbjct: 79  KTIVDAYGNLATFYQMQDNGKPVQGHAQKMHYELASDLVELTGNAY----LEQLDSNVKG 134

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   +        G    +V +++   
Sbjct: 135 DRITYLVKEQKMQAFGNTGRRVTTVLVPS 163


>gi|156975896|ref|YP_001446803.1| hypothetical protein VIBHAR_03662 [Vibrio harveyi ATCC BAA-1116]
 gi|156527490|gb|ABU72576.1| hypothetical protein VIBHAR_03662 [Vibrio harveyi ATCC BAA-1116]
          Length = 164

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 54/147 (36%), Gaps = 14/147 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K    + ++I +D  +V     +  FKGNV + Q   ++ AD++ +  +      +  I 
Sbjct: 22  KSDTQQPVYINSDTQQVDMQSNQVTFKGNVSLKQGSINIDADRVVVTRDPK----TESIK 77

Query: 98  RMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           ++           +      ++  A+          L + G       LK+  NT     
Sbjct: 78  QIQAFGKPATFSQLMDDGKTLSGQANELDYRISTDELTMKGQAQ----LKQDGNTIQSSS 133

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   I          ++++V +I++ +
Sbjct: 134 IRYQIGQQKLVADSSDNERVTTILQPN 160


>gi|332286596|ref|YP_004418507.1| hypothetical protein PT7_3343 [Pusillimonas sp. T7-7]
 gi|330430549|gb|AEC21883.1| hypothetical protein PT7_3343 [Pusillimonas sp. T7-7]
          Length = 212

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 65/189 (34%), Gaps = 15/189 (7%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEK-IHIKADMLEVKDAVQK 60
           +A+L +  +    L  +    +      AA+     +    E    I +D L+  D  ++
Sbjct: 10  AAWLLTAAMACMTLPTLAQTSQPSTQSNAAAPAGSSEQPAAEPDTLILSDTLDYDDIKKE 69

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE------INV 114
           + F GNV MT+   +L ADK+ +          +    ++  + + I+         I  
Sbjct: 70  SIFTGNVIMTRGLMTLHADKLIM--REDAEGFQHGTATVEQGKLVHIRQENPEEFEVIEA 127

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASL-----QGCES 168
               G  + +   L + G       +  K  +   G ++I    T               
Sbjct: 128 QGLRGEYNGKTEDLEMIGKAVITRYICGKPFDNIRGERVIYKQKTDTYQAFGGPNSAAAG 187

Query: 169 DQVQSIIRY 177
            +V+S+ + 
Sbjct: 188 GRVRSLAKP 196


>gi|145635600|ref|ZP_01791298.1| hypothetical protein CGSHiAA_07486 [Haemophilus influenzae PittAA]
 gi|145637099|ref|ZP_01792762.1| hypothetical protein CGSHiHH_02528 [Haemophilus influenzae PittHH]
 gi|148828308|ref|YP_001293061.1| hypothetical protein CGSHiGG_09410 [Haemophilus influenzae PittGG]
 gi|229846180|ref|ZP_04466292.1| hypothetical protein CGSHi7P49H1_05018 [Haemophilus influenzae
           7P49H1]
 gi|260581802|ref|ZP_05849598.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae NT127]
 gi|329124123|ref|ZP_08252670.1| YhbN like protein [Haemophilus aegyptius ATCC 11116]
 gi|145267162|gb|EDK07168.1| hypothetical protein CGSHiAA_07486 [Haemophilus influenzae PittAA]
 gi|145269753|gb|EDK09693.1| hypothetical protein CGSHiHH_02528 [Haemophilus influenzae PittHH]
 gi|148719550|gb|ABR00678.1| hypothetical protein CGSHiGG_09410 [Haemophilus influenzae PittGG]
 gi|229811184|gb|EEP46901.1| hypothetical protein CGSHi7P49H1_05018 [Haemophilus influenzae
           7P49H1]
 gi|260094995|gb|EEW78887.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae NT127]
 gi|309973384|gb|ADO96585.1| Lipooligosaccharide transporter, periplasmic binding protein LptA
           [Haemophilus influenzae R2846]
 gi|327467548|gb|EGF13046.1| YhbN like protein [Haemophilus aegyptius ATCC 11116]
          Length = 172

 Score = 60.8 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 ++  A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|329114440|ref|ZP_08243202.1| Hypothetical protein APO_1235 [Acetobacter pomorum DM001]
 gi|326696516|gb|EGE48195.1| Hypothetical protein APO_1235 [Acetobacter pomorum DM001]
          Length = 382

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 22/162 (13%), Positives = 53/162 (32%), Gaps = 23/162 (14%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN-------- 87
             K+   + +    D +E     + +  +GN  +T  D       + + Y+         
Sbjct: 217 AMKLTTPQDVLTARDSMEYYSQQRISIGRGNATVTTNDQRQIRADVLVGYSAPPDQNAQP 276

Query: 88  -----------TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
                           S K+ +++   ++++ +    V    G       I  + G+   
Sbjct: 277 QQQASNNSSSDPLSSGSGKLEKVNAFGHVWVHTQTEIVTGERGVYVPDTGIARIVGN--- 333

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            V +    N   G   I+N+ T  A++      +V  ++  +
Sbjct: 334 -VHITRGPNQIQGAAAIINMHTGIATMTERPGSRVSGLVVPN 374



 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 21/62 (33%), Gaps = 3/62 (4%)

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +     +N+I R++   ++ I +            D  + +LV+ G       L    + 
Sbjct: 170 DDQDSGANEIFRLEAIGHVHIFTQTDQAWGDKAVYDMDQAVLVMTGKAMK---LTTPQDV 226

Query: 147 FL 148
             
Sbjct: 227 LT 228


>gi|307544515|ref|YP_003896994.1| hypothetical protein HELO_1925 [Halomonas elongata DSM 2581]
 gi|307216539|emb|CBV41809.1| K09774 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 176

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 58/158 (36%), Gaps = 11/158 (6%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
             S     +   +  I ++AD L++ D    A ++GNV + Q    L   ++ I  N+  
Sbjct: 20  VTSQAQALEGDASAPIQVEADRLDLDDRAGTAVYQGNVRIQQGSMLLTGARVEIRRNDAG 79

Query: 90  RDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
           +         R  +E+        +            +R + L     D+  L    +TF
Sbjct: 80  QLSQAIATGQRAYIEQQPAPDESVVRGWGQRIVYHVAERRMEL----IDQAELHRGGDTF 135

Query: 148 LGCKLIVNID----TSFASLQGCES-DQVQSIIRYDGR 180
            G  L   +D     + ++ +G E   +V+  +  + +
Sbjct: 136 NGGYLEYFLDRRVVQARSAAEGVEGNQRVRMTLEPEKQ 173


>gi|85713034|ref|ZP_01044071.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
 gi|85693137|gb|EAQ31098.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
          Length = 180

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 59/173 (34%), Gaps = 16/173 (9%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             +LA +  + +  ++Q  + +         + I + A          +     NV +TQ
Sbjct: 5   FLILASLAAVSQLAVAQGESDF--------EKPIEVSAGHEHFDIKNNQLLLTDNVIVTQ 56

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKI--NRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
               ++AD++              +   R  V   +     EI+  A        +  + 
Sbjct: 57  GSLRIEADRLEASGGEAKDQADTFVAHGRPAVYTQLLENGTEISAEADQITYFQSQGRIE 116

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDGR 180
           L G+      + +  +   G  ++ ++     S +G +   ++V +I   + +
Sbjct: 117 LKGNAQ----ITQGSSLSRGDTIVYDLTNQHVSARGSKESGERVTTIFNPNKQ 165


>gi|210135746|ref|YP_002302185.1| hypothetical protein HPP12_1559 [Helicobacter pylori P12]
 gi|210133714|gb|ACJ08705.1| hypothetical protein HPP12_1559 [Helicobacter pylori P12]
          Length = 185

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQKTENK--GLKKER-ELLEITGNQFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|254780099|ref|YP_003058206.1| hypothetical protein HELPY_1571 [Helicobacter pylori B38]
 gi|254002012|emb|CAX30271.1| Conserved hypothetical protein [Helicobacter pylori B38]
          Length = 183

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+    +L   D   A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCFLVCCFGILSVMD---AQKTDNKGLKKER-ELLEITGNQFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|304413067|ref|ZP_07394540.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Candidatus Regiella insecticola LSR1]
 gi|304283910|gb|EFL92303.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Candidatus Regiella insecticola LSR1]
          Length = 189

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 61/172 (35%), Gaps = 16/172 (9%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           IH + L  + L A L+    +          + IHI +D   +      + F  NV + Q
Sbjct: 7   IHGILLTGLFLAAFLTVNFPAL--ALSSDSEQPIHITSDTQSLDLPNNVSVFIDNVIIKQ 64

Query: 72  EDFSLQADKMTIDYNNTNRDVS------NKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
               ++A+K+ +   +  +  +        +    ++ N  + +G               
Sbjct: 65  GSIEIKANKVVVTRPDGEQKKTVMEGFGTPVTFQQMQDNGKLVTGH----GEKLRYQLAN 120

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           + LVL G+      LK+  +     ++   ++         ++ +V +++  
Sbjct: 121 QFLVLTGNAY----LKQLDSNIEADRITYQVEKQLMEAFSDKNKRVTTVLLP 168


>gi|212633559|ref|YP_002310084.1| OstA-like protein [Shewanella piezotolerans WP3]
 gi|212555043|gb|ACJ27497.1| OstA-like protein [Shewanella piezotolerans WP3]
          Length = 182

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 63/169 (37%), Gaps = 15/169 (8%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            +LA +  LL +  S AA   +        +++ I A   E      +  F G V +TQ 
Sbjct: 6   SILAGLLCLL-SISSYAAVDDL-------KQEVKIAAASQEADIKNNQVIFFGPVEVTQG 57

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLN 131
              + AD++ +     N   +             ++ G      A     +   R L L 
Sbjct: 58  SIKMNADELRVFSKEANSGKTLVATGNPATYTQIMEDGRPATASAKEIRYELATRTLTLL 117

Query: 132 GDRADKVILKEKLNTFLGCKLIVN--IDTSFASLQGCESDQVQSIIRYD 178
           GD      L+++ +   G ++  N  +    A   G  +D+V +II+ +
Sbjct: 118 GDAT----LEQEGSQVTGNRIKYNIGLQQLIAESTGEGNDRVITIIQPE 162


>gi|317179769|dbj|BAJ57557.1| hypothetical protein HPF30_1460 [Helicobacter pylori F30]
 gi|317182793|dbj|BAJ60577.1| hypothetical protein HPF57_1503 [Helicobacter pylori F57]
          Length = 185

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQ--KTDNKGLKKER-ELLEITGNQFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|90408213|ref|ZP_01216380.1| hypothetical protein PCNPT3_11434 [Psychromonas sp. CNPT3]
 gi|90310659|gb|EAS38777.1| hypothetical protein PCNPT3_11434 [Psychromonas sp. CNPT3]
          Length = 177

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 54/143 (37%), Gaps = 17/143 (11%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + IH+ +     K       F  +V +TQ    ++ADK+ +      R       +M  +
Sbjct: 28  KPIHVSSISQHAKMKNNSITFVDDVLLTQGSIIIKADKLIVT-----RTAQPNHEQMLAK 82

Query: 103 RNIFIQSGEI------NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
            N+             N  A++ + D  K  + L G+   K    +  +   G K+I  +
Sbjct: 83  GNVATFYQTQEDGRPFNAQANSIHYDVAKSKITLTGNAQVK----QLDSRINGAKIIYYL 138

Query: 157 DTSFASLQGCES--DQVQSIIRY 177
           +T    +   ++   +V+++   
Sbjct: 139 NTEELIVMSDKNNEKRVKTVFLP 161


>gi|261855366|ref|YP_003262649.1| lipopolysaccharide transport periplasmic protein LptA
           [Halothiobacillus neapolitanus c2]
 gi|261835835|gb|ACX95602.1| lipopolysaccharide transport periplasmic protein LptA
           [Halothiobacillus neapolitanus c2]
          Length = 194

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 58/173 (33%), Gaps = 6/173 (3%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           N+ ++         ++L         +     K   N+ I + A+          + + G
Sbjct: 5   NTANICSTGWTSALLILGIIAGLMTPTVFAA-KADRNQPIDVTANEKVTDYKQGTSIYTG 63

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
           NV + Q       DK T+         +    +    + +  +   +   A++     Q+
Sbjct: 64  NVVINQGSLHATGDKATLYVEKGELVRAVLEGKPATFQELDDKGQLVKGSANDANYLAQQ 123

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-QVQSIIRY 177
           + ++L G+      L  + +T    ++  +++       G     +V  +I+ 
Sbjct: 124 QKIILTGNAK----LDRQGDTLSSQQITYDMNAEVVKAGGKTGGERVHVVIQP 172


>gi|217031723|ref|ZP_03437227.1| hypothetical protein HPB128_155g36 [Helicobacter pylori B128]
 gi|298737140|ref|YP_003729670.1| hypothetical protein HPB8_1649 [Helicobacter pylori B8]
 gi|216946570|gb|EEC25170.1| hypothetical protein HPB128_155g36 [Helicobacter pylori B128]
 gi|298356334|emb|CBI67206.1| conserved hypothetical protein [Helicobacter pylori B8]
          Length = 185

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 58/167 (34%), Gaps = 17/167 (10%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + +   
Sbjct: 7   LVCCFGILSVMSAQKTENR--GLKKER-ELLEITGNQFVANDKTKTAVIQGNVQIKKGKD 63

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQKRILV 129
            L ADK+++  N+  +       R +   N         + EI+  A     +       
Sbjct: 64  RLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYK 118

Query: 130 LNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 119 L---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|317010259|gb|ADU80839.1| hypothetical protein HPIN_08315 [Helicobacter pylori India7]
          Length = 185

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   S     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQKTDSK--GLKKER-ELLEITGNQFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|145630249|ref|ZP_01786031.1| hypothetical protein CGSHi22421_09358 [Haemophilus influenzae
           R3021]
 gi|144984530|gb|EDJ91953.1| hypothetical protein CGSHi22421_09358 [Haemophilus influenzae
           R3021]
          Length = 159

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 4   ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 60

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 ++  A+  + D     L L  +      LK+ 
Sbjct: 61  AEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGSEFLTLTNNAE----LKQL 116

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 117 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 151


>gi|114327362|ref|YP_744519.1| hypothetical protein GbCGDNIH1_0698 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315536|gb|ABI61596.1| hypothetical secreted protein [Granulibacter bethesdensis CGDNIH1]
          Length = 329

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 30/91 (32%), Gaps = 4/91 (4%)

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                + K+ R +   N+ I++         G       I  L G     V +    N  
Sbjct: 224 DPASAAGKLQRAEAYGNVEIRTPTETAYGDRGVYVPDTGIARLIGH----VRITRGQNQV 279

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G    VN+ T  ++L      +VQ +I   
Sbjct: 280 NGAAADVNLKTGISTLLSARDSRVQGMIVPS 310



 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 47/142 (33%), Gaps = 22/142 (15%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKA-DMLEVKDAVQKAFFKG 65
           +I   +   AL   L    L+   A       +     + + A D ++ +   ++   +G
Sbjct: 2   TIRAALLTTALAIGLPCIALAPVIALA-QSLDLSHGGPVQVTAQDGIDWRQQEKEVVARG 60

Query: 66  NVFMTQEDFSLQADKMTIDYNN--------------------TNRDVSNKINRMDVERNI 105
           N    +++ +++AD +   Y                       +   +N+I R++   N+
Sbjct: 61  NAVAIRDNVTVRADTLIAHYRKKETPDQKPATPTPAKASANAADESGANEIYRLEAVGNV 120

Query: 106 FIQSGEINVIASNGYVDFQKRI 127
            I +            D  + I
Sbjct: 121 HIYTDTDQAWGDRAIYDMDQAI 142


>gi|170728563|ref|YP_001762589.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           woodyi ATCC 51908]
 gi|169813910|gb|ACA88494.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           woodyi ATCC 51908]
          Length = 196

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 54/143 (37%), Gaps = 15/143 (10%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            +++ I A   E      +  F G V + Q    + ADK+      T    + +I  +  
Sbjct: 27  KQEVKISAASQEADIKNNQIIFNGPVEVVQGSVKINADKLRAF---TKEGSNGRI--LVA 81

Query: 102 ERNIFIQSG------EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             N    S         N  A     +  KR L+L G+      L++  +   G ++  N
Sbjct: 82  TGNPATYSQIMEDGRPANASAKEIRYELSKRTLILKGNAT----LEQDGSQVTGNQIQYN 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I+      +   S++V +II+ +
Sbjct: 138 IEKQQLIAESTGSERVITIIQPE 160


>gi|91791855|ref|YP_561506.1| OstA-like protein [Shewanella denitrificans OS217]
 gi|91713857|gb|ABE53783.1| OstA-like protein [Shewanella denitrificans OS217]
          Length = 184

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 47/144 (32%), Gaps = 7/144 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD-VSNKI 96
           +    +++ ++A   +      +  F G V + Q   ++ AD++       +   V   I
Sbjct: 23  QGDLQQELKVEAVSQKADIKNNQIIFFGPVKVVQGSINIHADELRAFSTAKSPSKVMLAI 82

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                              A     D   R L L G+      L +  N   G  +  NI
Sbjct: 83  GNPATFSQELDDGSTGTASAKEIRYDLASRTLTLTGEAK----LDQAGNQVTGNSIRYNI 138

Query: 157 DTSF--ASLQGCESDQVQSIIRYD 178
                 A   G   D+V +II+ +
Sbjct: 139 KDQQLIAESTGKGQDRVITIIQPE 162


>gi|145633121|ref|ZP_01788853.1| hypothetical protein CGSHi3655_06149 [Haemophilus influenzae 3655]
 gi|229844896|ref|ZP_04465034.1| hypothetical protein CGSHi6P18H1_01641 [Haemophilus influenzae
           6P18H1]
 gi|144986347|gb|EDJ92926.1| hypothetical protein CGSHi3655_06149 [Haemophilus influenzae 3655]
 gi|229812277|gb|EEP47968.1| hypothetical protein CGSHi6P18H1_01641 [Haemophilus influenzae
           6P18H1]
 gi|301169889|emb|CBW29493.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Haemophilus influenzae 10810]
          Length = 172

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 I+  A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGTPIDGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|260767483|ref|ZP_05876420.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
 gi|260617595|gb|EEX42777.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
          Length = 224

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 49/133 (36%), Gaps = 17/133 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             + I+++AD LE  +   +A + GNV + Q    ++AD +T+   +           + 
Sbjct: 52  NEQPINVEADKLEAINGE-RATYSGNVVVIQGKKQIRADNVTLHQKDNV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL----GCKLIVNI 156
            E N+    G++   +     +     + L  +   K + ++            K +  I
Sbjct: 102 AEGNVNFSDGQVKATSDKATNNLTTDQMTLE-NTKYKFLCEQGRGEAAYISKTGKAVYGI 160

Query: 157 DTSFASLQGCESD 169
           +    S+  C   
Sbjct: 161 EDG--SITSCPEG 171


>gi|154174256|ref|YP_001407907.1| cell envelope biogenesis protein YhbN [Campylobacter curvus 525.92]
 gi|112803366|gb|EAU00710.1| cell envelope biogenesis protein YhbN [Campylobacter curvus 525.92]
          Length = 161

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/141 (15%), Positives = 58/141 (41%), Gaps = 4/141 (2%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF-SLQADKMTIDYNNTNRDVSNK 95
           F  L  E++ I ++     +  Q + F GNV + +  +  L A+K+ + ++   + +   
Sbjct: 18  FTTLHAEQVEITSNSFFADENKQISEFTGNVHIKKGAYDELFANKVIVYFDTKRQPIKY- 76

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
           +   +    I ++    +        +   +   + G+     +  +  N + G K++VN
Sbjct: 77  VATGNARAKIAMKDKHYDGKGDTLTYEPATQTYTVTGNGHLHEVETD-KNVY-GEKIVVN 134

Query: 156 IDTSFASLQGCESDQVQSIIR 176
            ++   ++   E   V+ I +
Sbjct: 135 QNSGTYNVNSDEKKPVKFIFQ 155


>gi|152996438|ref|YP_001341273.1| cell envelope biogenesis YhbN [Marinomonas sp. MWYL1]
 gi|150837362|gb|ABR71338.1| Cell envelope biogenesis YhbN [Marinomonas sp. MWYL1]
          Length = 175

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 53/147 (36%), Gaps = 19/147 (12%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---- 95
              + + I+AD         +A +KGNVF+ Q    +QA  + +  +   R  S+     
Sbjct: 26  DTTKPLEIQADEASFDQNSGEAIYKGNVFVKQGTIEIQAQYLKVTTDANTRKFSSLEATG 85

Query: 96  -----INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
                  ++D   NI I  G         +    +  L + GD      L    N+    
Sbjct: 86  KPAKFSQQIDWSGNIVISKGNEI------HYLTSESKLEIIGDGY----LSRMQNSITAD 135

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRY 177
            ++  ID    S +  +S +V   ++ 
Sbjct: 136 YILYMIDDGTFSAEKKDSGRVSMTLQP 162


>gi|322834667|ref|YP_004214694.1| lipopolysaccharide transport periplasmic protein LptA [Rahnella sp.
           Y9602]
 gi|321169868|gb|ADW75567.1| lipopolysaccharide transport periplasmic protein LptA [Rahnella sp.
           Y9602]
          Length = 185

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 57/162 (35%), Gaps = 8/162 (4%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            +++ + L+ +  ++    K    + I I +    +      A F GNV + Q    ++A
Sbjct: 12  LLIVSSLLAVSVPAF--ALKDDTTKPITIDSANQALDVNTNTATFTGNVVVNQGTIQVKA 69

Query: 79  DKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
           DK+ +        ++V            +      I   A     + +  ++ L G+   
Sbjct: 70  DKVVVIRPQGVSGKEVVEGYGNPVTFYQMQDNGKPIKGHAQKVRYEVENDLVTLTGNAY- 128

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              L++  +   G ++   +          + ++V +++   
Sbjct: 129 ---LEQLDSNVKGDRITYLVQKQQMEAFSDKGNRVTTVLVPS 167


>gi|93006315|ref|YP_580752.1| OstA-like protein [Psychrobacter cryohalolentis K5]
 gi|92393993|gb|ABE75268.1| OstA-like protein [Psychrobacter cryohalolentis K5]
          Length = 189

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 47/152 (30%), Gaps = 6/152 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A   Y        N+ I + AD     +      + G V +TQ  F + AD +T++ +  
Sbjct: 33  ALPLYSHALPSDANQPIKLLADKATYSERSGITSYSGTVVITQGTFKMTADNITVNLSQG 92

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIAS--NGYVDFQKRILVLNGDRADKVILKEKLNT 146
               S             +   +            +    I+ L G+      L +   +
Sbjct: 93  RSINSAVATGRPATMQQVVTQEKGLAKGQANKIDYNAVTGIVTLTGNAK----LVQNGAS 148

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           F G  +  ++           + +V+ +   +
Sbjct: 149 FAGNVIRYSLKAGDVEATAGGNQRVELVFPPN 180


>gi|315585974|gb|ADU40355.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Helicobacter pylori 35A]
          Length = 185

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQ--KTDNKGLKKER-ELLEITGNKFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|206602319|gb|EDZ38800.1| Protein of unknown function [Leptospirillum sp. Group II '5-way
           CG']
          Length = 209

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 49/126 (38%), Gaps = 17/126 (13%)

Query: 41  GNEKIH--IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV------ 92
           G + +   I AD +  ++   +  F G+V + +++  L++D + + +   +R        
Sbjct: 51  GEQPVSTVINADRMLAENIQNEIHFVGHVHLVKKNLVLKSDNLDVFFVPPSRGATLMDNM 110

Query: 93  -----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                S KI  M    +++I+ G     A       Q    VL       V++ +  +  
Sbjct: 111 HARQKSQKIQTMIATGHVYIKKGNRIAYAGKAVYIAQGHYFVLT---RLPVVI-QNGDRI 166

Query: 148 LGCKLI 153
            G K+ 
Sbjct: 167 SGEKIT 172


>gi|189424300|ref|YP_001951477.1| organic solvent tolerance protein [Geobacter lovleyi SZ]
 gi|189420559|gb|ACD94957.1| Organic solvent tolerance protein [Geobacter lovleyi SZ]
          Length = 705

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 45/110 (40%), Gaps = 6/110 (5%)

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q      A  M I  +  N D ++  +++     + +   ++ + A     +   + LV 
Sbjct: 35  QAAEQTAAPGMVIRADVMNHDAAS--DQIKASGKVEMIWQDMTMTADEATFNRSNQTLVA 92

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            G+    V L +  +T  G +L+++ +T  A ++       Q   R DGR
Sbjct: 93  RGN----VHLVKAGDTLWGDQLVLDTETGRAEMENGHIFMAQGNFRADGR 138


>gi|317013383|gb|ADU83991.1| hypothetical protein HPLT_08100 [Helicobacter pylori Lithuania75]
          Length = 185

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQ--KTDNKGLKKER-ELLEITGNQFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|68249698|ref|YP_248810.1| hypothetical protein NTHI1317 [Haemophilus influenzae 86-028NP]
 gi|68057897|gb|AAX88150.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
          Length = 172

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIIIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 I+  A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGTPIDGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|87120460|ref|ZP_01076354.1| hypothetical protein MED121_21922 [Marinomonas sp. MED121]
 gi|86164103|gb|EAQ65374.1| hypothetical protein MED121_21922 [Marinomonas sp. MED121]
          Length = 183

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 64/176 (36%), Gaps = 31/176 (17%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           LV   L A++SQA             + I I+AD   + +    A + GNV + Q    +
Sbjct: 10  LVCSTLGANISQALPE-------DSLQAIEIEADSAFIDNDKGSAIYIGNVKVNQGTILI 62

Query: 77  QADKMT------------IDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
            A+K+T            I    T+  V+N   ++    ++ I  G         + D  
Sbjct: 63  SANKLTITSSNETNKYDKIYAKGTDTQVANFSQQLTASGDMIISRGNRI------FYDSS 116

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           + IL + G+   K       +  +   +  ++ T     +     +  S I+ + +
Sbjct: 117 QSILEVEGESYIK----RGEDEIMAHFIRYDMTTGT--FEARNKSKGSSEIKQNKK 166


>gi|308062851|gb|ADO04739.1| hypothetical protein HPCU_08030 [Helicobacter pylori Cuz20]
          Length = 185

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 61/174 (35%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+  + +L    +  A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCVLVCCLGIL---SVMSAQKTDNKGLKKER-ELLEITGNQFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|317011805|gb|ADU85552.1| hypothetical protein HPSA_08055 [Helicobacter pylori SouthAfrica7]
          Length = 185

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 59/174 (33%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+    +L       A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCFLVCCFGILSVMG---AQKTDNKGLKKE-KELLEITGNQFIANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|16273644|ref|NP_439307.1| hypothetical protein HI1149m [Haemophilus influenzae Rd KW20]
 gi|260580233|ref|ZP_05848063.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae RdAW]
 gi|1176174|sp|P45074|LPTA_HAEIN RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|260093517|gb|EEW77450.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae RdAW]
          Length = 172

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 ++  A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|188528360|ref|YP_001911047.1| hypothetical protein HPSH_08170 [Helicobacter pylori Shi470]
 gi|308183723|ref|YP_003927850.1| hypothetical protein HPPC_08010 [Helicobacter pylori PeCan4]
 gi|188144600|gb|ACD49017.1| hypothetical protein HPSH_08170 [Helicobacter pylori Shi470]
 gi|308064350|gb|ADO06237.1| hypothetical protein HPSAT_07685 [Helicobacter pylori Sat464]
 gi|308065908|gb|ADO07800.1| hypothetical protein HPPC_08010 [Helicobacter pylori PeCan4]
          Length = 185

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQ--KTDDKGLKKER-ELLEITGNKFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|94986898|ref|YP_594831.1| hypothetical protein LI0455 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731147|emb|CAJ54509.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 189

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 66/180 (36%), Gaps = 19/180 (10%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++  + L+  L+         +   +   LG  +  I +D L      Q+  F  NV + 
Sbjct: 5   FVSQVLLLIGLIYTYNQPTLYAQPIKKGSLGTVETKIFSDELTYDLEKQQITFNKNVHVQ 64

Query: 71  QEDFSLQADKMTIDYNNTNRDVSN---------------KINRMDVERNIFIQSGEINVI 115
           + DF L  D +TI      +   N               ++  +  +RN+ I+  +    
Sbjct: 65  RPDFQLTTDTLTIYLAPQKKSQKNEDLSTNPISSKISAGELKHIVAKRNVCIKGDKYTGT 124

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           A       +  IL+L     D  +L +  NT  G  +   I  + + +   ++ +V++  
Sbjct: 125 AGKVTYTEKTGILLL----EDSPVLTDGENTITGDSIRYYIYENRSEVIRGKNKRVEATF 180


>gi|255318177|ref|ZP_05359416.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SK82]
 gi|262379614|ref|ZP_06072770.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SH164]
 gi|255304723|gb|EET83901.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SK82]
 gi|262299071|gb|EEY86984.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SH164]
          Length = 188

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/147 (16%), Positives = 49/147 (33%), Gaps = 17/147 (11%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +L A L   + + +       N+ I + AD     +      + GNV + Q    LQA+
Sbjct: 17  AVLTALLGVTSVAAL-ALPSDRNQPISLVADRATYNEKTGITTYTGNVIIEQGTMKLQAN 75

Query: 80  KMTIDYNNTNRDVSNKINRMDVERN-------IFIQSGEINVIASNGYVDFQKRILVLNG 132
            +         + S +I+ +            +    G     A     + +  I+ L+G
Sbjct: 76  SIV-----AQLNKSRQISTITATGKPAKFQQQLDTNKGLARGEAQKIVYNAETGIITLSG 130

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTS 159
                  L +   +  G  L  +++  
Sbjct: 131 GAY----LYQNGASIRGNTLRYSMNKG 153


>gi|126641285|ref|YP_001084269.1| putative transport protein [Acinetobacter baumannii ATCC 17978]
          Length = 139

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 45/137 (32%), Gaps = 16/137 (11%)

Query: 49  ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN---- 104
           AD     +      + GNV + Q    LQAD +         +   +I  +  +      
Sbjct: 2   ADRATYNEKTGLTTYTGNVVIEQGTMKLQADSIV-----ATLNSKREIQTITAKGRPSKF 56

Query: 105 ---IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              I    G           +    I+ L+G       L +  ++  G  L  +++    
Sbjct: 57  QQQISADKGIARGEGQTIVYNADTGIITLSGGAY----LYQDGSSIRGNTLKYSMNKGDV 112

Query: 162 SLQGCESDQVQSIIRYD 178
             QG  S++VQ II   
Sbjct: 113 EAQGSSSNRVQIIIPPS 129


>gi|157963428|ref|YP_001503462.1| cell envelope biogenesis YhbN [Shewanella pealeana ATCC 700345]
 gi|157848428|gb|ABV88927.1| Cell envelope biogenesis YhbN [Shewanella pealeana ATCC 700345]
          Length = 179

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/139 (18%), Positives = 48/139 (34%), Gaps = 7/139 (5%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           +++ I A   E      +  F G V +TQ    + AD++ +         +         
Sbjct: 28  QEVKIAAASQEADIKNNQVIFFGPVEVTQGSIKMNADELRVFSKEDKSGKTLVATGNPAT 87

Query: 103 RNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF- 160
               ++ G      A     +   R L L G+      L +  +   G ++  NI     
Sbjct: 88  YTQMMEDGRPATASAKEIRYELATRTLTLVGEAT----LAQDGSQVTGNRIKYNISLQQL 143

Query: 161 -ASLQGCESDQVQSIIRYD 178
            A   G   D+V +II+ +
Sbjct: 144 IAESTGKGDDRVITIIQPE 162


>gi|21243697|ref|NP_643279.1| hypothetical protein XAC2970 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109278|gb|AAM37815.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 186

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 26  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 85

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 86  KQATLKQEMDDGATMHGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 141

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 142 TGNMQ-SGGDGSRVRTIIQP 160


>gi|83591352|ref|YP_425104.1| hypothetical protein Rru_A0012 [Rhodospirillum rubrum ATCC 11170]
 gi|83574266|gb|ABC20817.1| hypothetical protein Rru_A0012 [Rhodospirillum rubrum ATCC 11170]
          Length = 323

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 52/139 (37%), Gaps = 18/139 (12%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFK 64
           + +   + + AL+ +   A  +Q A          G + + + AD  +E +         
Sbjct: 16  SRLIRALGVAALLVLAPTAAGAQTA----------GGQPLEVYADDGIEWRRDEAVYIAN 65

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVS-------NKINRMDVERNIFIQSGEINVIAS 117
           GN    Q D  ++AD++   Y       +         I RM+   N+ I   +  +  +
Sbjct: 66  GNAAAIQGDSEVRADRLLARYRTDASAGAESSDTGGGDIYRMEAHGNVRILLTDRTITGT 125

Query: 118 NGYVDFQKRILVLNGDRAD 136
           +   D  ++++ L GD   
Sbjct: 126 DAVRDLDRKVMWLTGDNLK 144



 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 46/154 (29%), Gaps = 29/154 (18%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQ--EDFSLQADKMTIDYNNT------------------- 88
           D LE  +    A  +GN    Q     ++ AD +T  + +                    
Sbjct: 156 DSLEYWEERNLAVARGNATSRQIASRQTITADVLTAYFKDASTPKTAGSAKGKPATSKSG 215

Query: 89  ----NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                    + I  M    N+ + +    +       D       + G     V +  + 
Sbjct: 216 AGLAAPAEGSNIKVMTAVGNVVVVTPNEVIRGDEATYDPTSGQATVLG----AVRITTEG 271

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
               G +  VN+ T  + L G   D+ +++ +  
Sbjct: 272 EQLNGTRATVNMKTGVSRLFGDGQDRARALFKPS 305


>gi|261838855|gb|ACX98621.1| hypothetical protein KHP_1437 [Helicobacter pylori 51]
          Length = 185

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFSVLSVMSAQ--KTDNKGLKKER-ELLEITGNKFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|217033820|ref|ZP_03439245.1| hypothetical protein HP9810_877g24 [Helicobacter pylori 98-10]
 gi|216943718|gb|EEC23161.1| hypothetical protein HP9810_877g24 [Helicobacter pylori 98-10]
          Length = 185

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFSVLSVMSAQ--KTDNKGLKKER-ELLEITGNKFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|152978020|ref|YP_001343649.1| organic solvent tolerance protein [Actinobacillus succinogenes
           130Z]
 gi|150839743|gb|ABR73714.1| Organic solvent tolerance protein [Actinobacillus succinogenes
           130Z]
          Length = 793

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 57/157 (36%), Gaps = 17/157 (10%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQA---------AASYMTRFKVLGN---EKIHIKAD 50
           A  +S + +I L  L  +      + A              T   V G+   + ++I+AD
Sbjct: 6   AMKHSSYSFISLAILTALYSGGAWANADNLHRRCLSGVPQFTGEPVSGDANEQPVYIEAD 65

Query: 51  MLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG 110
             ++ +   +A + G+V + Q +  LQA ++ +       + +N +           +  
Sbjct: 66  SADIINP-SRATYSGDVDIKQGNRHLQAPQVVVT---QKGEGANALRHAYANGAFNYRDE 121

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
            I +   N  ++       +  +   + + ++   T 
Sbjct: 122 LILLKGENARINLNNNDADIT-NSDYQFVGRQGRGTA 157


>gi|288956948|ref|YP_003447289.1| hypothetical protein AZL_001070 [Azospirillum sp. B510]
 gi|288909256|dbj|BAI70745.1| hypothetical protein AZL_001070 [Azospirillum sp. B510]
          Length = 291

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 56/152 (36%), Gaps = 7/152 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q A       K++  + +    D LE  +A      +G+    + +  L+AD + I    
Sbjct: 123 QVAVVTGKDLKLITAKDVVTARDSLEYYEAQDLTVARGDAVAVRGNDRLRAD-VLIGRLK 181

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
              D ++++ R+D   NI + +     ++          + VL G+    V +    N  
Sbjct: 182 KMPDGTSQMERIDGSGNIIVTTPTDVALSDKLVYSVADNVAVLIGN----VRITRGDNQL 237

Query: 148 LGCKLIVNIDTSFASLQG--CESDQVQSIIRY 177
            G    +N++T    +        +V  ++  
Sbjct: 238 NGEAAEMNMNTKINRVIAGRDAGGRVSGLLIP 269



 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 46/106 (43%), Gaps = 2/106 (1%)

Query: 38  KVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
            + G + + I AD  +E    V+    +GN    + + ++ AD +T  Y        N++
Sbjct: 35  GMGGKQPVEINADQAIEWHQDVRAYVARGNASAKRNESTVFADVLTAYYREVPGKG-NEV 93

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
            ++  + N+ + S    V   +G  D  K++ V+ G     +  K+
Sbjct: 94  FQLVADGNVRVVSPNQQVFGDHGVYDVDKQVAVVTGKDLKLITAKD 139


>gi|332674379|gb|AEE71196.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Helicobacter pylori 83]
          Length = 185

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 61/174 (35%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+  + VL    +  A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCVLVCCLSVL---SVMSAQKTDNKGLKKER-ELLEITGNQFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTKDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 VLNGEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|83647981|ref|YP_436416.1| hypothetical protein HCH_05318 [Hahella chejuensis KCTC 2396]
 gi|83636024|gb|ABC31991.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 174

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 67/179 (37%), Gaps = 26/179 (14%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +   AL+  L+   LS A            +E + IKA   E         + GNV +TQ
Sbjct: 7   LFTAALLVALVFTPLSHALDLLNG-----SDEPVRIKAGRWERDGQKGIDTYIGNVVITQ 61

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERN----IFIQSGEIN---VIASNGYVDFQ 124
              S++ADK+ +  ++        I+R          +   + +       A +   D  
Sbjct: 62  GKSSIEADKVVLYTDDKG------ISRFQATGKPAHLVQFDAEKQTETHAYAESMDYDRS 115

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIV----NIDTSFASLQGCESDQVQSIIRYDG 179
           +  +V+        IL++  +   G ++I      + T+  +  G +++QV+ I     
Sbjct: 116 QSKVVMRNHAR---ILQDNSSV-EGEEIIYFTDKRLVTAKGASSGNQTEQVEIIYHPPK 170


>gi|146329290|ref|YP_001209444.1| OstA-like family protein [Dichelobacter nodosus VCS1703A]
 gi|146232760|gb|ABQ13738.1| OstA-like family protein [Dichelobacter nodosus VCS1703A]
          Length = 151

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/142 (11%), Positives = 42/142 (29%), Gaps = 21/142 (14%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            ++I + AD  E       A + G+V + Q +  L  DK+ + ++         + +++ 
Sbjct: 22  QDEISLSADQGEYDAEKGIATYTGHVAIAQANMKLTGDKVVVHFDKG------AVTKIEA 75

Query: 102 ERNIFI------QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                           I               + + GD +    + +  N     +L   
Sbjct: 76  WGRRVTFHYQPNNEPAITGQGDFMVYVIHTATVEIEGDAS----VMQGDNETKAERLTYQ 131

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
           +             ++Q  +  
Sbjct: 132 LKQQRLR-----GKRIQMTLNP 148



 Score = 38.8 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 31/86 (36%), Gaps = 7/86 (8%)

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
           I  +  +  I     EI++ A  G  D +K I    G     V + +      G K++V+
Sbjct: 12  IMPIYAQNKI---QDEISLSADQGEYDAEKGIATYTGH----VAIAQANMKLTGDKVVVH 64

Query: 156 IDTSFASLQGCESDQVQSIIRYDGRP 181
            D    +       +V    + +  P
Sbjct: 65  FDKGAVTKIEAWGRRVTFHYQPNNEP 90


>gi|225025297|ref|ZP_03714489.1| hypothetical protein EIKCOROL_02195 [Eikenella corrodens ATCC
           23834]
 gi|224941915|gb|EEG23124.1| hypothetical protein EIKCOROL_02195 [Eikenella corrodens ATCC
           23834]
          Length = 172

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 44/143 (30%), Gaps = 9/143 (6%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             N+ I I+AD   +    +   F GNV + Q    ++A K+ +                
Sbjct: 31  DRNQPIQIEADQGSLDQGNRSTEFSGNVVIQQGTMYIRAAKVRVVKAADGAQTMTASGSP 90

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
                   + G +   A+         I+ L+G    +       +   G  +  N  T 
Sbjct: 91  VHFGQQLDRQGTVKGQAARVEYQSATGIVKLSGGAKIE----RGGDRASGDTITYNTRTE 146

Query: 160 FASLQG-----CESDQVQSIIRY 177
             ++ G         +V   I+ 
Sbjct: 147 VYTVLGGSRSNANKGRVSITIQP 169


>gi|317015005|gb|ADU82441.1| hypothetical protein HPGAM_08385 [Helicobacter pylori Gambia94/24]
          Length = 185

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 60/174 (34%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+  + VL    +  A        K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCFLVCCLSVL---SVMSAQKLENKGLKKER-ELLEITGNQFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKFNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|1574705|gb|AAC22804.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
          Length = 159

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 4   ASSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVIT---RP 60

Query: 90  RDVSNKINRMDVER------NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++                 ++  A+  + D     L L  +      LK+ 
Sbjct: 61  AEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNAE----LKQL 116

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 117 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 151


>gi|238650255|ref|YP_002916106.1| hypothetical protein RPR_00295 [Rickettsia peacockii str. Rustic]
 gi|238624353|gb|ACR47059.1| hypothetical protein RPR_00295 [Rickettsia peacockii str. Rustic]
          Length = 169

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y     D    I+ + V   
Sbjct: 57  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTQELYIFYK--TIDEKQTIDHIVVPTK 114

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 115 LTVERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 165


>gi|119946513|ref|YP_944193.1| OstA family protein [Psychromonas ingrahamii 37]
 gi|119865117|gb|ABM04594.1| OstA family protein [Psychromonas ingrahamii 37]
          Length = 173

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 34  MTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
                +  +  + IH+ +    V     +  F+ +V +TQ    L ADK+T+      + 
Sbjct: 17  FASIALESDFTQPIHVSSVSQHVTMKNDRVVFQDDVLLTQGTIKLTADKLTVI---QGKQ 73

Query: 92  VSNKINRMDVERNIFIQSGEIN------VIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            + +I  M  E ++                A+    D  K  + L G+   K +  +   
Sbjct: 74  SNQEI--MIAEGSVATFYQTQEDGKPIDAEANVIRYDVAKAQVTLTGNAQVKQLKSQ--- 128

Query: 146 TFLGCKLIVNIDTSFASLQGC-ESDQVQSIIRY 177
              G K+I  ++T   ++    +  +V ++   
Sbjct: 129 -INGSKIIYFMETEELTVSNDGKETRVTTVFLP 160


>gi|294625297|ref|ZP_06703935.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665380|ref|ZP_06730669.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600418|gb|EFF44517.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604839|gb|EFF48201.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 166

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 6   DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 65

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 66  KQATLKQEMDDGATMHGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 121

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V+++I+ 
Sbjct: 122 TGNMQ-SGGDGSRVRTVIQP 140


>gi|283783843|ref|YP_003363708.1| organic solvent tolerance protein precursor [Citrobacter rodentium
           ICC168]
 gi|282947297|emb|CBG86842.1| organic solvent tolerance protein precursor [Citrobacter rodentium
           ICC168]
          Length = 785

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 52/147 (35%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF--------KVLGNE-KIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M           +   NE  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAASLASQCMLGVPSYDRPLVQGETNELPVTINADSAKGNYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F GNV + Q +  LQAD++ +            I  +D   N+     ++ +    
Sbjct: 66  D-AVFTGNVDIMQGNSRLQADEVQLH-QKAAPGQQEPIRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWKGDY--QMVGRQGR 148


>gi|89093949|ref|ZP_01166894.1| hypothetical protein MED92_01594 [Oceanospirillum sp. MED92]
 gi|89081835|gb|EAR61062.1| hypothetical protein MED92_01594 [Oceanospirillum sp. MED92]
          Length = 175

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 60/155 (38%), Gaps = 24/155 (15%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              + IHI AD   + D      +KG V +TQ    ++AD + +            ++++
Sbjct: 26  DQEKPIHITADTASINDKTGITTYKGKVVITQGSLLIEADYVDMY------RGDEGVDKL 79

Query: 100 DVERNI--FIQSGEINVIASNGY-----VDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
             +     F Q  EIN   S+ +          + L +   +  KV+  +  +TF G K+
Sbjct: 80  IAKGAPAHFRQQPEINGAFSDAWGLHMVYMVNDQKLTIT--KQAKVV--QAKDTFTGEKI 135

Query: 153 IVNIDT------SFASLQGCES-DQVQSIIRYDGR 180
           I ++D               ES  +V  +I+   +
Sbjct: 136 IYDLDRSIVDAFGTNKGDPGESKGRVNMVIQPKKK 170


>gi|325922181|ref|ZP_08183969.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           gardneri ATCC 19865]
 gi|325547351|gb|EGD18417.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           gardneri ATCC 19865]
          Length = 184

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 54/139 (38%), Gaps = 7/139 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    + 
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLVG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        +N  A N        ++VL G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQQMDDGAMMNGQADNIEYQVANEVIVLTGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSIIR 176
           T      G +  +V++II+
Sbjct: 139 TGNMQ-SGGDGSRVRTIIQ 156


>gi|302342254|ref|YP_003806783.1| OstA family protein [Desulfarculus baarsii DSM 2075]
 gi|301638867|gb|ADK84189.1| OstA family protein [Desulfarculus baarsii DSM 2075]
          Length = 774

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 49/125 (39%), Gaps = 14/125 (11%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           +  N + L I + AL+       L+Q+        ++  +  + ++AD L   D      
Sbjct: 8   SCANYLVLMI-VAALLVFSAGPALAQS----NELVRLETSTPVDVRADKLTYDDKTNSYL 62

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
            +G V +TQ    L ADK+ +          + I   + E N+ + S    V A++  V+
Sbjct: 63  AEGEVEITQGANRLVADKVRLF-------SQSMIA--EAEGNVSMVSPSQVVSAASLVVN 113

Query: 123 FQKRI 127
                
Sbjct: 114 LNTST 118


>gi|229586751|ref|YP_002845252.1| hypothetical protein RAF_ORF0605 [Rickettsia africae ESF-5]
 gi|228021801|gb|ACP53509.1| Unknown [Rickettsia africae ESF-5]
          Length = 194

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y     D    I+ + V   
Sbjct: 82  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTKELYIFYK--TIDEKQTIDHIVVPTK 139

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 140 LTVERKIKNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|312170874|emb|CBX79133.1| LPS export porin complex, periplasmic chaparone precursor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 183

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 53/156 (33%), Gaps = 14/156 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A++          N+ +++ ++   +      A F GNV +TQ    + ADK+ +    T
Sbjct: 20  ASSVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVLVTQGSIKITADKVVV----T 75

Query: 89  NRDVSNKINRMDVERNI------FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                +K   +D   N+            +   A     +     + L G+      L++
Sbjct: 76  RPGGDSKKTIVDAYGNLATFYQMQDNGKPVQGHAEKMRYELANDRVELTGNAY----LEQ 131

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   G ++   +        G    +V +++   
Sbjct: 132 LDSNVKGDRITYLVKEQKMQAYGNTGKRVTTVLVPS 167


>gi|239947701|ref|ZP_04699454.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921977|gb|EER22001.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 194

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 52/115 (45%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y       +  I+ + V   
Sbjct: 82  LHITSDTLIIDRTKQKAEYLGNVVVYFDNAILRTKELYIFYKTIAEKQT--IDHVVVPTK 139

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 140 LTVERKINNELLLADSAKYFFDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|312958999|ref|ZP_07773518.1| OstA family protein [Pseudomonas fluorescens WH6]
 gi|311286769|gb|EFQ65331.1| OstA family protein [Pseudomonas fluorescens WH6]
          Length = 177

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 58/170 (34%), Gaps = 23/170 (13%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + +L  +  +L +  + A  +          + IHI AD  ++ D    A + G V +TQ
Sbjct: 7   LPILLGLGAVLGSVSAWALPN-------DSQQPIHISADDAQLDDKQGVATYTGGVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI--------ASNGYVDF 123
               +  + +T+      R  S  I+ +    N+     + +                  
Sbjct: 60  GSMKITGNTVTLT-----RTQSGDIDVVTSVGNLAYFEQKQSATDTGPMKGYGKTIQYHA 114

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
           Q+  +VL        +L    N+  G K+  +     A+       +V +
Sbjct: 115 QQNRIVL---IDQAKVLSPDGNSTEGEKITYDTVKQIANAGRANGSKVTA 161


>gi|311280963|ref|YP_003943194.1| Organic solvent tolerance protein [Enterobacter cloacae SCF1]
 gi|308750158|gb|ADO49910.1| Organic solvent tolerance protein [Enterobacter cloacae SCF1]
          Length = 800

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 51/150 (34%), Gaps = 14/150 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIASALYSQQGAAADLASQCMLGVPTYNRPLVQGDTNSLPVTINADHAKGNYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F GNV + Q +  LQAD++ +         +  +  +D   N+     ++ +    
Sbjct: 66  N-AVFTGNVDVNQGNSRLQADEVQLH-QKEAPGQATPVRTVDALGNVHYDDNQVILTGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKLNTF 147
            + +   +   V  GD   +++ ++   T 
Sbjct: 124 AWSNLNTKDTNVWKGDY--QMVGRQGRGTA 151


>gi|297380743|gb|ADI35630.1| cell envelope biogenesis protein YhbN [Helicobacter pylori v225d]
          Length = 185

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  +L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 3   WWCVLVCCFGILSVMSAQ--KTDDKGLKKER-ELLEITGNKFVANDKTKTAVIQGNVQIK 59

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 60  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 114

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 115 GEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|145641261|ref|ZP_01796841.1| hypothetical protein CGSHiR3021_05649 [Haemophilus influenzae
           R3021]
 gi|145274098|gb|EDK13964.1| hypothetical protein CGSHiR3021_05649 [Haemophilus influenzae
           22.4-21]
          Length = 172

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 53/155 (34%), Gaps = 13/155 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 17  ASSSAFALKDDVNQPINIISDNQSLDMEKSVVTFTDNVVITQGSIIIKANKVVIT---RP 73

Query: 90  RDVSNKINRMDVER-NIFIQSGEINVI-----ASNGYVDFQKRILVLNGDRADKVILKEK 143
            + S K   ++     +       N       A+  + D     L L  +      LK+ 
Sbjct: 74  AEKSGKKETVEAFGTPVTFHQQLDNGTPVDGKANKVHYDLGNEFLTLTNNAE----LKQL 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   G  +  ++        G    +V +++   
Sbjct: 130 DSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|325998439|gb|ADZ50647.1| hypothetical protein hp2017_1522 [Helicobacter pylori 2017]
          Length = 185

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 49/137 (35%), Gaps = 14/137 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I  +     D  + A  +GNV + +    L ADK+++  N+  +       R +   N
Sbjct: 34  LEITGNQFVANDKTKTAVIQGNVQIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGN 88

Query: 105 IFIQ-----SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDT 158
                    + EI+  A     +       L     + V+ +    N   G ++I+N   
Sbjct: 89  THFNIFTEDNREISGSADKLIYNALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTK 145

Query: 159 SFASLQGCESDQVQSII 175
            +A + G      + + 
Sbjct: 146 GYADVLGSAKRPAKFVF 162


>gi|307638255|gb|ADN80705.1| OstA family organic solvent tolerance protein [Helicobacter pylori
           908]
 gi|325996847|gb|ADZ52252.1| hypothetical protein hp2018_1528 [Helicobacter pylori 2018]
          Length = 185

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 49/137 (35%), Gaps = 14/137 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I  +     D  + A  +GNV + +    L ADK+++  N+  +       R +   N
Sbjct: 34  LEITGNQFVANDKTKTAVIQGNVQIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGN 88

Query: 105 IFIQ-----SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDT 158
                    + EI+  A     +       L     + V+ +    N   G ++I+N   
Sbjct: 89  THFNIFTEDNREISGSADKLIYNALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTK 145

Query: 159 SFASLQGCESDQVQSII 175
            +A + G      + + 
Sbjct: 146 GYADVLGSAKRPAKFVF 162


>gi|292486806|ref|YP_003529676.1| LPS export porin complex, periplasmic chaperone [Erwinia amylovora
           CFBP1430]
 gi|291552223|emb|CBA19260.1| LPS export porin complex, periplasmic chaparone precursor [Erwinia
           amylovora CFBP1430]
          Length = 183

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 53/156 (33%), Gaps = 14/156 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A++          N+ +++ ++   +      A F GNV +TQ    + ADK+ +    T
Sbjct: 20  ASSVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVLVTQGSIKITADKVVV----T 75

Query: 89  NRDVSNKINRMDVERNI------FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                +K   +D   N+            +   A     +     + L G+      L++
Sbjct: 76  RPGGDSKKTIVDAYGNLATFYQMQDNGKPVQGHAEKMRYELANDRVELTGNAY----LEQ 131

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   G ++   +        G    +V +++   
Sbjct: 132 LDSNVKGDRITYLVKEQKMQAYGNTGKRVTTVLVPS 167


>gi|261840261|gb|ACY00027.1| hypothetical protein HPKB_1491 [Helicobacter pylori 52]
          Length = 185

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 49/137 (35%), Gaps = 14/137 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I  +     D  + A  +GNV + +    L ADK+++  N+  +       R +   N
Sbjct: 34  LEITGNQFVANDKTKTAVIQGNVQIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGN 88

Query: 105 IFIQ-----SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDT 158
                    + EI+  A     +       L     + V+ +    N   G ++I+N   
Sbjct: 89  THFNIFTEDNREISGSADKLIYNALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTK 145

Query: 159 SFASLQGCESDQVQSII 175
            +A + G      + + 
Sbjct: 146 GYADVLGSAKRPAKFVF 162


>gi|108563942|ref|YP_628258.1| hypothetical protein HPAG1_1517 [Helicobacter pylori HPAG1]
 gi|107837715|gb|ABF85584.1| hypothetical protein HPAG1_1517 [Helicobacter pylori HPAG1]
          Length = 185

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 49/137 (35%), Gaps = 14/137 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I  +     D  + A  +GNV + +    L ADK+++  N+  +       R +   N
Sbjct: 34  LEITGNQFVANDKTKTAVIQGNVQIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGN 88

Query: 105 IFIQ-----SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDT 158
                    + EI+  A     +       L     + V+ +    N   G ++I+N   
Sbjct: 89  THFNIFTEDNREISGSADKLIYNALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTK 145

Query: 159 SFASLQGCESDQVQSII 175
            +A + G      + + 
Sbjct: 146 GYADVLGSAKRPAKFVF 162


>gi|15646175|ref|NP_208359.1| hypothetical protein HP1568 [Helicobacter pylori 26695]
 gi|2314755|gb|AAD08611.1| predicted coding region HP1568 [Helicobacter pylori 26695]
          Length = 183

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 49/137 (35%), Gaps = 14/137 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I  +     D  + A  +GNV + +    L ADK+++  N+  +       R +   N
Sbjct: 34  LEITGNQFVANDKTKTAVIQGNVQIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGN 88

Query: 105 IFIQ-----SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDT 158
                    + EI+  A     +       L     + V+ +    N   G ++I+N   
Sbjct: 89  THFNIFTEDNREISGSADKLIYNALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTK 145

Query: 159 SFASLQGCESDQVQSII 175
            +A + G      + + 
Sbjct: 146 GYADVLGSAKRPAKFVF 162


>gi|262164101|ref|ZP_06031840.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus VM223]
 gi|262027629|gb|EEY46295.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus VM223]
          Length = 780

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI  +++          + L
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNSDEMTL 131


>gi|262172453|ref|ZP_06040131.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus MB-451]
 gi|261893529|gb|EEY39515.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus MB-451]
          Length = 753

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 25  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 74

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI  +++          + L
Sbjct: 75  AEGNVQFSDGEIKTLSTKATNHLNSDEMTL 104


>gi|258623408|ref|ZP_05718412.1| LPS-assembly protein precursor [Vibrio mimicus VM573]
 gi|258584374|gb|EEW09119.1| LPS-assembly protein precursor [Vibrio mimicus VM573]
          Length = 780

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI  +++          + L
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNSDEMTL 131


>gi|258627056|ref|ZP_05721854.1| LPS-assembly protein precursor [Vibrio mimicus VM603]
 gi|258580730|gb|EEW05681.1| LPS-assembly protein precursor [Vibrio mimicus VM603]
          Length = 780

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI  +++          + L
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNSDEMTL 131


>gi|297171736|gb|ADI22728.1| hypothetical protein [uncultured verrucomicrobium HF0500_27H16]
          Length = 189

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 57/175 (32%), Gaps = 22/175 (12%)

Query: 19  FVLLKADLSQAAASYMTRF-KVLGNEKIHIKADMLEV--KDAVQKAFFKGNVFMTQEDFS 75
            +L    + +   S  +   K   + +  I +D L +  ++      F GNV +   +  
Sbjct: 1   MLLTAWAVCEGQVSAPSAEPKAENSGETEIFSDNLVMVSREKDNYFIFTGNVEIHATNMV 60

Query: 76  LQADKMTIDYNNTNRDVS---------------NKINRMDVERNIFIQSGEINVIASNGY 120
              +++ +         +                KI R+     + +   +    A    
Sbjct: 61  ATCERLEVYAGKDAEPSAEKKQVKEKEKEEASIGKIERILATGKVRLIQKDRVATAGKAE 120

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           +  Q+  +VL     +  ++ +K  T  G ++ +       +++     + +  +
Sbjct: 121 IYPQEGKVVL----LESPVVTDKQGTLTGYRITLLQGEQKVTVESGAGQRPKITL 171


>gi|254467830|ref|ZP_05081236.1| cell envelope biogenesis protein YhbN [beta proteobacterium KB13]
 gi|207086640|gb|EDZ63923.1| cell envelope biogenesis protein YhbN [beta proteobacterium KB13]
          Length = 169

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 58/154 (37%), Gaps = 15/154 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K   ++ I I +D L + D+   + + G+V + Q    ++ DK+ I  +      S    
Sbjct: 20  KADKDQPIIIDSDELLIDDSKNISTYSGDVILQQGTLIIRGDKLIIREDKQGFQHSTSEG 79

Query: 98  RMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
           +    +     S + I   A     D     + L      K  +K+  +  +G  ++ + 
Sbjct: 80  KPTTFKQKMEGSDDYIEGQALRIEYDGNMDKIHLY----SKARVKKGNDLVIGDYIMYDA 135

Query: 157 DTSFASL----------QGCESDQVQSIIRYDGR 180
            + FA            +  +  + ++IIR D +
Sbjct: 136 SSEFAQAMSGNTKTKDGEELKKGRTRAIIRPDKK 169


>gi|261209785|ref|ZP_05924090.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC341]
 gi|260841175|gb|EEX67688.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC341]
          Length = 783

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI  +++          + L
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNTDEMTL 131


>gi|183597958|ref|ZP_02959451.1| hypothetical protein PROSTU_01307 [Providencia stuartii ATCC 25827]
 gi|188022730|gb|EDU60770.1| hypothetical protein PROSTU_01307 [Providencia stuartii ATCC 25827]
          Length = 182

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 56/166 (33%), Gaps = 16/166 (9%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
             +  A  + +  +  +  K    + + I +    +        F  +V + Q    ++A
Sbjct: 12  GAVASAIFALSVPA--SALKTDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRA 69

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNG 132
           +K+ +         S+KI  ++   N             I   AS    +  K +L L G
Sbjct: 70  NKVVVT---RPSSNSDKIT-IEAFGNPVTFYQLQDDGKPIKGRASKARYEVDKELLTLTG 125

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G K+   + T        +  +V +++   
Sbjct: 126 NAY----LEQLDSNIKGDKITYIVPTQQMEAFSDKGKRVTTVLLPS 167


>gi|124514201|gb|EAY55716.1| putative OstA family protein [Leptospirillum rubarum]
          Length = 209

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 50/129 (38%), Gaps = 17/129 (13%)

Query: 38  KVLGNEKIH--IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--- 92
           K  G + +   I AD +  ++   +  F G+V + +++  L++D + + +   +R     
Sbjct: 48  KAWGEQPVSTVINADRMLAENIQNEIHFVGHVHLVKKNLVLKSDNLDVFFVPPSRGATLM 107

Query: 93  --------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                   S KI  M    +++I+ G     A       Q    VL       V++ +  
Sbjct: 108 DNMHARQKSQKIQTMIAIGHVYIKKGNRIAYAGKAVYIAQGHYFVLT---RLPVVI-QNG 163

Query: 145 NTFLGCKLI 153
           +   G K+ 
Sbjct: 164 DRISGEKIT 172


>gi|53804951|ref|YP_113246.1| hypothetical protein MCA0743 [Methylococcus capsulatus str. Bath]
 gi|53758712|gb|AAU93003.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 177

 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 47/121 (38%), Gaps = 5/121 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD-VSN 94
                  + I+I+AD     +A  +  + G+V  TQ    + +DKM +       + V  
Sbjct: 29  GLSSDAKQPIYIEADTATYDEATGQTVYVGHVRSTQGSLIVDSDKMIVYQKEGKTEKVVA 88

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
             N + +++       +I+          +  IL+L     DK ++ +  ++    ++  
Sbjct: 89  WANPVRLKQTPDGGKEDIHGTGQRAEYFPETGILILY----DKAVVWQGGDSTESDRIEY 144

Query: 155 N 155
           +
Sbjct: 145 D 145


>gi|315638536|ref|ZP_07893712.1| OstA family protein [Campylobacter upsaliensis JV21]
 gi|315481380|gb|EFU72008.1| OstA family protein [Campylobacter upsaliensis JV21]
          Length = 154

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 56/147 (38%), Gaps = 11/147 (7%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
              F VL  +KI +KA      +   K+   GNV +++    L A+++ I  +   + + 
Sbjct: 10  FLSFNVLFADKIEVKALNFYADENTGKSVLSGNVVVSRGKDVLNAEELVIFMDKNRKPL- 68

Query: 94  NKINRMDVERN----IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
               R +  +N    I + +            +  K    +NG+     I  +K     G
Sbjct: 69  ----RYEASKNPKFSIMLNNKTYKGSGDKFIYNVAKDTYEINGNAFIHEINTDKK--LYG 122

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIR 176
            K+IV+   +   +Q  ++   + +  
Sbjct: 123 DKIIVDRKANIYQVQSRQNKPARFVFE 149


>gi|15892582|ref|NP_360296.1| hypothetical protein RC0659 [Rickettsia conorii str. Malish 7]
 gi|15619747|gb|AAL03197.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 194

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y     D    I+ + V   
Sbjct: 82  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTKELYIFYK--TIDEKQTIDHIVVPTK 139

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 140 LTVERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|22124072|ref|NP_667495.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis KIM 10]
 gi|45443566|ref|NP_995105.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis biovar Microtus str. 91001]
 gi|165928124|ref|ZP_02223956.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|167420466|ref|ZP_02312219.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|21956820|gb|AAM83746.1|AE013615_7 hypothetical protein y0152 [Yersinia pestis KIM 10]
 gi|45438435|gb|AAS63982.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|165919898|gb|EDR37199.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|166961272|gb|EDR57293.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. MG05-1020]
          Length = 188

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/146 (13%), Positives = 45/146 (30%), Gaps = 14/146 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               +   +K+D   +        F  NV + Q    ++ADK+ +       D S  I  
Sbjct: 35  GDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVV--TRPGGDQSKMI-- 90

Query: 99  MDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           ++   N             +         +     +VL GD      L++  +   G ++
Sbjct: 91  IEGFGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----LEQLDSNIKGDRI 146

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
              +          +  +V +++   
Sbjct: 147 TYLVKKQQMEAFSDKGKRVTTVLLPS 172


>gi|323495832|ref|ZP_08100900.1| LPS assembly outer membrane complex protein LptD [Vibrio
           sinaloensis DSM 21326]
 gi|323319048|gb|EGA71991.1| LPS assembly outer membrane complex protein LptD [Vibrio
           sinaloensis DSM 21326]
          Length = 771

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 45/133 (33%), Gaps = 17/133 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             + + ++AD LE  +   KA +KG+V + Q     QAD++T+               + 
Sbjct: 52  NQQPVKVEADSLEAING-NKATYKGDVVVVQGKKRFQADQVTLHEKENI---------IV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    G +   +     +     + L  +   K + +             K +  +
Sbjct: 102 AEGNVAFSDGTVKSQSDKVTNNLTTEDITLE-NTKYKFLCEPGRGDAVYIAKTGKAVYEM 160

Query: 157 DTSFASLQGCESD 169
                S+  C   
Sbjct: 161 KDG--SITSCPEG 171


>gi|109948149|ref|YP_665377.1| hypothetical protein Hac_1675 [Helicobacter acinonychis str.
           Sheeba]
 gi|109715370|emb|CAK00378.1| conserved hypothetical protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 185

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 59/174 (33%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+  + +L    +  A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCFLMCCLGIL---SMMSAQKTDNKSLKKE-KELLEITGNQFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS-----GEINVIASNGYVD 122
            + +    L A+K+ +  N+  +       R +   N           EI+  A     +
Sbjct: 57  QIKKGKDRLFANKVIVFLNDKRKP-----ERYEAIGNTRFNIFTEDHREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|292900796|ref|YP_003540165.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291200644|emb|CBJ47776.1| putative exported protein [Erwinia amylovora ATCC 49946]
          Length = 179

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 53/156 (33%), Gaps = 14/156 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A++          N+ +++ ++   +      A F GNV +TQ    + ADK+ +    T
Sbjct: 16  ASSVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVLVTQGSIKITADKVVV----T 71

Query: 89  NRDVSNKINRMDVERNI------FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
                +K   +D   N+            +   A     +     + L G+      L++
Sbjct: 72  RPGGDSKKTIVDAYGNLATFYQMQDNGKPVQGHAEKMRYELANDRVELTGNAY----LEQ 127

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   G ++   +        G    +V +++   
Sbjct: 128 LDSNVKGDRITYLVKEQKMQAYGNTGKRVTTVLVPS 163


>gi|90415751|ref|ZP_01223685.1| hypothetical protein GB2207_10546 [marine gamma proteobacterium
           HTCC2207]
 gi|90333074|gb|EAS48244.1| hypothetical protein GB2207_10546 [marine gamma proteobacterium
           HTCC2207]
          Length = 194

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 57/162 (35%), Gaps = 17/162 (10%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +L   LS   A+          + I I++D  E  +   +  ++GNV ++Q    ++AD
Sbjct: 23  TILIVVLSSVLATQCLALPDDRQQTISIESDYAERNEKTGRTIYRGNVVISQGSVLVEAD 82

Query: 80  KMTIDYNNTNRDVSNKINRMDVER-------NIFIQSGEINVIASNGYVDFQKRILVLNG 132
           ++ +   +      NKI+R++             I+   +   A +         L L  
Sbjct: 83  QIVLHLED------NKISRIECTGKPASYKQKPTIEGATMIARADHIDYMPATNKLALK- 135

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSI 174
                 +L        G  +  +I+      +G    Q + I
Sbjct: 136 ---QNAMLSRNGTIIKGDSIDYDINKETWKAKGDNQGQQKRI 174


>gi|15599656|ref|NP_253150.1| hypothetical protein PA4460 [Pseudomonas aeruginosa PAO1]
 gi|116052492|ref|YP_792805.1| hypothetical protein PA14_57920 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893551|ref|YP_002442420.1| hypothetical protein PLES_48391 [Pseudomonas aeruginosa LESB58]
 gi|254238878|ref|ZP_04932201.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254244726|ref|ZP_04938048.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9950696|gb|AAG07848.1|AE004860_4 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587713|gb|ABJ13728.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170809|gb|EAZ56320.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198104|gb|EAZ62167.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218773779|emb|CAW29593.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 175

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 68/186 (36%), Gaps = 24/186 (12%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+N++ L   L A +   +   L                + I ++AD  E+ D    A +
Sbjct: 3   FVNTLPLIFGLTAALGSSMALALPS-----------DREQPIRVQADSAELDDKQGVAVY 51

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNR-DVSNKINRMDVERNIFIQSGEIN-VIASNGYV 121
           +G+V +TQ    L  + +T+  +     +V   + +            ++          
Sbjct: 52  RGDVVVTQGSTKLTGNTVTLKQDKNGDIEVVTSVGKPAYYEQKPAPDKDVTKAYGLTIQY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN-----IDTSFASLQ--GCESDQVQSI 174
              +  +VL      KVI  ++ NTF G K++ +     ++   A+         ++  +
Sbjct: 112 FVTQNRVVLI--DQAKVI--QEGNTFEGEKIVYDTQRQIVNAGRATGSQVTSPRPRIDMV 167

Query: 175 IRYDGR 180
           I+   +
Sbjct: 168 IQPKKK 173


>gi|157828533|ref|YP_001494775.1| hypothetical protein A1G_03750 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933248|ref|YP_001650037.1| hypothetical protein RrIowa_0788 [Rickettsia rickettsii str. Iowa]
 gi|157801014|gb|ABV76267.1| hypothetical protein A1G_03750 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908335|gb|ABY72631.1| hypothetical protein RrIowa_0788 [Rickettsia rickettsii str. Iowa]
          Length = 138

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y     D    I+ + V   
Sbjct: 26  LHITSDSLIIDRTKQKAAYLGNVIVYFDNVILRTKELYIFYK--TIDEKQTIDHIVVPTK 83

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 84  LTVERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 134


>gi|207092004|ref|ZP_03239791.1| hypothetical protein HpylHP_02888 [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 183

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 59/171 (34%), Gaps = 17/171 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            +  L   F +L    +Q   +     K    E + I  +     D  + A  +GNV + 
Sbjct: 1   MVVFLVCCFGILSVMSAQKTENK--GLKKER-ELLEITGNQFVANDKTKTAVIQGNVQIK 57

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVDFQK 125
           +    L ADK+++  N+  +       R +   N         + EI+  A     +   
Sbjct: 58  KGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYNALN 112

Query: 126 RILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
               L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 113 GEYKL---LQNAVVREVGKSNVITGDEIILNKTKGYADVLGSAKRPAKFVF 160


>gi|167031976|ref|YP_001667207.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida GB-1]
 gi|166858464|gb|ABY96871.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida GB-1]
          Length = 174

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 13/129 (10%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             ++ I I+AD   + D    A + G+V +TQ    ++ + +TI      R  S  I+ +
Sbjct: 28  DRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTIT-----RSASGDIDVV 82

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK------LNTFLGCKLI 153
               N  +   E    A+         + +    + D VIL ++       NT  G K++
Sbjct: 83  TSVGN--LAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVILTDRAKVENEGNTTEGEKIV 140

Query: 154 VNIDTSFAS 162
            N  T  A+
Sbjct: 141 YNTQTQVAT 149


>gi|317181270|dbj|BAJ59056.1| hypothetical protein HPF32_1474 [Helicobacter pylori F32]
          Length = 185

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 61/174 (35%), Gaps = 18/174 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +  L+  + VL    +  A  +     K    E + I  +     D  + A  +GNV
Sbjct: 1   MRWWCVLVCCLSVL---SVMSAQKTDDKGLKKER-ELLEITGNKFVANDKTKTAVIQGNV 56

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-----SGEINVIASNGYVD 122
            + +    L ADK+++  N+  +       R +   N         + EI+  A     +
Sbjct: 57  QIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGNTHFNIFTEDNREISGSADKLIYN 111

Query: 123 FQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                  L     + V+ +    N   G ++I+N    +A + G      + + 
Sbjct: 112 ALNGEYKL---LQNAVVREVGKSNVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|34580434|ref|ZP_00141914.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28261819|gb|EAA25323.1| unknown [Rickettsia sibirica 246]
          Length = 194

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y     D    I+ + V   
Sbjct: 82  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTKELHIFYK--TIDEKQTIDHIVVPTK 139

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 140 LTVERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|26987690|ref|NP_743115.1| hypothetical protein PP_0954 [Pseudomonas putida KT2440]
 gi|148546236|ref|YP_001266338.1| cell envelope biogenesis YhbN [Pseudomonas putida F1]
 gi|24982376|gb|AAN66579.1|AE016286_3 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148510294|gb|ABQ77154.1| Cell envelope biogenesis YhbN [Pseudomonas putida F1]
          Length = 174

 Score = 58.1 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 13/129 (10%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             ++ I I+AD   + D    A + G+V +TQ    ++ + +TI      R  S  I+ +
Sbjct: 28  DRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTIT-----RSASGDIDVV 82

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK------LNTFLGCKLI 153
               N  +   E    A+         + +    + D VIL ++       NT  G K++
Sbjct: 83  TSVGN--LAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVILTDRAKVESEGNTTEGEKIV 140

Query: 154 VNIDTSFAS 162
            N  T  A+
Sbjct: 141 YNTQTQVAT 149


>gi|49081664|gb|AAT50232.1| PA4460 [synthetic construct]
          Length = 176

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 68/186 (36%), Gaps = 24/186 (12%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+N++ L   L A +   +   L                + I ++AD  E+ D    A +
Sbjct: 3   FVNTLPLIFGLTAALGSSMALALPS-----------DREQPIRVQADSAELDDKQGVAVY 51

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNR-DVSNKINRMDVERNIFIQSGEIN-VIASNGYV 121
           +G+V +TQ    L  + +T+  +     +V   + +            ++          
Sbjct: 52  RGDVVVTQGSTKLTGNTVTLKQDKNGDIEVVTSVGKPAYYEQKPAPDKDVTKAYGLTIQY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN-----IDTSFASLQ--GCESDQVQSI 174
              +  +VL      KVI  ++ NTF G K++ +     ++   A+         ++  +
Sbjct: 112 FVTQNRVVLI--DQAKVI--QEGNTFEGEKIVYDTQRQIVNAGRATGSQVTSPRPRIDMV 167

Query: 175 IRYDGR 180
           I+   +
Sbjct: 168 IQPKKK 173


>gi|57242608|ref|ZP_00370545.1| OstA family protein [Campylobacter upsaliensis RM3195]
 gi|57016537|gb|EAL53321.1| OstA family protein [Campylobacter upsaliensis RM3195]
          Length = 154

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 56/148 (37%), Gaps = 11/148 (7%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
           +   F VL  +KI +KA      +   K+   GNV +++    L A+++ I  +   + +
Sbjct: 9   FFLSFNVLFADKIEVKALNFYADENTGKSVLSGNVVVSRGKDVLNAEELVIFMDKNRKPL 68

Query: 93  SNKINRMDVERN----IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                R +  +N    I +              +  K    +NG+     I  +K     
Sbjct: 69  -----RYEASKNPKFSIMLNDKTYKGSGDKFIYNVAKDTYEINGNAFIHEINTDKK--LY 121

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIR 176
           G K+IV+   +   +Q  ++   + +  
Sbjct: 122 GDKIIVDRKANIYQVQSRQNKPARFVFE 149


>gi|313497323|gb|ADR58689.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 165

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 58/152 (38%), Gaps = 18/152 (11%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             ++ I I+AD   + D    A + G+V +TQ    ++ + +TI      R  S  I+ +
Sbjct: 19  DRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTIT-----RSASGDIDVV 73

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK------LNTFLGCKLI 153
               N  +   E    A+         + +    + D VIL ++       NT  G K++
Sbjct: 74  TSVGN--LAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVILTDRAKVESEGNTTEGEKIV 131

Query: 154 VNIDTSFASLQ-----GCESDQVQSIIRYDGR 180
            N  T  A+            ++  +I+   +
Sbjct: 132 YNTQTQVATAGRGGNVTTPRQRIDMVIQPKKK 163


>gi|325916423|ref|ZP_08178695.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325537343|gb|EGD09067.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 181

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 54/140 (38%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLTG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        +N  A N        I++L+G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQQMDDGAMMNGQADNIEYKVADEIIILSGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 139 TGNMQ-SGGDGSRVRTIIQP 157


>gi|262403928|ref|ZP_06080485.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC586]
 gi|262349890|gb|EEY99026.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC586]
          Length = 780

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 131


>gi|229512624|ref|ZP_04402093.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TMA 21]
 gi|229350301|gb|EEO15252.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TMA 21]
          Length = 787

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|229525139|ref|ZP_04414544.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae bv. albensis VL426]
 gi|229338720|gb|EEO03737.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae bv. albensis VL426]
          Length = 782

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|229530290|ref|ZP_04419678.1| imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae 12129(1)]
 gi|229332063|gb|EEN97551.1| imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae 12129(1)]
          Length = 787

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|227080657|ref|YP_002809208.1| organic solvent tolerance protein [Vibrio cholerae M66-2]
 gi|227008545|gb|ACP04757.1| organic solvent tolerance protein [Vibrio cholerae M66-2]
          Length = 799

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|153827428|ref|ZP_01980095.1| organic solvent tolerance protein [Vibrio cholerae MZO-2]
 gi|149738671|gb|EDM53014.1| organic solvent tolerance protein [Vibrio cholerae MZO-2]
          Length = 622

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 46  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 95

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 96  AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 125


>gi|153803548|ref|ZP_01958134.1| organic solvent tolerance protein [Vibrio cholerae MZO-3]
 gi|124120915|gb|EAY39658.1| organic solvent tolerance protein [Vibrio cholerae MZO-3]
          Length = 766

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 131


>gi|255743829|ref|ZP_05417786.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholera CIRS 101]
 gi|262147182|ref|ZP_06027988.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae INDRE 91/1]
 gi|262167590|ref|ZP_06035294.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC27]
 gi|67477419|sp|Q9KUR9|LPTD_VIBCH RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|255738578|gb|EET93966.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholera CIRS 101]
 gi|262023926|gb|EEY42623.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC27]
 gi|262031387|gb|EEY49995.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae INDRE 91/1]
          Length = 783

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 131


>gi|254227130|ref|ZP_04920675.1| organic solvent tolerance protein [Vibrio cholerae V51]
 gi|125620344|gb|EAZ48733.1| organic solvent tolerance protein [Vibrio cholerae V51]
          Length = 707

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|15640473|ref|NP_230100.1| organic solvent tolerance protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121729960|ref|ZP_01682380.1| organic solvent tolerance protein [Vibrio cholerae V52]
 gi|147675099|ref|YP_001218714.1| organic solvent tolerance protein [Vibrio cholerae O395]
 gi|153820174|ref|ZP_01972841.1| organic solvent tolerance protein [Vibrio cholerae NCTC 8457]
 gi|229507085|ref|ZP_04396591.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae BX 330286]
 gi|229508760|ref|ZP_04398252.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae B33]
 gi|229519747|ref|ZP_04409190.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC9]
 gi|229606259|ref|YP_002876907.1| organic solvent tolerance protein [Vibrio cholerae MJ-1236]
 gi|254850677|ref|ZP_05240027.1| organic solvent tolerance protein [Vibrio cholerae MO10]
 gi|297580586|ref|ZP_06942512.1| organic solvent tolerance protein [Vibrio cholerae RC385]
 gi|298501022|ref|ZP_07010823.1| organic solvent tolerance protein [Vibrio cholerae MAK 757]
 gi|9654870|gb|AAF93619.1| organic solvent tolerance protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121628300|gb|EAX60810.1| organic solvent tolerance protein [Vibrio cholerae V52]
 gi|126509284|gb|EAZ71878.1| organic solvent tolerance protein [Vibrio cholerae NCTC 8457]
 gi|146316982|gb|ABQ21521.1| organic solvent tolerance protein [Vibrio cholerae O395]
 gi|227012300|gb|ACP08510.1| organic solvent tolerance protein [Vibrio cholerae O395]
 gi|229344436|gb|EEO09411.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC9]
 gi|229354163|gb|EEO19094.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae B33]
 gi|229355830|gb|EEO20750.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae BX 330286]
 gi|229368914|gb|ACQ59337.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae MJ-1236]
 gi|254846382|gb|EET24796.1| organic solvent tolerance protein [Vibrio cholerae MO10]
 gi|297535002|gb|EFH73837.1| organic solvent tolerance protein [Vibrio cholerae RC385]
 gi|297540270|gb|EFH76330.1| organic solvent tolerance protein [Vibrio cholerae MAK 757]
          Length = 787

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|254787687|ref|YP_003075116.1| lipopolysaccharide transport periplasmic protein LptA
           [Teredinibacter turnerae T7901]
 gi|237686059|gb|ACR13323.1| lipopolysaccharide transport periplasmic protein LptA
           [Teredinibacter turnerae T7901]
          Length = 194

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 52/157 (33%), Gaps = 14/157 (8%)

Query: 30  AASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           A + M    +  +  + + I AD  E+ D      + G+V + Q    ++A+K+ I    
Sbjct: 23  ACTAMPADALPDDRLQDLSISADSAELDDLNGTTTYAGSVIVEQGSMKIRAEKVVIYGRK 82

Query: 88  TNRDVSNKINRMDVERNIF-IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                            +       +   A+          L+L     D    +++  +
Sbjct: 83  DTYSRVVATGTPARLSQVPKPGQEPVTARANRMEYQITSETLIL----LDNAAFRQEGTS 138

Query: 147 FLGCKLIVNID------TSFASLQGCESDQVQSIIRY 177
             G ++  ++          A  +G +  +V+ +I  
Sbjct: 139 LSGNRIEYDVKKAVVRAGGKADAEG-DDRRVRMVIPP 174


>gi|78048672|ref|YP_364847.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037102|emb|CAJ24847.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 186

 Score = 57.7 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 26  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 85

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 86  KQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 141

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 142 TGNMQ-SGGDGSRVRTIIQP 160


>gi|157373867|ref|YP_001472467.1| OstA family protein [Shewanella sediminis HAW-EB3]
 gi|157316241|gb|ABV35339.1| OstA family protein [Shewanella sediminis HAW-EB3]
          Length = 217

 Score = 57.7 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 52/148 (35%), Gaps = 7/148 (4%)

Query: 34  MTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
            +    L +  +++ I A   E      +  F G V +TQ    + AD++          
Sbjct: 17  FSGMAKLDDLKQEVKISAASQEADIKNNQIIFNGPVEVTQGSVKILADELRAFSKEEGGG 76

Query: 92  VSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
                       +  ++ G   +  A     +   R L L G+      L++  +   G 
Sbjct: 77  KILVATGSPATYSQIMEDGRPASASAKEIRYELSSRTLTLIGNAT----LEQAGSQVTGH 132

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           ++  NI       +   +D+V +II+ +
Sbjct: 133 QIRYNIAKQQLIAESTGNDRVITIIQPE 160


>gi|58580909|ref|YP_199925.1| hypothetical protein XOO1286 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622842|ref|YP_450214.1| hypothetical protein XOO_1185 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58425503|gb|AAW74540.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366782|dbj|BAE67940.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 182

 Score = 57.7 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 26  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 85

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 86  KQATLKQEMDDGAMMHGQADNIEYKVADDIIILTGNY--KVDSPKGTN--AGQRMVYNTK 141

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 142 TGNMQ-SGGDGSRVRTIIQP 160


>gi|251773404|gb|EES53953.1| putative OstA family protein [Leptospirillum ferrodiazotrophum]
          Length = 218

 Score = 57.7 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 21/155 (13%), Positives = 54/155 (34%), Gaps = 15/155 (9%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L A      A+     K  G   + +++D +  ++   +  F G+V + +    L +D +
Sbjct: 34  LAAADPVGTAAPAPPKKEKGPTSMVVRSDHMLARNIENEITFSGHVHLVKGTLRLTSDDL 93

Query: 82  TIDYNNTNRD-----------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
            +      +             S ++  M    ++ I++      A          + VL
Sbjct: 94  VVYLRKAGKGKTLMEETGQGSSSQRVETMVATGHVIIRTPRRTAYAGRAVYVESAHLFVL 153

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
                + V++ +  +   G ++      + + +QG
Sbjct: 154 T---EEPVVI-QNGDRMSGSRITFFTRMNKSVVQG 184


>gi|157825778|ref|YP_001493498.1| hypothetical protein A1C_03545 [Rickettsia akari str. Hartford]
 gi|157799736|gb|ABV74990.1| hypothetical protein A1C_03545 [Rickettsia akari str. Hartford]
          Length = 125

 Score = 57.7 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   ++  +  I+ + V   
Sbjct: 13  LHITSDTLIIDRTKQKAEYLGNVVVYFDNAILRTKELYIFYKTIDKKQT--IDHIVVPTK 70

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 71  LTVERKINNELLLADSVKYFFDDKQLILLGN----VILQRDDNVLKTNKLIYYVD 121


>gi|289667912|ref|ZP_06488987.1| hypothetical protein XcampmN_05253 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 183

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 139 TGNMQ-SGGDGSRVRTIIQP 157


>gi|289664523|ref|ZP_06486104.1| putative secreted protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 183

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 139 TGNMQ-SGGDGSRVRTIIQP 157


>gi|229588428|ref|YP_002870547.1| hypothetical protein PFLU0884 [Pseudomonas fluorescens SBW25]
 gi|229360294|emb|CAY47151.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 177

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 58/168 (34%), Gaps = 17/168 (10%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L+  + +LL    +  + S          + IHI AD  ++ D    A + G V +TQ  
Sbjct: 3   LVKTLPILLGLGAALGSVSAW-ALPNDSQQPIHISADDAQLDDKQGVATYTGGVIITQGS 61

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI--------ASNGYVDFQK 125
             +  + +T+      R  +  I+ +    N+     + +                  Q+
Sbjct: 62  MKITGNTVTLT-----RTPAGDIDVVTSVGNLAYFEQKQSAADTGPMKGYGKTIQYHAQQ 116

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
             +VL        +L    N+  G K+  +     A+      ++V +
Sbjct: 117 NRIVL---IDQAKVLSPDGNSTEGEKITYDTVKQIANAGRANGNKVTA 161


>gi|91205591|ref|YP_537946.1| hypothetical protein RBE_0776 [Rickettsia bellii RML369-C]
 gi|91069135|gb|ABE04857.1| unknown [Rickettsia bellii RML369-C]
          Length = 151

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 64/153 (41%), Gaps = 12/153 (7%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++++ L    + LV     +  + A    ++          HI +D L +    QKA + 
Sbjct: 1   MSTLLLIYRTIKLVIFFTISISTYADDKDISNL--------HITSDTLIINRVKQKAEYL 52

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +  ++  L+ +++ I Y   +   +     +  + ++  +     ++A +G     
Sbjct: 53  GNVVVYFDNAILRTEELYIFYKTIDNKQTIDYIVVPTKLSVEKKINNELLLADSGKYFLD 112

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
            + L+L G+    V+L+   N     KLI  +D
Sbjct: 113 NKQLILLGN----VVLERNNNILKTNKLIYYVD 141


>gi|58040275|ref|YP_192239.1| hypothetical protein GOX1844 [Gluconobacter oxydans 621H]
 gi|58002689|gb|AAW61583.1| Hypothetical protein GOX1844 [Gluconobacter oxydans 621H]
          Length = 266

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 38/95 (40%), Gaps = 4/95 (4%)

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           +N     ++K++R     ++ +++         G   F  +I  L G     V + +  N
Sbjct: 169 SNPMGGGASKLDRAYGWGHVVLRTQTQTGTGDRGVYVFDTQIARLIGH----VHVTQGQN 224

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              G + IVN+ T  A++       +Q ++  +  
Sbjct: 225 QNNGSQAIVNMKTGIATMLPGTDSPIQGLVVPNEA 259



 Score = 41.9 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 39/141 (27%), Gaps = 32/141 (22%)

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNN----------------------TNRDVSNKINRM 99
              G     + D ++ AD +                                 S ++ R+
Sbjct: 2   TLTGGARAVRGDVTVDADTLIGYLRKKTPPPGQPAPPPPPATAKDNSGDPMGGSLELYRI 61

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG-CKLIVNIDT 158
           +   N+ I +        +   D  + ++V+ G       L    +       +  +  T
Sbjct: 62  EARGNVHIYNQTDQGWGDHALYDMDQAVMVMTGKHLK---LTTPQDVLTARDVMEYHSKT 118

Query: 159 ------SFASLQGCESDQVQS 173
                   A++   +  QV++
Sbjct: 119 RMSVGRGDATVTTNDGKQVKA 139


>gi|15612541|ref|NP_224194.1| hypothetical protein jhp1476 [Helicobacter pylori J99]
 gi|4156096|gb|AAD07048.1| putative [Helicobacter pylori J99]
          Length = 185

 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 48/137 (35%), Gaps = 14/137 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I  +     D  + A  +GNV + +    L ADK+++  N+  +       R +   N
Sbjct: 34  LEITGNQFVANDKTKTAVIQGNVQIKKGKDRLFADKVSVFLNDKRKP-----ERYEATGN 88

Query: 105 IFIQ-----SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDT 158
                    + EI+        +       L     + V+ +    N   G ++I+N   
Sbjct: 89  THFNIFTEDNREISGSTDKLIYNALNGEYKL---LQNAVVREVGKSNVITGDEIILNKTK 145

Query: 159 SFASLQGCESDQVQSII 175
            +A + G      + + 
Sbjct: 146 GYADVLGSAKRPAKFVF 162


>gi|296137176|ref|YP_003644418.1| lipopolysaccharide transport periplasmic protein LptA [Thiomonas
           intermedia K12]
 gi|295797298|gb|ADG32088.1| lipopolysaccharide transport periplasmic protein LptA [Thiomonas
           intermedia K12]
          Length = 211

 Score = 57.3 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 53/153 (34%), Gaps = 13/153 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI- 96
           ++  N+ IHI+AD +   D  Q + F GNV +T+    L+A  + +         +  I 
Sbjct: 28  QIDRNQPIHIEADAMRYDDVHQTSVFTGNVVVTKGSLVLRAATVDVRQAPDGYQYATAIA 87

Query: 97  --NRMDVERNIFIQSGEINV-----IASNGYVDFQKRILVLNGDRADKVILKEKL--NTF 147
              ++   +     +           A     D +  ++ L G       L +    +  
Sbjct: 88  APGQLATFQQQLDGAPGQPAQTMDGAAQRIEYDGKTDVVTLRGQAMLS-RLIDGKLADRS 146

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            G  +  N  T   +++G       +     GR
Sbjct: 147 QGNVIAYNQITDVFTVEGGAQG--ATATNPGGR 177


>gi|188578112|ref|YP_001915041.1| hypothetical protein PXO_02229 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188522564|gb|ACD60509.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 179

 Score = 57.3 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQEMDDGAMMHGQADNIEYKVADDIIILTGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 139 TGNMQ-SGGDGSRVRTIIQP 157


>gi|261250210|ref|ZP_05942786.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio orientalis CIP 102891]
 gi|260939326|gb|EEX95312.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio orientalis CIP 102891]
          Length = 795

 Score = 57.3 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            ++++AD LE  +  + A ++GNV + Q    + AD +T+           + N +  E 
Sbjct: 64  PVNVEADSLEAINGDK-ATYRGNVVVVQGKKRMLADNVTLH---------QQENVVVAEG 113

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVL 130
           N+    GE+  I+     +     + L
Sbjct: 114 NVTFSDGEVKTISDKATNNLNTDFVTL 140


>gi|51597816|ref|YP_072007.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809714|ref|YP_653630.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Antiqua]
 gi|108813622|ref|YP_649389.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Nepal516]
 gi|145597633|ref|YP_001161709.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Pestoides F]
 gi|153950762|ref|YP_001399436.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis IP 31758]
 gi|153997355|ref|ZP_02022455.1| hypothetical protein YPE_3802 [Yersinia pestis CA88-4125]
 gi|162419439|ref|YP_001605696.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Angola]
 gi|165937461|ref|ZP_02226024.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011343|ref|ZP_02232241.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211892|ref|ZP_02237927.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167400620|ref|ZP_02306129.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167426750|ref|ZP_02318503.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470874|ref|ZP_02335578.1| hypothetical protein YpesF_24092 [Yersinia pestis FV-1]
 gi|186897008|ref|YP_001874120.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930592|ref|YP_002348467.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis CO92]
 gi|229836864|ref|ZP_04457029.1| Protein yhbN precursor [Yersinia pestis Pestoides A]
 gi|229839236|ref|ZP_04459395.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229899801|ref|ZP_04514942.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229904116|ref|ZP_04519227.1| Protein yhbN precursor [Yersinia pestis Nepal516]
 gi|270488551|ref|ZP_06205625.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis KIM D27]
 gi|294505298|ref|YP_003569360.1| hypothetical protein YPZ3_3189 [Yersinia pestis Z176003]
 gi|51591098|emb|CAH22762.1| Conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777270|gb|ABG19789.1| hypothetical protein YPN_3462 [Yersinia pestis Nepal516]
 gi|108781627|gb|ABG15685.1| hypothetical protein YPA_3723 [Yersinia pestis Antiqua]
 gi|115349203|emb|CAL22168.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209329|gb|ABP38736.1| hypothetical protein YPDSF_0317 [Yersinia pestis Pestoides F]
 gi|149288992|gb|EDM39072.1| hypothetical protein YPE_3802 [Yersinia pestis CA88-4125]
 gi|152962257|gb|ABS49718.1| cell envelope biogenesis protein YhbN [Yersinia pseudotuberculosis
           IP 31758]
 gi|162352254|gb|ABX86202.1| cell envelope biogenesis protein YhbN [Yersinia pestis Angola]
 gi|165914566|gb|EDR33180.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165989727|gb|EDR42028.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206638|gb|EDR51118.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167049988|gb|EDR61396.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054277|gb|EDR64098.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186700034|gb|ACC90663.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678234|gb|EEO74339.1| Protein yhbN precursor [Yersinia pestis Nepal516]
 gi|229687293|gb|EEO79368.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229695602|gb|EEO85649.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229705807|gb|EEO91816.1| Protein yhbN precursor [Yersinia pestis Pestoides A]
 gi|262363361|gb|ACY60082.1| hypothetical protein YPD4_3178 [Yersinia pestis D106004]
 gi|262367261|gb|ACY63818.1| hypothetical protein YPD8_3148 [Yersinia pestis D182038]
 gi|270337055|gb|EFA47832.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis KIM D27]
 gi|294355757|gb|ADE66098.1| hypothetical protein YPZ3_3189 [Yersinia pestis Z176003]
 gi|320017122|gb|ADW00694.1| Protein yhbN precursor [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 181

 Score = 57.3 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/146 (13%), Positives = 45/146 (30%), Gaps = 14/146 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               +   +K+D   +        F  NV + Q    ++ADK+ +       D S  I  
Sbjct: 28  GDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVV--TRPGGDQSKMI-- 83

Query: 99  MDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           ++   N             +         +     +VL GD      L++  +   G ++
Sbjct: 84  IEGFGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----LEQLDSNIKGDRI 139

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
              +          +  +V +++   
Sbjct: 140 TYLVKKQQMEAFSDKGKRVTTVLLPS 165


>gi|331005068|ref|ZP_08328472.1| LptA, protein essential for LPS transport across the periplasm
           [gamma proteobacterium IMCC1989]
 gi|330421123|gb|EGG95385.1| LptA, protein essential for LPS transport across the periplasm
           [gamma proteobacterium IMCC1989]
          Length = 178

 Score = 57.3 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 56/180 (31%), Gaps = 29/180 (16%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L + +L      L    S               + I++ AD            ++GNV +
Sbjct: 18  LLMTILISSLFFLSNPAS--------ALPSDKEQPINVSADKARKNGNQGLTIYEGNVVI 69

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI----------FIQSGEINVIASNG 119
           TQ    +  D++ I       D +  +++M  + +             +  ++       
Sbjct: 70  TQGSIRITGDEVAIY------DEAGTVSKMIAKGSKNQPAKFKQRPQPEGTDMIANGETI 123

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             D     L+L     +   L++        K+  ++ ++  +  G    +V  +I    
Sbjct: 124 EYDINSETLLL----LESARLEQDGRITDSNKITYDMKSTVVN-AGDSDGRVIMVIPPSK 178


>gi|325273322|ref|ZP_08139594.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           sp. TJI-51]
 gi|324101555|gb|EGB99129.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           sp. TJI-51]
          Length = 165

 Score = 57.3 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 66/173 (38%), Gaps = 21/173 (12%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            + L A L  A+A  +       ++ I I+AD   + D    A + G+V +TQ    ++ 
Sbjct: 1   MLSLSAALGSASAFALPN---DRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKG 57

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +T+      R  +  I+ +    N  +   E    A+         + +    + D V
Sbjct: 58  NTVTMT-----RAANGDIDVVTSVGN--LAYFEQQQSAAKPDKMKGWAVTIQYQAQKDTV 110

Query: 139 ILKEK------LNTFLGCKLIVNIDTSFASLQ-----GCESDQVQSIIRYDGR 180
           IL ++       NT  G K++ N  +  A+            ++  +I+   +
Sbjct: 111 ILTDRAKVENEGNTTEGEKIVYNTKSQVATAGRGGNVTQPRQRIDMVIQPKKK 163


>gi|270159888|ref|ZP_06188544.1| cell envelope biogenesis protein YhbN [Legionella longbeachae
           D-4968]
 gi|289165358|ref|YP_003455496.1| OstA family protein [Legionella longbeachae NSW150]
 gi|269988227|gb|EEZ94482.1| cell envelope biogenesis protein YhbN [Legionella longbeachae
           D-4968]
 gi|288858531|emb|CBJ12412.1| OstA family protein [Legionella longbeachae NSW150]
          Length = 180

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 64/181 (35%), Gaps = 15/181 (8%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           ++ H Y  L   ++  L    S  A            + +H+ AD  ++     K  + G
Sbjct: 9   SASHQYFKLWFCLWFFLTFACSSYA------LSEDKEKVMHVMADSADLSQQQHKGIYTG 62

Query: 66  NVFMTQEDFSLQADK-MTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN----VIASNGY 120
           NV + Q   +L+A K +T+        V+        + + +  +          A    
Sbjct: 63  NVELIQGTTNLRATKAITLGNEKNQLVVAIASGAPGQQAHYWTTTDPKKPPLHAYADTIR 122

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
               + ++ L G+   +    +  N+F   K+  + +      QG  S ++  I   + +
Sbjct: 123 YYPLRHLIELIGNARVE----QGNNSFSATKISYDTEKQHVLSQGDGSKRIMIIYHPEKK 178

Query: 181 P 181
           P
Sbjct: 179 P 179


>gi|121998903|ref|YP_001003690.1| OstA family protein [Halorhodospira halophila SL1]
 gi|121590308|gb|ABM62888.1| OstA family protein [Halorhodospira halophila SL1]
          Length = 175

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/146 (9%), Positives = 49/146 (33%), Gaps = 5/146 (3%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
            +   +  + ++AD ++V      + ++G+  +T+ +  +  D+M +  +         +
Sbjct: 30  MEQREDAPVELEADSVDVDAVAGVSVYEGDAVLTRGEMRITGDRMEVYTDEDGDLSHVYV 89

Query: 97  NRMDVERNIFIQSGEI--NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
           +          ++     +  A       +               L +  +      + V
Sbjct: 90  DGTPATYRDHPENQPRPVHAEAKRMEYYTRGPE---RAHFQGDARLWQGDDQVTAETIDV 146

Query: 155 NIDTSFASLQGCESDQVQSIIRYDGR 180
           +++      +G E  + ++I+    R
Sbjct: 147 DLEGQIMKARGAEGQRARTILYPTRR 172


>gi|323144373|ref|ZP_08078981.1| lipopolysaccharide transport periplasmic protein LptA
           [Succinatimonas hippei YIT 12066]
 gi|322415826|gb|EFY06552.1| lipopolysaccharide transport periplasmic protein LptA
           [Succinatimonas hippei YIT 12066]
          Length = 173

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 51/147 (34%), Gaps = 8/147 (5%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR-DVSN 94
             +   ++ +++ +          K  F GNV  TQ    + ADK+ I  ++  +  +  
Sbjct: 24  ALESDYSKPVNVLSVEQFADLKANKVIFSGNVVATQGTMKITADKVEITRDDEGKLKMVT 83

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      I+  ++    +  K ++VL G    K  + +  +  +G ++  
Sbjct: 84  AYGSPTTFEQMMENGKPIHSRSATINYEPNKNLIVLTG----KATVWQGESRMVGERIEY 139

Query: 155 NIDTSFASLQG---CESDQVQSIIRYD 178
           N+ T           +  +V S     
Sbjct: 140 NVKTQTMRANNKTKSQGGRVSSTFIPS 166


>gi|213865401|ref|ZP_03387520.1| hypothetical protein SentesT_36938 [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 112

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 35/83 (42%), Gaps = 3/83 (3%)

Query: 15 LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
          L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 8  LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 65

Query: 75 SLQADKMTIDYNNTNRDVSNKIN 97
           + ADK+ +            I+
Sbjct: 66 KINADKVVVT-RPGGEQGKEVID 87


>gi|254497761|ref|ZP_05110534.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254353054|gb|EET11816.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 155

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 51/156 (32%), Gaps = 19/156 (12%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + +H+ AD  ++     K  + GNV + Q   +L+A K       T  D  N+
Sbjct: 8   ALPTDKEQVMHVMADSADLSQQDHKGTYVGNVELIQGTTNLRAAKAI-----TQGDDKNQ 62

Query: 96  INRMDVERN----------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           +       N             +    +  A        + ++ L G+   +    +  N
Sbjct: 63  LVLAIANGNKEKQAHYWAITDPKKPPFHAYADTIRYYPLRHLIELIGNARVE----QGDN 118

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           +F   K+  +        QG    ++  I   + +P
Sbjct: 119 SFSAAKITYDTIKQHVLSQGDRKQRITIIYHPEKKP 154


>gi|330993927|ref|ZP_08317857.1| LPS-assembly protein lptD [Gluconacetobacter sp. SXCC-1]
 gi|329758873|gb|EGG75387.1| LPS-assembly protein lptD [Gluconacetobacter sp. SXCC-1]
          Length = 800

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 53/153 (34%), Gaps = 7/153 (4%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           +  + ++ H          + ++A  SQ  A       V   + +  +AD +        
Sbjct: 41  LGGWTSTAHADAEGAPRRRMPIQAPKSQPQAPASFSGTVSNTDPMTFQADHVAYDSRNGI 100

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           A + GNV + Q D  ++ADK+  D N         +  ++ +  +           SNG 
Sbjct: 101 ATWTGNVQVWQNDQIMRADKIVYDRNTGIASARGNVAMVEPDGTVLF---TDYAELSNG- 156

Query: 121 VDFQKRILV-LNGDRADKVILKEKLNTFLGCKL 152
              +  I+  L    AD   +        G K+
Sbjct: 157 --MRDGIMTRLYAQMADNARMAANGMRRTGSKI 187



 Score = 42.3 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 56/185 (30%), Gaps = 25/185 (13%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +A L  +   + L A +   +   L    ++     +     ++ I+A           A
Sbjct: 17  TAVLRRLPRGMLLGATMLAGMIGGLGGWTSTAHADAEGAPRRRMPIQAPK---SQPQAPA 73

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            F G V  T    + QAD   + Y++ N   +          N+ +   +  + A     
Sbjct: 74  SFSGTVSNTD-PMTFQADH--VAYDSRNGIATW-------TGNVQVWQNDQIMRADKIVY 123

Query: 122 DFQKRILVLNGDRA-----DKVILKEKLNTFLG------CKLIVNIDTSFASLQGCESDQ 170
           D    I    G+ A       V+  +      G       +L   +    A +      +
Sbjct: 124 DRNTGIASARGNVAMVEPDGTVLFTDYAELSNGMRDGIMTRLYAQMAD-NARMAANGMRR 182

Query: 171 VQSII 175
             S I
Sbjct: 183 TGSKI 187


>gi|166711213|ref|ZP_02242420.1| putative secreted protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 183

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 53/140 (37%), Gaps = 7/140 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQEMDDGAMMHGQADNIEYKVADDIIILTGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSIIRY 177
           T      G +  +V++II+ 
Sbjct: 139 TGNMQ-SGGDGSRVRTIIQP 157


>gi|308051146|ref|YP_003914712.1| lipopolysaccharide transport periplasmic protein LptA [Ferrimonas
           balearica DSM 9799]
 gi|307633336|gb|ADN77638.1| lipopolysaccharide transport periplasmic protein LptA [Ferrimonas
           balearica DSM 9799]
          Length = 183

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 49/136 (36%), Gaps = 5/136 (3%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + I + +D            + GNV + Q    ++AD++ +  +    +           
Sbjct: 29  QPIKVTSDNSSADIQSYTLIYSGNVRIVQGSMEIKADELKVISSAEKGNEVMIATGKPAT 88

Query: 103 RNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
               +++G      A     + + R L L+GD      L +  +   G  +  N++    
Sbjct: 89  YTQMMENGLPAEAQAKEIRYEVRTRQLTLSGDAQ----LSQAGSLMRGNTISYNVEKQQL 144

Query: 162 SLQGCESDQVQSIIRY 177
             +G E +Q+ +I   
Sbjct: 145 IAEGKEDEQITTIFLP 160


>gi|188532474|ref|YP_001906271.1| lipopolysaccharide transport periplasmic protein LptA [Erwinia
           tasmaniensis Et1/99]
 gi|188027516|emb|CAO95363.1| Putative ABC superfamily (Bind_prot) transport protein [Erwinia
           tasmaniensis Et1/99]
          Length = 182

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 58/164 (35%), Gaps = 14/164 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL A L  A +  +       ++ +++ ++   +      A F G V +TQ    + ADK
Sbjct: 11  LLTASLLLAISVPVLALTDDSSKPVNVDSENQALDMQGNVATFTGKVVVTQGSIKITADK 70

Query: 81  MTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +    T     +K   +D   N      +      +   A   + +  K ++ L G  
Sbjct: 71  VVV----TRPGGDSKKTIVDAYGNPATFYQMQDNGKPVQGHAQKMHYELAKDLVELTGGA 126

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L++  +   G ++   +        G    +V +++   
Sbjct: 127 Y----LEQLDSNVKGDRITYLVKEQKMQAFGNTGKRVTTVLVPS 166


>gi|227112735|ref|ZP_03826391.1| hypothetical protein PcarbP_07224 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 149

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 49/141 (34%), Gaps = 15/141 (10%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L+ + L   + S         N+ IHI +    +        F GNV + Q    ++AD
Sbjct: 12  TLIASSLFAVSVSAF-AVTGDSNQPIHIDSAQQSLDMQGNTVTFTGNVVVKQGTIEVKAD 70

Query: 80  KMTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           K+ +      +         N +    ++ N     G     A     +  K  LVL GD
Sbjct: 71  KVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGH----AQKIRYELAKDFLVLTGD 126

Query: 134 RADKVILKEKLNTFLGCKLIV 154
                 L+++ +   G ++  
Sbjct: 127 AY----LEQQDSNVKGDRITY 143


>gi|56476150|ref|YP_157739.1| OstA-like family protein [Aromatoleum aromaticum EbN1]
 gi|56312193|emb|CAI06838.1| OstA-like family protein [Aromatoleum aromaticum EbN1]
          Length = 190

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 56/152 (36%), Gaps = 14/152 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID--YNNTNRDVSNKI 96
               + ++I+A+ L V D  +   F+GNV +TQ    ++ D++ +    +     V+   
Sbjct: 28  ADREKPVNIEANRLTVDDRNKVHVFEGNVVLTQGSLVIKGDRLVVTQGPDGFQTGVATGS 87

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG------- 149
           ++         +     V      +++  R         ++  ++   +   G       
Sbjct: 88  DKRPATFRQKREGSNEFVEGEAERIEYDSRAE--RARLFNQARVESGGDEVRGHYIEYDA 145

Query: 150 --CKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
              K  V      ++    +S +V+++I+  G
Sbjct: 146 LSEKYFVTNQPGTSAATAGDS-RVRAVIQPKG 176


>gi|328471911|gb|EGF42788.1| LPS assembly outer membrane complex protein LptD [Vibrio
           parahaemolyticus 10329]
          Length = 781

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADNLQAINGDK-AQYSGNVQVTQGPKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTEYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPEG 171


>gi|153838971|ref|ZP_01991638.1| organic solvent tolerance protein [Vibrio parahaemolyticus AQ3810]
 gi|260903393|ref|ZP_05911788.1| organic solvent tolerance protein [Vibrio parahaemolyticus AQ4037]
 gi|149747559|gb|EDM58491.1| organic solvent tolerance protein [Vibrio parahaemolyticus AQ3810]
 gi|308109033|gb|EFO46573.1| organic solvent tolerance protein [Vibrio parahaemolyticus AQ4037]
          Length = 781

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADNLQAINGDK-AQYSGNVQVTQGPKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTEYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPEG 171


>gi|28897113|ref|NP_796718.1| organic solvent tolerance protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260361687|ref|ZP_05774714.1| organic solvent tolerance protein [Vibrio parahaemolyticus K5030]
 gi|260896921|ref|ZP_05905417.1| LPS-assembly protein (Organic solvent tolerance protein) [Vibrio
           parahaemolyticus Peru-466]
 gi|32129811|sp|Q87ST3|LPTD_VIBPA RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|28805322|dbj|BAC58602.1| organic solvent tolerance protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088750|gb|EFO38445.1| LPS-assembly protein (Organic solvent tolerance protein) [Vibrio
           parahaemolyticus Peru-466]
 gi|308115497|gb|EFO53037.1| organic solvent tolerance protein [Vibrio parahaemolyticus K5030]
          Length = 781

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADNLQAINGDK-AQYSGNVQVTQGPKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTEYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPEG 171


>gi|229519984|ref|ZP_04409413.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TM 11079-80]
 gi|229342933|gb|EEO07922.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TM 11079-80]
          Length = 787

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 37/90 (41%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 56  SQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 106 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 135


>gi|294084265|ref|YP_003551023.1| organic solvent tolerance protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663838|gb|ADE38939.1| Organic solvent tolerance protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 739

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 9/82 (10%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A S M+   +  +  I  +AD ++V       +  GNV + Q   +L+AD+  + YN  N
Sbjct: 14  ATSLMSATAMADDNPIAFEADKVQVNQEDGSMYATGNVVLKQAGKTLRADE--VTYNKPN 71

Query: 90  RDVSNKINRMDVERNIFIQSGE 111
                  +R     N+ +   +
Sbjct: 72  -------DRAIARGNVVMTLPD 86


>gi|153824294|ref|ZP_01976961.1| organic solvent tolerance protein [Vibrio cholerae B33]
 gi|126518183|gb|EAZ75408.1| organic solvent tolerance protein [Vibrio cholerae B33]
          Length = 281

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE  +  + A + GNV + Q    + AD +T+           + N + 
Sbjct: 52  GQQPINVEADKLEAINGQK-ATYSGNVVVVQGKKRIAADNVTLH---------QQENVVV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            E N+    GEI   ++          + L
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTL 131


>gi|254283657|ref|ZP_04958625.1| lipopolysaccharide transport periplasmic protein LptA, putative
           [gamma proteobacterium NOR51-B]
 gi|219679860|gb|EED36209.1| lipopolysaccharide transport periplasmic protein LptA, putative
           [gamma proteobacterium NOR51-B]
          Length = 216

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 60/160 (37%), Gaps = 24/160 (15%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
            +  LL   +    A  +   K    + I I AD  E  +  Q+  + G+V + Q    +
Sbjct: 15  FIPALLTLLVLGTVAPPIAALKDDREQPIKISADSAERDERSQRTQYIGSVELVQGSLHI 74

Query: 77  QADKMTIDYNNTNRDVSNKIN--------------RMDVERNI--FIQSGEINVIASNGY 120
           +AD++T+ ++  N D    +                ++ E     +I+S ++  +     
Sbjct: 75  KADRLTVFHDKANADRIIAVGDPATLTQLPAVGDPPIEAEAGKIEYIRSEDLIKLTQTAR 134

Query: 121 VDFQKRILVLNGDRAD------KVILKEKLNTFLGCKLIV 154
              ++   V+ GD  D      +V+ +       G ++ V
Sbjct: 135 --IEQDGAVVTGDSIDYLITEQRVLARAGERIEGGQRVEV 172


>gi|257092275|ref|YP_003165916.1| lipopolysaccharide transport periplasmic protein LptA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257044799|gb|ACV33987.1| lipopolysaccharide transport periplasmic protein LptA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 207

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 57/161 (35%), Gaps = 21/161 (13%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI------DYNNT 88
              +   ++ IH++AD + + D  +    +GNV M Q    L+ +++ +           
Sbjct: 22  QAERADRDKPIHLEADRMSIDDIKKVKTLEGNVVMIQGTLELRTNRLVVTDDADGFQKGV 81

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               +N + R   +R       +  +      ++   R  V        V  +   +   
Sbjct: 82  ATGGANGLARFRQKREGV----DEWMEGEAERIEHDARSEVTQFFIRAWV--QSGADEVR 135

Query: 149 GCKLIVN-------IDTSFA--SLQGCESDQVQSIIRYDGR 180
           G  +  +       +++  A  +  G    +V++II+   +
Sbjct: 136 GPYISYDALNEKYAVNSGGATKTATGAAQARVRAIIQPKSK 176


>gi|67459110|ref|YP_246734.1| hypothetical protein RF_0718 [Rickettsia felis URRWXCal2]
 gi|67004643|gb|AAY61569.1| Uncharacterized protein [Rickettsia felis URRWXCal2]
          Length = 145

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 50/113 (44%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 33  LHITSDTLIIDRIKQKAEYLGNVVVYFDNAILRTKELYIFYKTIDDKQTIDYIVIPTKLT 92

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 93  VERKINNELLLADSAKYFFDDKQLILLGN----VILQRDDNVLKTNKLIYYVD 141


>gi|296116658|ref|ZP_06835268.1| organic solvent tolerance protein [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976870|gb|EFG83638.1| organic solvent tolerance protein [Gluconacetobacter hansenii ATCC
           23769]
          Length = 832

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 41/108 (37%), Gaps = 1/108 (0%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +A +   H++    A          ++   +  +     G+  +  +AD +        A
Sbjct: 75  AASMRGRHVHSQAAASQPDAANPAPAKPHGAASSSTVSTGD-PVTFQADHVAYDSKNGLA 133

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS 109
            + GNV + Q D  ++ADK+  D N      S  +  ++ +  +   S
Sbjct: 134 IWSGNVQIWQNDQVMRADKVVYDRNTGVASASGNVALVEPDGTVMFTS 181


>gi|257465443|ref|ZP_05629814.1| organic solvent tolerance protein [Actinobacillus minor 202]
 gi|257451103|gb|EEV25146.1| organic solvent tolerance protein [Actinobacillus minor 202]
          Length = 780

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 51/140 (36%), Gaps = 12/140 (8%)

Query: 31  ASYMTRFKVLGNE---KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
             +    +V G +    I+I+AD   +      A + G+V + Q + ++ AD++ ++ + 
Sbjct: 33  VPHFQGEEVKGEQTDLPIYIEADSAVINQPKD-ATYTGDVSVKQGNRTIVADEVRVEQDG 91

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                     +  ++     Q   I     +  +D   +   L  +   +++ ++   T 
Sbjct: 92  DKA------RKAFLKGQYQYQDNMIQAQGHDAAMDLTSKEATL-ANMEYQLVGRQGRGTA 144

Query: 148 LGCKLIVNIDTSF-ASLQGC 166
                  +  T   AS   C
Sbjct: 145 ESGSFSEDTRTLKNASFTSC 164


>gi|190573140|ref|YP_001970985.1| putative OstA family protein [Stenotrophomonas maltophilia K279a]
 gi|190011062|emb|CAQ44671.1| putative OstA family protein [Stenotrophomonas maltophilia K279a]
          Length = 183

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 60/168 (35%), Gaps = 15/168 (8%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLE-VKDAVQKAFFKGNVFM 69
           +  +LAL  ++  A  +++            NE +HI +     +     K      V +
Sbjct: 5   FAAVLALGLLVPSAAFAKST---------DRNEDMHIDSGAQSGMLTGDGKTVLSQGVII 55

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
           TQ    L++ +  I   +          +    +        ++ +A     D +  I+ 
Sbjct: 56  TQGTLDLRSSEAEIYLKDGEAVRVVFTGKQAKMKQQLDDGTWMDALADRIDYDIKTEIIT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           L G+   KV      N   G +++ N  T   +  G +  +V+++I  
Sbjct: 116 LTGNY--KVTSARGTN--AGQRMVYNTRTGEMN-SGGDGSRVRTVIPP 158


>gi|304310279|ref|YP_003809877.1| OstA-like protein [gamma proteobacterium HdN1]
 gi|301796012|emb|CBL44216.1| OstA-like protein [gamma proteobacterium HdN1]
          Length = 205

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 60/158 (37%), Gaps = 24/158 (15%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +    + I I AD  E+ +    A + G V +TQ    + AD + I  +N       +
Sbjct: 39  ALESDRQQPIEIIADQAELDEGQGVAHYTGKVVLTQGSLIINADDLYIRADNNK-----Q 93

Query: 96  INRMDVERN--IFIQSGE-----INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
           + ++  + +  +F Q+ E     +   A           L+L  D     I+ +  +TF 
Sbjct: 94  VQQVTAKGSPAVFTQTPEPDQPPVTAKAKTIDYYVSDEKLILQLD----AIVVQNESTFQ 149

Query: 149 GCKLIVNIDTSFASLQGCES--------DQVQSIIRYD 178
           G ++  +I T      G ++         +V+ ++   
Sbjct: 150 GTRIQYDIRTRRMQATGGDAKNAVKGGNQRVKMVLPPS 187


>gi|170022758|ref|YP_001719263.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis YPIII]
 gi|169749292|gb|ACA66810.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis YPIII]
          Length = 181

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/146 (13%), Positives = 45/146 (30%), Gaps = 14/146 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               +   +K+D   +        F  NV + Q    ++ADK+ +       D S  I  
Sbjct: 28  GDTEQPAEVKSDKQTLDMETNTITFIDNVVIKQGTIEIKADKVVV--TRPGGDQSKMI-- 83

Query: 99  MDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           ++   N             +         +     +VL GD      L++  +   G ++
Sbjct: 84  IEGFGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----LEQLDSNIKGDRI 139

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
              +          +  +V +++   
Sbjct: 140 TYLVKKQQMEAFSDKGKRVTTVLLPS 165


>gi|127514237|ref|YP_001095434.1| OstA family protein [Shewanella loihica PV-4]
 gi|126639532|gb|ABO25175.1| OstA family protein [Shewanella loihica PV-4]
          Length = 181

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 52/142 (36%), Gaps = 15/142 (10%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           +++ I A   E      +  F G V +TQ    + A ++      +    S KI  +   
Sbjct: 28  QEVKISAASQEADIKNNQIIFHGPVEVTQGSIKILASELRAF---SKEKNSGKI--LIAT 82

Query: 103 RN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
            N      +       +  A     +   R L L GD      L+++ +   G ++  NI
Sbjct: 83  GNPATYSQVMEDGRPASASAKEIRYELSSRTLTLIGDAT----LEQEGSQVTGSQIRYNI 138

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
           +      +    D+V +II+ +
Sbjct: 139 EQQQLIAESTGKDRVITIIQPE 160


>gi|302877523|ref|YP_003846087.1| lipopolysaccharide transport periplasmic protein LptA
          [Gallionella capsiferriformans ES-2]
 gi|302580312|gb|ADL54323.1| lipopolysaccharide transport periplasmic protein LptA
          [Gallionella capsiferriformans ES-2]
          Length = 178

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 15 LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
          L+ +F+LL   +   A       +   ++ I I AD + V DA Q + F G+V +TQ   
Sbjct: 5  LSFIFMLLAVSVPCQAE------RADRDKPIDIDADQVIVDDAKQISTFTGHVILTQGTM 58

Query: 75 SLQADKMTIDYNNTN 89
            + DK+ +  +   
Sbjct: 59 VFRGDKIVVVQDKAG 73


>gi|260878026|ref|ZP_05890381.1| LPS-assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|308090070|gb|EFO39765.1| LPS-assembly protein [Vibrio parahaemolyticus AN-5034]
          Length = 781

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADNLQAINGDK-AQYSGNVQVTQGQKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTEYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPEG 171


>gi|304396320|ref|ZP_07378201.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           aB]
 gi|304355829|gb|EFM20195.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           aB]
          Length = 183

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 59/168 (35%), Gaps = 15/168 (8%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
              LL A +  A +          ++ ++I +    +      A F GNV +TQ    + 
Sbjct: 9   SLKLLMASMLLATSVPALALTGDSDKPVNIDSQNQALDLQGNVATFTGNVIVTQGSIKIT 68

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLN 131
           ADK+ +    T     +K   +D   N      +      +   AS  + +     + L 
Sbjct: 69  ADKVVV----TRPGGDSKKTIVDAYGNPATFYQMQDSGKPVQGHASKLHYELANDFVELT 124

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASL-QGCESDQVQSIIRYD 178
           G+      ++++ +   G ++   +           ++ +V +++   
Sbjct: 125 GNA----FIEQQDSNIKGDRITYLVKEQKMQAYSQGQNKRVTTVLVPS 168


>gi|167944993|ref|ZP_02532067.1| cell envelope biogenesis protein YhbN [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 52

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 36 RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
                 + I+++AD +E+ +A   + + GNV ++Q    L+ADKM I
Sbjct: 5  ALSGDREQPIYLEADSVEIDEASGVSVYIGNVVVSQGSMRLEADKMWI 52


>gi|224373217|ref|YP_002607589.1| cell envelope biogenesis protein YhbN [Nautilia profundicola AmH]
 gi|223589701|gb|ACM93437.1| cell envelope biogenesis protein YhbN [Nautilia profundicola AmH]
          Length = 152

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 64/146 (43%), Gaps = 19/146 (13%)

Query: 45  IHIKADMLEVKDA-------VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           I + A+ L+V           +++ FKG+V  T+   ++ AD+M I ++   + +     
Sbjct: 13  ICVNAEELKVTSKYFHYDMAKKESIFKGDVNATKGKDNILADEMIIFFDKNKKPL----- 67

Query: 98  RMDVERNI-FIQSGEINVI----ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           +     N+ F+ S + N      +           ++L G+ A  V L+   +   G K+
Sbjct: 68  KFIATGNVRFVISLDKNATYKGRSDILVYQLHNGNIILKGN-AKIVKLETNESV-KGNKI 125

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
           I+N  T  A + G E   V+ II+ +
Sbjct: 126 ILNRFTKNAEVTGGEKKPVEIIIKVN 151


>gi|91227111|ref|ZP_01261595.1| organic solvent tolerance protein precursor [Vibrio alginolyticus
           12G01]
 gi|269964661|ref|ZP_06178899.1| organic solvent tolerance protein precursor [Vibrio alginolyticus
           40B]
 gi|91188763|gb|EAS75050.1| organic solvent tolerance protein precursor [Vibrio alginolyticus
           12G01]
 gi|269830560|gb|EEZ84781.1| organic solvent tolerance protein precursor [Vibrio alginolyticus
           40B]
          Length = 781

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADTLQAINGDK-AQYSGNVQVTQGQKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTDYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPQG 171


>gi|254229742|ref|ZP_04923150.1| organic solvent tolerance protein [Vibrio sp. Ex25]
 gi|262392436|ref|YP_003284290.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein [Vibrio sp. Ex25]
 gi|151937709|gb|EDN56559.1| organic solvent tolerance protein [Vibrio sp. Ex25]
 gi|262336030|gb|ACY49825.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. Ex25]
          Length = 781

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADTLQAINGDK-AQYSGNVQVTQGQKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTDYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPQG 171


>gi|240949343|ref|ZP_04753686.1| organic solvent tolerance protein [Actinobacillus minor NM305]
 gi|240296294|gb|EER46943.1| organic solvent tolerance protein [Actinobacillus minor NM305]
          Length = 780

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 51/140 (36%), Gaps = 12/140 (8%)

Query: 31  ASYMTRFKVLGNE---KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
             +    +V G +    I+I+AD   +      A + G+V + Q + ++ AD++ ++ + 
Sbjct: 33  VPHFQGEEVKGEQTDLPIYIEADSAVINQPKD-ATYTGDVSVKQGNRTIVADEVRVEQDG 91

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                     +  ++     Q   I     +  +D   +   L  +   +++ ++   T 
Sbjct: 92  DKA------RKAFLKGQYQYQDNMIQAQGHDAAMDLTSKEATL-ANTEYQLVGRQGRGTA 144

Query: 148 LGCKLIVNIDTSF-ASLQGC 166
                  +  T   AS   C
Sbjct: 145 ESGSFSEDTRTLKNASFTSC 164


>gi|326795049|ref|YP_004312869.1| lipopolysaccharide transport periplasmic protein LptA [Marinomonas
           mediterranea MMB-1]
 gi|326545813|gb|ADZ91033.1| lipopolysaccharide transport periplasmic protein LptA [Marinomonas
           mediterranea MMB-1]
          Length = 172

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 53/160 (33%), Gaps = 34/160 (21%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
             +F+ + A LS   AS     +   ++ + I+AD         +A +KG+V + Q    
Sbjct: 10  VTLFLTVSACLS---ASSNYALESDTSQPLEIQADEAFYDQKAGEATYKGDVLIKQGTIE 66

Query: 76  LQADKMTIDYNNTNRDVSN--------------------------KIN-----RMDVERN 104
           ++AD + +  +      S+                          +I+     R+++   
Sbjct: 67  IKADFLKVFTDPATNTFSSLQATGTPARFTQQLDEAGNRVTSRGDQIDYITDGRLEINGK 126

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
            +++ G   + A       +            +V +  + 
Sbjct: 127 GYLKRGLDEIDADFILYMMKNETFTAENRGNGRVKMTLQP 166


>gi|85058405|ref|YP_454107.1| organic solvent tolerance protein [Sodalis glossinidius str.
           'morsitans']
 gi|123520098|sp|Q2NVX3|LPTD_SODGM RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|84778925|dbj|BAE73702.1| organic solvent tolerance protein [Sodalis glossinidius str.
           'morsitans']
          Length = 780

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 42/105 (40%), Gaps = 6/105 (5%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  +HI+AD          A F GNV++ Q + +L AD++ +         +  +    
Sbjct: 47  NSLPVHIQADKAAANYPEH-ALFSGNVYIEQGNSTLTADEVQL--TQRQEQNNAPLRTAT 103

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+   S EI +     + +   +   V  G+   +++ ++  
Sbjct: 104 ATGNVNYSSNEIKLQGPKAWSNLNTKDTDVYQGNY--QIVGRQGR 146


>gi|161504787|ref|YP_001571899.1| organic solvent tolerance protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866134|gb|ABX22757.1| hypothetical protein SARI_02911 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 786

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            I  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPIRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|194364734|ref|YP_002027344.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas maltophilia R551-3]
 gi|194347538|gb|ACF50661.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas maltophilia R551-3]
          Length = 183

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 61/171 (35%), Gaps = 15/171 (8%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLE-VKDAVQKAFFKGNVFM 69
           +  +LAL  ++  A  +++            NE +HI +     +     K      V +
Sbjct: 5   FAAVLALGLLVPSAAFAKST---------DRNEDMHIDSGAQSGMLTGDGKTVLSQGVVI 55

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
           TQ    L++ +  I   +          +    +        ++ +A     D +  I+ 
Sbjct: 56  TQGTLDLRSSEAEIYLKDGEAVRVVFTGKQAKMKQQLDDGTWMDALADRIDYDIKTEIIT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           L G+   KV      N   G +++ N  +   +  G +  +V+++I    +
Sbjct: 116 LTGNY--KVTSARGTN--AGQRMVYNTRSGEMN-SGGDGSRVRTVIPPKNK 161


>gi|332994378|gb|AEF04433.1| OstA-like protein [Alteromonas sp. SN2]
          Length = 187

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 60/180 (33%), Gaps = 14/180 (7%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
            +   I L    LA    +     +  AA          N+ I + +    V    + + 
Sbjct: 1   MYKPFIRLATKALATSLAVSLFATAAIAAES------DFNKPIKVDSKSQFVDGKNKTSL 54

Query: 63  FKGNVFMTQEDFSLQADKM-TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
           FK +V +TQ    + AD++  I      R++     +             +   A+    
Sbjct: 55  FKDDVRITQGSLVINADEVEVIASEGDGREIFVARGKPASYSQKLEDGAPVTAKANEIRY 114

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG---CESDQVQSIIRYD 178
           +   R + L G+      L++  +   G K+  ++ T      G    E  +V ++   +
Sbjct: 115 EVVNRTISLQGNAE----LQQDTSKVQGDKITFDMVTEQLLATGGEDGEGGRVTTVFTPE 170


>gi|291615980|ref|YP_003518722.1| YhbN [Pantoea ananatis LMG 20103]
 gi|291151010|gb|ADD75594.1| YhbN [Pantoea ananatis LMG 20103]
 gi|327396232|dbj|BAK13654.1| protein YhbN precursor [Pantoea ananatis AJ13355]
          Length = 184

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 61/166 (36%), Gaps = 17/166 (10%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
            L A +  AA+          ++ ++I ++   +      A F GNV +TQ    + ADK
Sbjct: 12  FLLASMLLAASLPALALTGDSDKPVNIDSENQSLDLQGNVATFTGNVIVTQGSIKITADK 71

Query: 81  MTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + +    T     +K   +D   N      +      +   AS  + +     + L G+ 
Sbjct: 72  VVV----TRPGGDSKKTIVDAYGNPATFYQMQDNGKPVQGHASKLHYELANDFVELTGNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTS--FASLQGCESDQVQSIIRYD 178
             +    +  +   G ++   +      A  QG +S +V +++   
Sbjct: 128 YIE----QLDSNIKGDRITYLVKEQKMQAYSQG-QSKRVTTVLVPS 168


>gi|237757155|ref|ZP_04585583.1| putative organic solvent tolerance protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690685|gb|EEP59865.1| putative organic solvent tolerance protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 671

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
            G EK+ I++D LE ++       +GNV +T  D  L++ K  + Y++  + V+  +   
Sbjct: 17  FGQEKVIIESDKLE-REKDNIVIAEGNVVITSGDKVLKSQK--VIYDSEKKIVTVPV--- 70

Query: 100 DVERNIFIQSGEINVIASNGYVDFQK 125
                 +I++       S+G+ DF+ 
Sbjct: 71  ----KFYIKTNTFEGTGSHGWYDFEN 92


>gi|308189072|ref|YP_003933203.1| Protein yhbN precursor [Pantoea vagans C9-1]
 gi|308059582|gb|ADO11754.1| Protein yhbN precursor [Pantoea vagans C9-1]
          Length = 183

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/185 (14%), Positives = 64/185 (34%), Gaps = 24/185 (12%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N   L I L +++       L+              ++ ++I +    +      
Sbjct: 1   MKFKMNKNSLKILLASMLLATSVPALA---------LTGDSDKPVNIDSQNQALDLQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINV 114
           A F GNV +TQ    + ADK+ +    T     +K   +D   N      +      +  
Sbjct: 52  ATFTGNVIVTQGSIKITADKVVV----TRPGGDSKKTIVDAYGNPATFYQMQDSGKPVQG 107

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL-QGCESDQVQS 173
            A+  + +     + L G+      ++++ +   G ++   +           ++ +V +
Sbjct: 108 HAAKLHYELANDFVELTGNA----FIEQQDSNIKGDRITYLVKEQKMQAYSQGQNKRVTT 163

Query: 174 IIRYD 178
           ++   
Sbjct: 164 VLVPS 168


>gi|157964549|ref|YP_001499373.1| hypothetical protein RMA_0666 [Rickettsia massiliae MTU5]
 gi|157844325|gb|ABV84826.1| hypothetical protein RMA_0666 [Rickettsia massiliae MTU5]
          Length = 194

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA +  NV +  ++  L+  ++ I Y     D    I+ + V   
Sbjct: 82  LHITSDSLIIDRTKQKAAYLENVIVYFDNAILRTKELYIFYK--TIDEKQTIDHIVVPTK 139

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 140 LTVERKINNELLLADSAKYFFDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|291326550|ref|ZP_06124966.2| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rettgeri DSM 1131]
 gi|291313518|gb|EFE53971.1| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rettgeri DSM 1131]
          Length = 195

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/167 (13%), Positives = 58/167 (34%), Gaps = 20/167 (11%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
             +  A L+ +  +     K    + + I +    +        F  +V + Q    ++A
Sbjct: 21  GAVASAILALSLPAM--ALKSDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRA 78

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVL 130
           +K+ +         S+  +++ +E      +          I   AS    +  K+++ L
Sbjct: 79  NKVVVT------RPSSDSDKIVIEAFGTPVTFYQLQDDGKPIKGHASKARYEVDKQLVTL 132

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            G+      L++  +   G K+   + T        +  +V ++I  
Sbjct: 133 TGNAY----LEQLDSNIQGDKITYLVPTQQMEAFSDKGKRVTTVILP 175


>gi|254480128|ref|ZP_05093376.1| lipopolysaccharide transport periplasmic protein LptA [marine gamma
           proteobacterium HTCC2148]
 gi|214039690|gb|EEB80349.1| lipopolysaccharide transport periplasmic protein LptA [marine gamma
           proteobacterium HTCC2148]
          Length = 175

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 65/172 (37%), Gaps = 29/172 (16%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L+ LVF+L  A ++              ++ I I+AD     +      ++G+V M Q  
Sbjct: 13  LIVLVFLLPGAAIA---------LPDDRDQPIRIEADEALRDEKQGFTRYEGHVRMDQGS 63

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIF-------IQSGEINVIASNGYVDFQKR 126
             ++AD++TI +++   D      R+    +         ++ G I   A+       + 
Sbjct: 64  LHIEADQITIYHDDKEAD------RILATGSPARLQQQPELEKGPIKASANTIEYFKTED 117

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE---SDQVQSII 175
            + L  +   +    ++ +   G  +   ++         +   S +V+ +I
Sbjct: 118 RIQLRENANIE----QEGSIVTGDSIDYLMNEQLVKAGSDKNSESSRVKVVI 165


>gi|153840156|ref|ZP_01992823.1| organic solvent tolerance protein [Vibrio parahaemolyticus AQ3810]
 gi|149746206|gb|EDM57314.1| organic solvent tolerance protein [Vibrio parahaemolyticus AQ3810]
          Length = 499

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+   +           +  
Sbjct: 53  NTPVVVEADNLQAINGDK-AQYSGNVQVTQGPKKITADSVTLHQQDNV---------VVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     D  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVTFNDGQVKARSDRVTNDINQDTFSLE-NTEYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
               S+  C   
Sbjct: 162 DG--SITSCPEG 171


>gi|237746785|ref|ZP_04577265.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes HOxBLS]
 gi|229378136|gb|EEO28227.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes HOxBLS]
          Length = 184

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 63/181 (34%), Gaps = 27/181 (14%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
             F LL        AS     +   N+  +I+AD +   D  Q   F GNV +T+    +
Sbjct: 4   TSFKLLALLFCIGLASNAAAERADANKPTNIEADQMTSDDVKQITTFTGNVVVTKGTLLI 63

Query: 77  QADKMTID-----------YNNTNRDVSNKINRMDVERNIFIQSGEINVIASN----GYV 121
           +A K  I            Y    +  S +  + D   +I+I+     +   N       
Sbjct: 64  KAGKAVIVEDPEGYQFITLYAAPGKLASLR-QKQDAGPDIWIEGYGEKIEYDNKKEVAKF 122

Query: 122 DFQKRILVLNG-----DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
             + R+  L G     D   + I  +    +     + N +   +      + +V+++I+
Sbjct: 123 FTRARVKRLQGTKITDDITGEFISYDGKTEYYS---VYNTNEGVSK---PGAGRVKAVIQ 176

Query: 177 Y 177
            
Sbjct: 177 P 177


>gi|294341474|emb|CAZ89891.1| conserved hypothetical protein OstA-like protein [Thiomonas sp.
           3As]
          Length = 211

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 53/155 (34%), Gaps = 17/155 (10%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI- 96
           +   N+ IHI+AD +   D  Q + F GNV +T+    L+A  + +         +  I 
Sbjct: 28  QTDRNQPIHIEADAMRYDDVHQTSVFTGNVVVTKGSLVLRAATVDVRQAPDGYQYATAIA 87

Query: 97  ---------NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL--N 145
                     ++D       Q+ +          D +  ++ L G       L +    +
Sbjct: 88  APGQLATFQQQLDTAPGQPTQTMDGAA--QRIEYDGKTDVVTLRGQAMLS-RLIDGKLAD 144

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              G  +  N  T   +++G       +     GR
Sbjct: 145 RSQGNVIAYNQITDVFTVEGGAQG--ATATNPGGR 177


>gi|294056659|ref|YP_003550317.1| protein of unknown function DUF1239 [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615992|gb|ADE56147.1| protein of unknown function DUF1239 [Coraliomargarita akajimensis
           DSM 45221]
          Length = 619

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 59/164 (35%), Gaps = 20/164 (12%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIH----IKADML---EVKDA-VQKAFFKGNVFMTQED 73
             A  +Q   +      + G  ++     I A+ +   EV+D+   +  F+GNV +    
Sbjct: 286 ADAGRAQMILTDTGGLGIQGASELSEQTIILANHITMVEVEDSGQHEIEFEGNVDVMSGA 345

Query: 74  FSLQADKMTIDYNNTNRDVSNK------INRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            +LQAD + +          +       ++ ++   ++ +      V A        K  
Sbjct: 346 LTLQADVLDVYTQAAETTEDSGELAVGEVSLVEAAGSVRLAQDGQTVNAKKVVFHPLKET 405

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
            VL G+     ++        G +  + +    A +   E+D+V
Sbjct: 406 AVLTGEP----MVSNGRVDVHGDR--IELKPGRAIVYSAEADRV 443



 Score = 37.3 bits (85), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 34/127 (26%), Gaps = 12/127 (9%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFS 75
           V    K    Q     +        +   I +  L ++  D      F  +V +   D  
Sbjct: 131 VLSETKVVFQQGMGDSLGDPDTSSADTTLIYSGSLLLRTTDDGYFFEFDRDVLVFSGDME 190

Query: 76  LQADKMTIDYN----------NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
           L   ++    +                +  +  +   R + I  G   + A     D + 
Sbjct: 191 LSCQRLIASADAPEGKKAEASQVGDTKAEAVREVIAIRKVVINQGAREIHAEKAEFDPRA 250

Query: 126 RILVLNG 132
              +L G
Sbjct: 251 ETALLTG 257



 Score = 36.1 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 42/115 (36%), Gaps = 9/115 (7%)

Query: 46  HIKADMLEV-KDAVQKAF-FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN---KINRMD 100
            I +  +E+ +D  +  F F   V +   +  L   ++ +  +  + + +     ++ ++
Sbjct: 482 QIWSQRVEMFEDPEKTRFHFIDEVEVHGTNLDLSCRRLNVVSSGESANAAEDALGVDFIE 541

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
               + I             V   +  LVL GD     ++ +      G ++ +N
Sbjct: 542 ALDEVVIVQKGRTATCDKATVLPLEGKLVLEGDA----VVDDAKGKVSGHRITLN 592


>gi|291612909|ref|YP_003523066.1| lipopolysaccharide transport periplasmic protein LptA [Sideroxydans
           lithotrophicus ES-1]
 gi|291583021|gb|ADE10679.1| lipopolysaccharide transport periplasmic protein LptA [Sideroxydans
           lithotrophicus ES-1]
          Length = 195

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 55/150 (36%), Gaps = 12/150 (8%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
              ++ IH+++D + + DA Q + F+G V +TQ    +QA+K+ +  +            
Sbjct: 27  ADRDKPIHVESDRVVIDDAKQTSVFEGQVELTQGTLFIQAEKIVLTQDKLGNKHCTATGS 86

Query: 99  MDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
               R     + + +         D +   +   G    K   +++ +   G  +  +  
Sbjct: 87  PANFRQKHEGTDQYMEGYGDRIEYDTRTETVDFFGHARVK---RDQDDV-QGDHIAYSTR 142

Query: 158 TSFASLQGCES-------DQVQSIIRYDGR 180
           T    + G  +        +  ++I+   +
Sbjct: 143 TEVFEVSGDPTRLNDPDKGRAHAVIQPKAK 172


>gi|188996010|ref|YP_001930261.1| Organic solvent tolerance protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931077|gb|ACD65707.1| Organic solvent tolerance protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 671

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
            G EK+ I++D LE ++       +GNV +T  D  L+++K  + Y++  +  +  +   
Sbjct: 17  FGQEKVIIESDKLE-REKDNIVIAEGNVVITSGDKVLKSEK--VIYDSEKKIATVPV--- 70

Query: 100 DVERNIFIQSGEINVIASNGYVDFQK 125
                 +I++       S+G+ DF+ 
Sbjct: 71  ----KFYIKTNTFEGTGSHGWYDFEN 92


>gi|300724970|ref|YP_003714295.1| putative ABC transporter periplasmic-binding protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631512|emb|CBJ92219.1| putative transport protein (ABC superfamily, peri_bind)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 182

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 49/148 (33%), Gaps = 14/148 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I I +    +      A F  NV + Q    + ADK+ +    T  D   K
Sbjct: 23  ALKDDTKKPITIDSARQSLDLTGNVATFTDNVTVKQGSIDIHADKVVV----TRPDGDAK 78

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N      +      +   A+    +  K ++ L G+      L++  +   G
Sbjct: 79  KTVIEAYGNPATFYQLQDDGKPLKGHAAKMRYEMDKELVTLIGNAY----LEQLDSNIKG 134

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRY 177
            K+   + T        +   V +++  
Sbjct: 135 DKITYLVPTQQMEAFSDKGKHVTTVLLP 162


>gi|170723422|ref|YP_001751110.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida W619]
 gi|169761425|gb|ACA74741.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida W619]
          Length = 174

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 58/156 (37%), Gaps = 18/156 (11%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ I I+AD   + D    A + G+V +TQ    ++ + +T+      R  +  
Sbjct: 24  ALPTDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTMT-----RAANGD 78

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK------LNTFLG 149
           I+ +    N  +   E    A+         + +    + D VIL ++       NT  G
Sbjct: 79  IDVVTSVGN--LAYFEQQQSAAKPDKMKGWAVTIQYQAQKDTVILTDRAKVENEGNTTEG 136

Query: 150 CKLIVNIDTSFASLQ-----GCESDQVQSIIRYDGR 180
            K++ N  +  A+            ++  +I+   +
Sbjct: 137 EKIVYNTKSQVATAGRGGNVTQPRQRIDMVIQPKKK 172


>gi|107099955|ref|ZP_01363873.1| hypothetical protein PaerPA_01000976 [Pseudomonas aeruginosa PACS2]
 gi|296391170|ref|ZP_06880645.1| hypothetical protein PaerPAb_23579 [Pseudomonas aeruginosa PAb1]
 gi|313107045|ref|ZP_07793248.1| hypothetical protein PA39016_000840147 [Pseudomonas aeruginosa
           39016]
 gi|310879750|gb|EFQ38344.1| hypothetical protein PA39016_000840147 [Pseudomonas aeruginosa
           39016]
          Length = 155

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 57/154 (37%), Gaps = 13/154 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR-DVSN 94
                  + I ++AD  E+ D    A ++G+V +TQ    L  + +T+  +     +V  
Sbjct: 4   ALPSDREQPIRVQADSAELDDKQGVAVYRGDVVVTQGSTKLTGNTVTLKQDKNGDIEVVT 63

Query: 95  KINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
            + +            ++             +  +VL      KVI  ++ NTF G K++
Sbjct: 64  SVGKPAYYEQKPAPDKDVTKAYGLTIQYFVTQNRVVLI--DQAKVI--QEGNTFEGEKIV 119

Query: 154 VN-----IDTSFASLQ--GCESDQVQSIIRYDGR 180
            +     ++   A+         ++  +I+   +
Sbjct: 120 YDTQRQIVNAGRATGSQVTSPRPRIDMVIQPKKK 153


>gi|320539611|ref|ZP_08039275.1| putative exported protein required for envelope biosynthesis and
           integrity [Serratia symbiotica str. Tucson]
 gi|320030223|gb|EFW12238.1| putative exported protein required for envelope biosynthesis and
           integrity [Serratia symbiotica str. Tucson]
          Length = 792

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 46/109 (42%), Gaps = 7/109 (6%)

Query: 42  NEKIHIKADMLEVK-DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           N+ I I AD  E   D  Q A F GNV + Q + +L A ++ ++    +   ++ +  + 
Sbjct: 48  NQPITINAD--ESHADYPQSALFTGNVNIEQGNSTLTAKQVELN-QMQHPGQADAVRTVT 104

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTFL 148
              ++     +I +     + +   +   V  GD   +++ ++   T  
Sbjct: 105 ATGDVHYNDPQITLAGPKAWSNLNTKDTDVYKGDY--QMVGRQGRGTAN 151


>gi|85058179|ref|YP_453881.1| hypothetical protein SG0201 [Sodalis glossinidius str. 'morsitans']
 gi|84778699|dbj|BAE73476.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 187

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 49/144 (34%), Gaps = 14/144 (9%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              + IHI +    V  A     F G V + +    ++ADK+ I    T  D  +    +
Sbjct: 38  DNQQPIHIDSAQQAVDMATNTVTFTGEVVVKRGSIDIRADKVVI----TRPDGKDGNEVV 93

Query: 100 DVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +   N             +   +     +    +++L G+      L++  +   G ++ 
Sbjct: 94  ESYGNPVTFYQLQDDGKPVRGHSQKVRYETTNDLVILTGNAY----LEQLDSNVKGDRIT 149

Query: 154 VNIDTSFASLQGCESDQVQSIIRY 177
             +      +   +  QV +++  
Sbjct: 150 YLVKKQRMEVFSDKGKQVTTVLVP 173


>gi|119469167|ref|ZP_01612151.1| hypothetical protein ATW7_18765 [Alteromonadales bacterium TW-7]
 gi|119447419|gb|EAW28687.1| hypothetical protein ATW7_18765 [Alteromonadales bacterium TW-7]
          Length = 178

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 56/171 (32%), Gaps = 16/171 (9%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+ +F++    L+    +      +  N+ I I AD  E +       F+ NV +   D 
Sbjct: 5   LSTLFIIPTFILALGTNAAEPTAPISANQ-ISISADKQEGQLKENVGIFEKNVEIIHGDR 63

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN------VIASNGYVDFQKRIL 128
            + AD++ +   +   D       +           +          A+    D   R L
Sbjct: 64  KITADRLEVHKRDELGDNK---QLLIATGTPAYFEEKQADGTIMSASANEVRYDVSTRFL 120

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRY 177
            L GD      + +         +  +I+     A      +D+V +I+  
Sbjct: 121 TLIGDAE----ISQAGQKMNAKSITYDIEQQLISAEKDESSTDRVHTILVP 167


>gi|262275061|ref|ZP_06052872.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Grimontia hollisae CIP 101886]
 gi|262221624|gb|EEY72938.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Grimontia hollisae CIP 101886]
          Length = 783

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 49/124 (39%), Gaps = 15/124 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            N  I I+AD  E K A ++A ++G+V +TQ + +++AD  T+        V+       
Sbjct: 61  NNLPIKIEADSAEAK-ANERAIYRGDVVVTQGNRTVKADTATL--RQPENIVT------- 110

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK----EKLNTFLGCKLIVNI 156
            + N++   GEI V   +   +       L  +   K++      +    F        +
Sbjct: 111 ADGNVYFHDGEIAVSGKSLQTNLDNEDTTLT-EAYYKMMCTPGRGQAKRVFKNGTTFYEM 169

Query: 157 DTSF 160
           +   
Sbjct: 170 EDGT 173


>gi|89075687|ref|ZP_01162082.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
 gi|89048550|gb|EAR54124.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
          Length = 163

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 56/150 (37%), Gaps = 18/150 (12%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK-- 95
           K      I ++A   +V          GNV +TQ    ++ADK  I  +   + + +   
Sbjct: 22  KTDTQLPIQLEATTQDVDVINNVTTLTGNVDITQGGVQIKADKAVIKLDTKTKALKSVEV 81

Query: 96  ------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                  +R+  +  +          +  G     K ++VL     DK  + +  +T   
Sbjct: 82  YGKPAYFHRVMEDGKVVDG------ESLYGIYTPTKNMMVLK----DKAKITQNGSTIQA 131

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            ++  N+ +     +G +S QV +++  + 
Sbjct: 132 AEISYNLASEVMKAKGSKSRQVNTVLLPEK 161


>gi|319779021|ref|YP_004129934.1| Protein yhbN precursor [Taylorella equigenitalis MCE9]
 gi|317109045|gb|ADU91791.1| Protein yhbN precursor [Taylorella equigenitalis MCE9]
          Length = 209

 Score = 55.0 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/172 (15%), Positives = 59/172 (34%), Gaps = 17/172 (9%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNE--KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
             +       Q+    M   +    E  K  I +D L+  +  +   F GNV + +    
Sbjct: 12  TLLFAGIAKGQSLGDLMKSQQNKNEEEPKTTILSDSLQYNNNTKATVFSGNVILQRGSMK 71

Query: 76  LQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
           L AD++ +            I     ++++          +   +     D +   + L 
Sbjct: 72  LLADELRVSEKPDGTQTGTAIVNGDKKVELYNERLDLYELLKGTSKTAIYDGKTERVFLR 131

Query: 132 GDRA------DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           GD          V+     ++  G ++I +   S       ++D+V+S+++ 
Sbjct: 132 GDAVITRSICGTVV-----DSIRGEEIIFDNAKSTYRANRSKTDRVRSVLQP 178


>gi|294634978|ref|ZP_06713495.1| LPS-assembly protein [Edwardsiella tarda ATCC 23685]
 gi|291091577|gb|EFE24138.1| LPS-assembly protein [Edwardsiella tarda ATCC 23685]
          Length = 795

 Score = 55.0 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 37/86 (43%), Gaps = 2/86 (2%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  +HI AD  E       A F+GNV + Q + +L AD++ +D   T     + +  + 
Sbjct: 55  NDLPVHITADKSEANYPNN-ALFQGNVDIKQGNSTLTADRVQLD-QKTISGQPDPLRTVT 112

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR 126
              N+     +I +   + + +   +
Sbjct: 113 ATGNVNYADNQIRLQGPSAWSNLNNK 138


>gi|91790319|ref|YP_551271.1| OstA-like protein [Polaromonas sp. JS666]
 gi|91699544|gb|ABE46373.1| OstA-like protein [Polaromonas sp. JS666]
          Length = 205

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/169 (11%), Positives = 62/169 (36%), Gaps = 13/169 (7%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           +++ A L+  A   +   +   ++ ++ +AD L   D  Q + F GNV +T+    ++ +
Sbjct: 8   LIVLAALAVGAVFPVAAERADRDKPMNAEADALRYDDLKQTSVFTGNVVITKGTTIVRGE 67

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSG-----EINVIASNGYVDFQKRILVLNGDR 134
           ++ +  +      +  +        +          +  +      +++  R   +   +
Sbjct: 68  RVDVSQDPQGYQQALAVA---APGKLAFYRKKRDGVDEYIEGEGERIEYDSRADTVKFIK 124

Query: 135 ADKVILKEKL---NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              V         +   G  ++ + +T   ++ G   ++  + +   GR
Sbjct: 125 QAVVRRYNGATLVDETTGSLIVYDNNTDVFTVDGGAQNR--TAVNPTGR 171


>gi|94968687|ref|YP_590735.1| OstA-like protein [Candidatus Koribacter versatilis Ellin345]
 gi|94550737|gb|ABF40661.1| OstA-like protein [Candidatus Koribacter versatilis Ellin345]
          Length = 760

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 55/160 (34%), Gaps = 9/160 (5%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           +LV        S   + ++ + K      ++I A  L   DA ++A ++G V     D  
Sbjct: 592 SLVAQGTGQAASPVTSVFVQKDKDGKITPVNITARKLTYVDAERRARYEGGVTARTTDGV 651

Query: 76  LQADKMTIDYNNTNRDVS-------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           L AD + +    +    S       ++++R+  +  + +         +      Q    
Sbjct: 652 LTADHVDVYLKESGASTSPTAQPGPSQLDRIIAQGTVVLAQPGRRATGNKLTYFQQDGRF 711

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
           VL+GD       +    T  G  L          ++G  +
Sbjct: 712 VLSGDNPAIADAEHG--TVRGESLTFFSKDDRVLVEGSNA 749



 Score = 41.2 bits (95), Expect = 0.067,   Method: Composition-based stats.
 Identities = 20/112 (17%), Positives = 36/112 (32%), Gaps = 6/112 (5%)

Query: 71  QEDFSLQADKMTIDYNNTNRDVS-NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
           Q + +  ADK+ + YN      S  +         +    GE    A          +L 
Sbjct: 433 QAERTTTADKLEVLYNEKGELASVLQQGNFRYHEALPANQGERTATAEKATYSPSDELLR 492

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRYDGR 180
           L G       + +   +     + +N  T  A+  G  +S   Q   + +G 
Sbjct: 493 LTGSPR----ITDGGMSLTASLVNINRHTGEATADGNVKSTYSQLKEQPNGA 540


>gi|322615914|gb|EFY12831.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620699|gb|EFY17559.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623950|gb|EFY20787.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322627398|gb|EFY24189.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322630705|gb|EFY27469.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322638075|gb|EFY34776.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640561|gb|EFY37212.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647701|gb|EFY44186.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648051|gb|EFY44518.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322656917|gb|EFY53203.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657372|gb|EFY53644.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663692|gb|EFY59892.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322666525|gb|EFY62703.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672316|gb|EFY68428.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676372|gb|EFY72443.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679535|gb|EFY75580.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686136|gb|EFY82120.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323194980|gb|EFZ80166.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200111|gb|EFZ85198.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201068|gb|EFZ86137.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209465|gb|EFZ94398.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212283|gb|EFZ97107.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216588|gb|EGA01314.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222473|gb|EGA06843.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225784|gb|EGA10004.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228675|gb|EGA12804.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236711|gb|EGA20787.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239788|gb|EGA23835.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242164|gb|EGA26193.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249411|gb|EGA33327.1| LPS assembly outer membrane complex protein LptD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323252254|gb|EGA36105.1| LPS assembly outer membrane complex protein LptD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323256655|gb|EGA40385.1| LPS assembly outer membrane complex protein LptD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323261311|gb|EGA44898.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323265509|gb|EGA49005.1| LPS assembly outer membrane complex protein LptD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323271703|gb|EGA55121.1| LPS assembly outer membrane complex protein LptD [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 784

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|253734674|ref|ZP_04868839.1| possible ABC superfamily ATP binding cassette transporter,
          periplasmic lipopolysaccharide-binding protein
          [Staphylococcus aureus subsp. aureus TCH130]
 gi|253727351|gb|EES96080.1| possible ABC superfamily ATP binding cassette transporter,
          periplasmic lipopolysaccharide-binding protein
          [Staphylococcus aureus subsp. aureus TCH130]
          Length = 80

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 15 LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
          L+L  VL  + L+ +  ++        ++ IHI++D   +        F GNV +TQ   
Sbjct: 3  LSLNLVLASSLLAASIPAF--AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTI 60

Query: 75 SLQADKMTIDYNNTNRD 91
           + ADK+ +      + 
Sbjct: 61 KINADKVVVTRPGGEQG 77


>gi|224581935|ref|YP_002635733.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224466462|gb|ACN44292.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|322713111|gb|EFZ04682.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|213646896|ref|ZP_03376949.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 725

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|213581066|ref|ZP_03362892.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 616

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 14  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 71

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 72  ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 114


>gi|213420996|ref|ZP_03354062.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
          Length = 345

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|205351433|ref|YP_002225234.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205271214|emb|CAR36002.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326626456|gb|EGE32799.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|204927008|ref|ZP_03218210.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|204323673|gb|EDZ08868.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
          Length = 784

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|168262230|ref|ZP_02684203.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168820925|ref|ZP_02832925.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205342402|gb|EDZ29166.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348840|gb|EDZ35471.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|320084331|emb|CBY94124.1| LPS-assembly protein Organic solvent tolerance protein; Flags:
           Precursor [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|197250730|ref|YP_002145077.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197214433|gb|ACH51830.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|167989956|ref|ZP_02571056.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331294|gb|EDZ18058.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261245326|emb|CBG23114.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267991764|gb|ACY86649.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301156722|emb|CBW16196.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|323128411|gb|ADX15841.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332987045|gb|AEF06028.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|168230362|ref|ZP_02655420.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168464363|ref|ZP_02698266.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194445274|ref|YP_002039323.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194468680|ref|ZP_03074664.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|200386860|ref|ZP_03213472.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|207855606|ref|YP_002242257.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|238911151|ref|ZP_04654988.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|194403937|gb|ACF64159.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194455044|gb|EDX43883.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|195632917|gb|EDX51371.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|199603958|gb|EDZ02503.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205335098|gb|EDZ21862.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|206707409|emb|CAR31682.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|198242523|ref|YP_002214045.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197937039|gb|ACH74372.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|326621789|gb|EGE28134.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|161612429|ref|YP_001586394.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161361793|gb|ABX65561.1| hypothetical protein SPAB_00118 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 775

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 37  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 94

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 95  ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 137


>gi|56412364|ref|YP_149439.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197361301|ref|YP_002140936.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|67460763|sp|Q5PDE5|LPTD_SALPA RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|56126621|gb|AAV76127.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197092776|emb|CAR58201.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 784

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|16763483|ref|NP_459098.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167550724|ref|ZP_02344481.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|168243500|ref|ZP_02668432.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|194450910|ref|YP_002044061.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197265948|ref|ZP_03166022.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|25008880|sp|Q8ZRW0|LPTD_SALTY RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|16418590|gb|AAL19057.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194409214|gb|ACF69433.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197244203|gb|EDY26823.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205324339|gb|EDZ12178.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205337498|gb|EDZ24262.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|312911063|dbj|BAJ35037.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222337|gb|EFX47409.1| Outer membrane protein Imp [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 786

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|16759088|ref|NP_454705.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29140638|ref|NP_803980.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213427536|ref|ZP_03360286.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|289826181|ref|ZP_06545293.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25008879|sp|Q8Z9J6|LPTD_SALTI RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|25306757|pir||AI0513 organic solvent tolerance protein precursor [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501378|emb|CAD01249.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29136262|gb|AAO67829.1| organic solvent tolerance protein precursor [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 784

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|218547504|ref|YP_002381295.1| organic solvent tolerance protein [Escherichia fergusonii ATCC
           35469]
 gi|218355045|emb|CAQ87651.1| exported protein required for envelope biosynthesis and integrity
           [Escherichia fergusonii ATCC 35469]
 gi|324112543|gb|EGC06520.1| hypothetical protein ERIG_02875 [Escherichia fergusonii B253]
          Length = 783

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 52/147 (35%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF--------KVLGNE-KIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M           K   NE  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVKGDTNELPVTINADDAKGNYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F GNV + Q +  LQAD++ +            I  +D   N+     ++ +    
Sbjct: 66  D-AVFSGNVDIMQGNSRLQADEVQLH-QKEAPGEPEPIRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|21232231|ref|NP_638148.1| hypothetical protein XCC2800 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767640|ref|YP_242402.1| hypothetical protein XC_1313 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188990756|ref|YP_001902766.1| hypothetical protein xccb100_1360 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113990|gb|AAM42072.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572972|gb|AAY48382.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732516|emb|CAP50710.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 178

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 52/139 (37%), Gaps = 7/139 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F G V +TQ    + AD   I   N   D      
Sbjct: 26  DRNQPMTIDSNSNDCNMLDDSGKCRFSGKVVITQGTLEIHADTADIFQKNGQTDRVVLNG 85

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        +N  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 86  KQATLKQEMDDGAMMNGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 141

Query: 158 TSFASLQGCESDQVQSIIR 176
           T      G +  +V++II+
Sbjct: 142 TGNMQ-SGGDGSRVRTIIQ 159


>gi|325926075|ref|ZP_08187438.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           perforans 91-118]
 gi|325543533|gb|EGD14953.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           perforans 91-118]
          Length = 183

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 52/138 (37%), Gaps = 7/138 (5%)

Query: 40  LGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
             N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D      
Sbjct: 23  DRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVLNG 82

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +    +        ++  A N        I++L G+   KV   +  N   G +++ N  
Sbjct: 83  KQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNY--KVDSPKGTN--AGQRMVYNTK 138

Query: 158 TSFASLQGCESDQVQSII 175
           T      G +  +V++II
Sbjct: 139 TGNMQ-SGGDGSRVRTII 155


>gi|289812307|ref|ZP_06542936.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 142

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 47/132 (35%), Gaps = 6/132 (4%)

Query: 49  ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIF 106
           +D   +        F GNV MTQ    + ADK+ +        ++V +          + 
Sbjct: 1   SDQQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQ 60

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
                +   AS+ + +  K  +VL G+      L++  +   G K+   +          
Sbjct: 61  DNGKPVKGHASHMHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSE 116

Query: 167 ESDQVQSIIRYD 178
           +  +V +++   
Sbjct: 117 KGKRVTTVLVPS 128


>gi|300715282|ref|YP_003740085.1| Organic solvent tolerance protein [Erwinia billingiae Eb661]
 gi|299061118|emb|CAX58225.1| Organic solvent tolerance protein [Erwinia billingiae Eb661]
          Length = 787

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 47/130 (36%), Gaps = 12/130 (9%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K   +  + I AD  +       A F GNV + Q +  L +D++ +            + 
Sbjct: 46  KTNNDLPVTINADNAKGNYPDN-AVFTGNVDIQQGNSRLLSDEVQLH-QKQQPGQPTPVR 103

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNT-----FLGC- 150
            +D   N+     ++ +     + +   +   V NGD   +++ ++   T       G  
Sbjct: 104 TVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWNGDY--QMVGRQGRGTGDQMKLRGQN 161

Query: 151 KLIVNIDTSF 160
           +  + ++   
Sbjct: 162 RYTI-MENGT 170


>gi|62178658|ref|YP_215075.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|67460728|sp|Q57TG7|LPTD_SALCH RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|62126291|gb|AAX63994.1| Organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 786

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPND-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|226940942|ref|YP_002796016.1| OstA-like protein [Laribacter hongkongensis HLHK9]
 gi|226715869|gb|ACO75007.1| OstA-like protein [Laribacter hongkongensis HLHK9]
          Length = 183

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 65/190 (34%), Gaps = 36/190 (18%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           N++  ++ +  L  + + A   QA            ++ I I+AD   +        ++G
Sbjct: 4   NNLAGFLLISGLAGLSVPAHAEQA----------DRSKPIVIEADRANLDQLKGVTVYEG 53

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNKI-------NRMDV--ERNIFIQSGEINVIA 116
           NV +TQ    +  +++ +  +N  + ++N          R+D   +  +    G+     
Sbjct: 54  NVILTQGTARITGNRLVVTEDNAKQQIANVYGNPATFKQRLDADKDGKVEWVDGK----G 109

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-------- 168
                D  K ++       D   +    +   G  ++ N  T      G ++        
Sbjct: 110 QRIEYDSGKDLV----RIWDNGRVTRGGDVVTGNYIVYNAKTEQFEASGQQAGPNGQPQG 165

Query: 169 -DQVQSIIRY 177
             +V   I+ 
Sbjct: 166 KGRVTVTIQP 175


>gi|312883923|ref|ZP_07743640.1| organic solvent tolerance protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368381|gb|EFP95916.1| organic solvent tolerance protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 819

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 10/91 (10%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              E + + AD LE  +  + A +KGNV   Q    + AD M + +      V       
Sbjct: 79  SKQEPVVVDADHLEAINGEK-ATYKGNVVAIQGQKRMLADNM-VYHQKEEIVV------- 129

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVL 130
             E N+    G+I  I+          ++ L
Sbjct: 130 -AEGNVTFSDGQIKTISDKATNKLNSDLVTL 159


>gi|302063707|ref|ZP_07255248.1| ostA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302133819|ref|ZP_07259809.1| ostA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|331016689|gb|EGH96745.1| ostA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 173

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 64/172 (37%), Gaps = 17/172 (9%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            + L A L  A+A  +       ++ IHI++D  ++ D    A +KGNV +TQ    +  
Sbjct: 1   MLGLSAALGSASAWSLPN---DRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITG 57

Query: 79  DKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           + +TI  N     DV   +  +            I    +     +  +  ++  D+A  
Sbjct: 58  NTVTITRNAQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAITIQYYAGQDRIVLIDKAKV 117

Query: 138 VILKEKLNTFLGCKLIVN---------IDTSFASLQGCESDQVQSIIRYDGR 180
           V   +  NT  G K++ +              A +      ++  +I+   +
Sbjct: 118 V--NDG-NTSEGEKIVYDTVRQVVSAGRANGGAKVTTPR-PRIDMVIQPKKK 165


>gi|317046869|ref|YP_004114517.1| Organic solvent tolerance protein [Pantoea sp. At-9b]
 gi|316948486|gb|ADU67961.1| Organic solvent tolerance protein [Pantoea sp. At-9b]
          Length = 803

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 44/114 (38%), Gaps = 18/114 (15%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I +D L+       A + GNV + Q +  + AD++ +         +  +  +D
Sbjct: 60  NSLPVTIHSDSLKGTYPSD-AVYTGNVDVQQGNSRMTADEVQLHQRQQE-GQTTPVRTVD 117

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
              N+              + D  +  ++L G +A   +  +  N + G  L+V
Sbjct: 118 ALGNV--------------HYDDNQ--VILKGPKAWSNLNTKDTNVWNGNYLMV 155


>gi|34498785|ref|NP_903000.1| hypothetical protein CV_3330 [Chromobacterium violaceum ATCC 12472]
 gi|34104636|gb|AAQ60994.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 186

 Score = 54.6 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 41/118 (34%), Gaps = 6/118 (5%)

Query: 43  EKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           + I I +D    ++     +   GNV + Q    L ADK+    +           R+  
Sbjct: 29  KPIEITSDNGCTMEQTKGISTCTGNVVVVQGTLRLNADKVVATQDQQGNQTLQATGRIVT 88

Query: 102 ER-NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
            R  +   SG I   +S    D  K   VL G+   K       +  +G  +  +  +
Sbjct: 89  FRQKLDNNSGWIEGQSSKLDYDSAKHFAVLTGNARVK----RNGDLVIGNVITYDTQS 142


>gi|268679306|ref|YP_003303737.1| OstA family protein [Sulfurospirillum deleyianum DSM 6946]
 gi|268617337|gb|ACZ11702.1| OstA family protein [Sulfurospirillum deleyianum DSM 6946]
          Length = 154

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 54/132 (40%), Gaps = 3/132 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I AD     +  + + F+GNV +T+E   + A K+ +++++  + +   I   D + N
Sbjct: 20  VEIVADKFFADEKKKISVFEGNVKVTKESDKITAKKIIVEFDDKKQPI-RYIATGDAKAN 78

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + +   +    A     + QK +  L        I  ++     G  + VN  T    + 
Sbjct: 79  LIMNQKKYYGEAEKMTYEPQKSLYTLEKKAFLHEIDTDRK--VYGDFVRVNQATGHYEVD 136

Query: 165 GCESDQVQSIIR 176
              S  V+ I +
Sbjct: 137 SKNSAPVKFIFK 148


>gi|315635177|ref|ZP_07890455.1| LPS-assembly protein [Aggregatibacter segnis ATCC 33393]
 gi|315476139|gb|EFU66893.1| LPS-assembly protein [Aggregatibacter segnis ATCC 33393]
          Length = 781

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 54/146 (36%), Gaps = 13/146 (8%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVL------GNEKIHIKADMLEVKDAVQKAFFKGNV 67
           L AL      ADL++   S +  F          +  I+I+AD  E+  +     +KGNV
Sbjct: 14  LTALYSATSAADLAKQCLSGVPHFSGEVVSENPNDLPIYIEADSAEINQSNG-GVYKGNV 72

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDFQKR 126
            + Q    LQ+ ++ I          + I R    R  F       N++  +  V    +
Sbjct: 73  DIKQGVRHLQSAEVEI----QQTGEGDNIQRYAFARGGFDYRDNQINLLGDDAKVHLNNK 128

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKL 152
              +  +   +++ ++        +L
Sbjct: 129 DTDIQ-NANYQLVDRQGRGAAESVEL 153


>gi|304396536|ref|ZP_07378417.1| Organic solvent tolerance protein [Pantoea sp. aB]
 gi|304356045|gb|EFM20411.1| Organic solvent tolerance protein [Pantoea sp. aB]
          Length = 798

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 46/118 (38%), Gaps = 6/118 (5%)

Query: 37  FKVLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                N+  + I +D  +       A F GNV + Q +  +QAD++ +         +  
Sbjct: 49  VNGDTNQLPVTIHSDAAKGNYPND-AVFTGNVNIEQGNSRMQADEVQLHQRQQEGQTA-P 106

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTFLGCKL 152
           +  +D   N+     ++ +     + +   +   V NGD   +++ ++   T    KL
Sbjct: 107 VRTVDALGNVHYDDNQVILKGPKAWSNLNSKDTNVWNGDY--QMVDRQGRGTADQMKL 162


>gi|289627572|ref|ZP_06460526.1| OstA family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646998|ref|ZP_06478341.1| OstA family protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|302185310|ref|ZP_07261983.1| OstA family protein [Pseudomonas syringae pv. syringae 642]
 gi|320330040|gb|EFW86027.1| OstA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330875122|gb|EGH09271.1| OstA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330888618|gb|EGH21279.1| OstA family protein [Pseudomonas syringae pv. mori str. 301020]
 gi|330950270|gb|EGH50530.1| OstA family protein [Pseudomonas syringae Cit 7]
 gi|331011537|gb|EGH91593.1| OstA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 173

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 65/172 (37%), Gaps = 17/172 (9%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            + L A L  A+A  +       ++ IHI++D  ++ D    A +KGNV +TQ    +  
Sbjct: 1   MLGLGAALGSASAWSLPT---DRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITG 57

Query: 79  DKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           + +TI  N     DV   +  +            I    +     +  +  ++  D+A  
Sbjct: 58  NTVTITRNAQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLIDKAK- 116

Query: 138 VILKEKLNTFLGCKLIVN---------IDTSFASLQGCESDQVQSIIRYDGR 180
            ++ +  NT  G K++ +              A +      ++  +I+   +
Sbjct: 117 -VINDG-NTSEGEKIVYDTVRQVVSAGRANGGAKVTTPR-PRIDMVIQPKKK 165


>gi|163749270|ref|ZP_02156519.1| hypothetical protein KT99_08408 [Shewanella benthica KT99]
 gi|161330989|gb|EDQ01915.1| hypothetical protein KT99_08408 [Shewanella benthica KT99]
          Length = 218

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 52/151 (34%), Gaps = 7/151 (4%)

Query: 31  ASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-N 87
            +  +      +  +++ I A   E      +  F G V +TQ   ++ AD++      +
Sbjct: 14  TTSFSGMTKQDDLMQEVKISAASQEADIKNNQMIFHGPVEVTQGSITILADELRATSKED 73

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
               +   I        I       +  A     +   R L L G+      L++  +  
Sbjct: 74  GGGKILIAIGNPATYSQIMEDGRPASASAKEIRYELSSRTLTLVGNAT----LEQDGSRV 129

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G  +  NI       +   +++V +II+ +
Sbjct: 130 TGNMIRYNIAKQQLIAESIGNERVITIIQPE 160


>gi|86148120|ref|ZP_01066420.1| organic solvent tolerance protein precursor [Vibrio sp. MED222]
 gi|85834107|gb|EAQ52265.1| organic solvent tolerance protein precursor [Vibrio sp. MED222]
          Length = 748

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 50/130 (38%), Gaps = 17/130 (13%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
             H+++D LE  +  + A + G+V +TQ + ++ AD +T+            I  +  E 
Sbjct: 20  PAHVESDRLEAINGDK-AIYSGDVRVTQGNKTILADNVTLH-------QQENI--VVAEG 69

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTS 159
           N+    G+I  +A     +     + L  +   + + ++            K +  I+  
Sbjct: 70  NVNFSDGQIKSVADRATNNLTTDEMTLE-NTDYEFLCEQGRGDAVYIAKTGKAVYEIEDG 128

Query: 160 FASLQGCESD 169
             S+  C   
Sbjct: 129 --SITSCPIG 136


>gi|294139187|ref|YP_003555165.1| hypothetical protein SVI_0416 [Shewanella violacea DSS12]
 gi|293325656|dbj|BAJ00387.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 217

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 51/151 (33%), Gaps = 7/151 (4%)

Query: 31  ASYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-N 87
            +  +      +  +++ I A   E      +  F G V +TQ    + AD++      +
Sbjct: 18  VTSFSGIAKQNDLMQEVKISASSQEADIKNNQMIFHGPVEVTQGSIKILADELRATSKED 77

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
               +   I        I       +  A     +   R L L G+      L++  +  
Sbjct: 78  GGGKILVAIGNPATYSQIMEDGRPASASAKEIRYELSSRTLTLLGNAT----LEQDASRV 133

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G  +  NI       +   +D+V +II+ +
Sbjct: 134 TGNMIRYNIAKQQLIAESKGNDRVITIIQPE 164


>gi|239996753|ref|ZP_04717277.1| OstA-like protein [Alteromonas macleodii ATCC 27126]
          Length = 184

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 61/166 (36%), Gaps = 9/166 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L  + L   A+  +   +   ++ I I ++   +    + A +K +V +TQ    ++
Sbjct: 5   LIPLATSLLLAIASGAVHASEDDFSQPIKIGSNTQFIDGKNKTALYKDDVLITQGSLVIE 64

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRAD 136
           AD++ +   +                +  ++ G  ++  A+    +   R + L G+   
Sbjct: 65  ADEVEVIATDGGGREIFIARGKPASYSQQLEDGTPVSAKANEIRYEVVNRTISLAGNAE- 123

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRYD 178
              LK+  +   G  +  ++ T      G        +V ++   +
Sbjct: 124 ---LKQDTSKVQGDNITFDMITEQLLATGGAGKDGEGRVTTVFTPE 166


>gi|238758314|ref|ZP_04619492.1| hypothetical protein yaldo0001_2010 [Yersinia aldovae ATCC 35236]
 gi|238703437|gb|EEP95976.1| hypothetical protein yaldo0001_2010 [Yersinia aldovae ATCC 35236]
          Length = 165

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/151 (10%), Positives = 49/151 (32%), Gaps = 18/151 (11%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ +++ +    +  A     F  NV + Q    ++ADK+ +     ++     
Sbjct: 9   ALTGDTDQPVNVDSVKQALDMAANTVTFTDNVIIRQGTIEIKADKVVVTRPGGDQS---- 64

Query: 96  INRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
             +M +E      +          +         +     +VL G+      L++  +  
Sbjct: 65  --KMVIEGYGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDSNI 118

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G ++   +          + ++V +++   
Sbjct: 119 KGDRITYLVKKQQMEAFSDKGNRVTTVLLPS 149


>gi|160871559|ref|ZP_02061691.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159120358|gb|EDP45696.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 173

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 47/119 (39%), Gaps = 16/119 (13%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN-- 104
            ++D +   +  ++  ++G++ +TQ    L AD     Y  +  D + +IN++    N  
Sbjct: 41  FESDSVTYNNKTKQGIYRGHIKLTQGSAVLTAD-----YATSYFDQNGQINKIIAIGNPA 95

Query: 105 -----IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
                IF    ++       Y   +K  L   G+      + +  N F G ++  +  T
Sbjct: 96  RYQAFIFPHRPQLIATGKTIYYYPKKEYLEAIGNAE----MVQGKNHFKGYQINYDFKT 150


>gi|289676084|ref|ZP_06496974.1| OstA-like protein [Pseudomonas syringae pv. syringae FF5]
 gi|330895270|gb|EGH27608.1| OstA-like protein [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330937988|gb|EGH41771.1| OstA-like protein [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330969689|gb|EGH69755.1| OstA-like protein [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330981130|gb|EGH79233.1| OstA-like protein [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 173

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 65/172 (37%), Gaps = 17/172 (9%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            + L A L  A+A  +       ++ IHI++D  ++ D    A +KGNV +TQ    +  
Sbjct: 1   MLGLGAALGSASAWSLPT---DRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITG 57

Query: 79  DKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           + +TI  N     DV   +  +            I    +     +  +  ++  D+A  
Sbjct: 58  NTVTITRNAQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLIDKAK- 116

Query: 138 VILKEKLNTFLGCKLIVN---------IDTSFASLQGCESDQVQSIIRYDGR 180
            ++ +  NT  G K++ +              A +      ++  +I+   +
Sbjct: 117 -VINDG-NTSEGEKIVYDTVRQVVTAGRANGGAKVTTPR-PRIDMVIQPKKK 165


>gi|317046698|ref|YP_004114346.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           At-9b]
 gi|316948315|gb|ADU67790.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           At-9b]
          Length = 184

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 52/150 (34%), Gaps = 15/150 (10%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ ++I ++   +      A F GNV +TQ    + ADK+ +    T     +K
Sbjct: 27  ALTGDSDKPVNIDSENQSLDLQGNVATFTGNVIVTQGSIKITADKVVV----TRPGGDSK 82

Query: 96  INRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +D   N      +      +   A+  + +     + L G+   +    +  +   G
Sbjct: 83  KTIVDAWGNPATFYQMQDNGKPVQGHAAKLHYELANDFVELTGNAYIE----QLDSNIKG 138

Query: 150 CKLIVNIDTSFASL-QGCESDQVQSIIRYD 178
            ++   +           +S +V +++   
Sbjct: 139 DRITYLVKEQKMQAYSQGQSKRVTTVLVPS 168


>gi|89075562|ref|ZP_01161967.1| organic solvent tolerance protein precursor [Photobacterium sp.
           SKA34]
 gi|89048702|gb|EAR54274.1| organic solvent tolerance protein precursor [Photobacterium sp.
           SKA34]
          Length = 825

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 37/90 (41%), Gaps = 8/90 (8%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            N  I I+ D ++ +    +A + G+V + Q   ++ ADK+T+      R V+       
Sbjct: 72  NNTPITIEGDNVQAQQG-HQAVYTGDVIVKQGTRTIAADKVTLQQKQQQRIVT------- 123

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVL 130
            + N++   G I +       D   +   +
Sbjct: 124 AKGNVYYHDGGIEMDGKQLQSDLNTKDSQM 153


>gi|332140247|ref|YP_004425985.1| OstA-like protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550269|gb|AEA96987.1| OstA-like protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 184

 Score = 54.3 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/166 (13%), Positives = 64/166 (38%), Gaps = 9/166 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L  + L   A+  ++  +   ++ I I ++   +    + A +K +V +TQ    ++
Sbjct: 5   LIPLATSLLLVIASGAVSASEDDFSQPIKIGSNTQFIDGKNKTALYKEDVLITQGSLVIE 64

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRAD 136
           AD++ +  +  +              +  ++ G  ++  A+    +   R + L+G+   
Sbjct: 65  ADEVEVIASEGSGREIFIARGKPASYSQTLEDGTPVSAKANEIRYEVINRTISLSGNAE- 123

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRYD 178
              L++  +   G  +  ++ T      G        +V ++   +
Sbjct: 124 ---LQQDTSKVQGDNITFDMITEQLLATGGAGENGEGRVTTVFTPE 166


>gi|157827305|ref|YP_001496369.1| hypothetical protein A1I_04995 [Rickettsia bellii OSU 85-389]
 gi|157802609|gb|ABV79332.1| hypothetical protein A1I_04995 [Rickettsia bellii OSU 85-389]
          Length = 146

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 51/113 (45%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QK  + GNV +  ++  L+ +++ I Y   +   +     +  + +
Sbjct: 28  LHITSDTLIINRVKQKVEYLGNVVVYFDNAILRTEELYIFYKTIDNKQTIDYIVVPTKLS 87

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +G      + L+L G+    V+L+   N     KLI  +D
Sbjct: 88  VEKKINNELLLADSGKYFLDNKQLILLGN----VVLERNNNILKTNKLIYYVD 136


>gi|283956063|ref|ZP_06373550.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792383|gb|EFC31165.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 145

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 47/131 (35%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   + +  +  + +    
Sbjct: 13  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKPIRYEAMQ-NATFK 71

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 72  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 129

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 130 SKDQKPARFVF 140


>gi|254362691|ref|ZP_04978778.1| hypothetical protein MHA_2287 [Mannheimia haemolytica PHL213]
 gi|153094310|gb|EDN75174.1| hypothetical protein MHA_2287 [Mannheimia haemolytica PHL213]
          Length = 134

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/130 (12%), Positives = 42/130 (32%), Gaps = 4/130 (3%)

Query: 49  ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ 108
           +    +        F  NV +TQ    + A  + I      ++  +        +     
Sbjct: 1   SGSQSLDMTNNIVTFSDNVVITQGSIKVTAANVKITRQEGKKETIDATGSPVTFQQTLDN 60

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
              +N   ++ + D     L L G+      LK++ +     K+  ++            
Sbjct: 61  GKPVNGKGNSVHYDLNSEFLTLIGNAE----LKQQGSFIKANKITYDVKKQQLKATSGGK 116

Query: 169 DQVQSIIRYD 178
            +V++++  +
Sbjct: 117 TRVKTVLIPN 126


>gi|254523996|ref|ZP_05136051.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas sp. SKA14]
 gi|219721587|gb|EED40112.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas sp. SKA14]
          Length = 175

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 53/152 (34%), Gaps = 8/152 (5%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLE-VKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
            S         NE + I++     V     K      V +TQ    +++ +  I   +  
Sbjct: 16  PSAAFAKSTDRNENMDIESGAQSGVLTGDGKTVLSQGVTITQGTLDIRSSEAEIYLKDGE 75

Query: 90  RDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
              +    +        +  G  ++ +A     D +  I+ L G+   KV      N   
Sbjct: 76  AVRAVFTGK-QATMKQQLDDGTWMDAVADRIDYDIKTEIITLTGNY--KVTSARGTN--A 130

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           G +++ N  +   +  G +  +V+++I    +
Sbjct: 131 GQRMVYNTRSGEMN-SGGDGSRVRTVIPPKNK 161


>gi|15604367|ref|NP_220883.1| hypothetical protein RP507 [Rickettsia prowazekii str. Madrid E]
 gi|6647949|sp|Q9ZD40|Y507_RICPR RecName: Full=Uncharacterized protein RP507
 gi|3861059|emb|CAA14959.1| unknown [Rickettsia prowazekii]
 gi|292572120|gb|ADE30035.1| hypothetical protein rpr22_CDS491 [Rickettsia prowazekii Rp22]
          Length = 145

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 50/115 (43%), Gaps = 8/115 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I ++ L +    QKA + GNV +  ++  L+  K+ I Y          I+ + V   
Sbjct: 33  LQITSNTLIIDRIKQKAEYSGNVIVYFDNAILRTQKLYIFYKTIGE--KQVIDHIVVPSK 90

Query: 105 IFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           + +  +     ++A +    F  + L+L G+    VIL+   +     KLI  ++
Sbjct: 91  LTVERKINNELLLADSAKYFFVDKQLILLGN----VILQRNDHVLKTNKLIYYVE 141


>gi|206578979|ref|YP_002240482.1| LPS-assembly protein [Klebsiella pneumoniae 342]
 gi|288937182|ref|YP_003441241.1| organic solvent tolerance protein [Klebsiella variicola At-22]
 gi|290512603|ref|ZP_06551969.1| organic solvent tolerance protein [Klebsiella sp. 1_1_55]
 gi|206568037|gb|ACI09813.1| LPS-assembly protein [Klebsiella pneumoniae 342]
 gi|288891891|gb|ADC60209.1| Organic solvent tolerance protein [Klebsiella variicola At-22]
 gi|289774944|gb|EFD82946.1| organic solvent tolerance protein [Klebsiella sp. 1_1_55]
          Length = 782

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 51/150 (34%), Gaps = 14/150 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVL---------GNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A   M               G+  + I AD  +     
Sbjct: 6   PSLLATMIASALYSQQGLAADLATQCMLGVPSFDRPLVEGRPGDLPVTINADHAKGNYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F GNV + Q +  L+AD++ +         +  +  +D   N+     ++ +    
Sbjct: 66  N-AVFTGNVDINQGNSRLRADEVQLH-QQQAAGQAQPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKLNTF 147
            + +   +   V  GD   +++ ++   T 
Sbjct: 124 AWSNLNTKDTNVWQGDY--QMVGRQGRGTA 151


>gi|153951767|ref|YP_001398393.1| OstA family protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939213|gb|ABS43954.1| OstA family protein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 153

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 48/131 (36%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +  ++ +  +  + +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNHKPIRYEAMQ-NASFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IILKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 138 SKDQKPARFVF 148


>gi|217971900|ref|YP_002356651.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS223]
 gi|217497035|gb|ACK45228.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS223]
          Length = 184

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 51/145 (35%), Gaps = 17/145 (11%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            +++ IKA          +  F G V +TQ    + AD++      +    ++KI  +  
Sbjct: 27  KQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHADQLRAF---SAEGENSKI--LVA 81

Query: 102 ERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             N      +       +  A     D   R L L G    K  L +  +   G  +  N
Sbjct: 82  TGNPATYSQVLDDGRPASASAKEIRYDMASRTLTLKG----KASLDQAGSQVTGNLIRYN 137

Query: 156 IDTSF--ASLQGCESDQVQSIIRYD 178
           I      A   G   D+V +II+ +
Sbjct: 138 IIQQKLIAESTGSGDDRVITIIQPE 162


>gi|126175861|ref|YP_001052010.1| OstA family protein [Shewanella baltica OS155]
 gi|152999227|ref|YP_001364908.1| cell envelope biogenesis YhbN [Shewanella baltica OS185]
 gi|160873840|ref|YP_001553156.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS195]
 gi|125999066|gb|ABN63141.1| OstA family protein [Shewanella baltica OS155]
 gi|151363845|gb|ABS06845.1| Cell envelope biogenesis YhbN [Shewanella baltica OS185]
 gi|160859362|gb|ABX47896.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS195]
 gi|315266067|gb|ADT92920.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS678]
          Length = 184

 Score = 53.9 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 51/145 (35%), Gaps = 17/145 (11%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            +++ IKA          +  F G V +TQ    + AD++      +    ++KI  +  
Sbjct: 27  KQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHADQLRAF---SAEGENSKI--LVA 81

Query: 102 ERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             N      +       +  A     D   R L L G    K  L +  +   G  +  N
Sbjct: 82  TGNPATYSQVLDDGRPASASAKEIRYDMASRTLTLKG----KASLDQAGSQVTGNLIRYN 137

Query: 156 IDTSF--ASLQGCESDQVQSIIRYD 178
           I      A   G   D+V +II+ +
Sbjct: 138 IIQQKLIAESTGSGDDRVITIIQPE 162


>gi|253689993|ref|YP_003019183.1| Organic solvent tolerance protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251756571|gb|ACT14647.1| Organic solvent tolerance protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 799

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 43/108 (39%), Gaps = 5/108 (4%)

Query: 39  VLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
              N+  ++I+AD  E       A F GNV + Q +  + A+++ ++  +     S    
Sbjct: 56  GDPNQLPVNIQADKTEANYPDS-AKFTGNVNIQQGNSVMTAEQVELNQLDPATQGSTPTR 114

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
            +    N+     ++ +     + +   +   V  GD   +++ ++  
Sbjct: 115 TITATGNVHYDDNQVILKGPKAWANLNTKDTDVYEGDY--QMVGRQGR 160


>gi|298370561|ref|ZP_06981876.1| organic solvent tolerance protein [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281171|gb|EFI22661.1| organic solvent tolerance protein [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 804

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 44/131 (33%), Gaps = 14/131 (10%)

Query: 53  EVKDAVQKAF-FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE 111
           E   A  +A    GN      +  L AD   +  +         +     E ++ I+  +
Sbjct: 68  ETVQAEARALGLTGNPVRRSGEDPLPADYTRVTADQIQGKTKVAVR---AEGDVIIERND 124

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID--TSFA---SLQG- 165
             + A     D     +       +K  L +  +T  G K+  N+   T  +    +   
Sbjct: 125 EILNAQWADYDQAANTVT----AGNKFKLAQNGSTVSGNKITYNLTDSTGTSDYVRVDAE 180

Query: 166 CESDQVQSIIR 176
            E  ++QS+ R
Sbjct: 181 QEGRRLQSVSR 191


>gi|238793709|ref|ZP_04637331.1| hypothetical protein yinte0001_860 [Yersinia intermedia ATCC 29909]
 gi|238726950|gb|EEQ18482.1| hypothetical protein yinte0001_860 [Yersinia intermedia ATCC 29909]
          Length = 171

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/166 (10%), Positives = 54/166 (32%), Gaps = 19/166 (11%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L + L  A+   +       ++ + + +    +        F  NV + Q    ++ADK
Sbjct: 1   MLASSLLTASLPAL-ALTGDTDQPVTVDSVKQALDMEANTVTFTDNVVIKQGTIEIKADK 59

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVLNG 132
           + +     ++       +M +E      +          +         +     +VL G
Sbjct: 60  VVVTRPGGDQS------KMVIEGYGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTG 113

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L++  +   G ++   +          + ++V +++   
Sbjct: 114 NAY----LEQLDSNIKGDRITYLVKKQQMEAFSDKGNRVTTVLLPS 155


>gi|209693974|ref|YP_002261902.1| organic solvent tolerance protein [Aliivibrio salmonicida LFI1238]
 gi|208007925|emb|CAQ78056.1| organic solvent tolerance protein precursor [Aliivibrio salmonicida
           LFI1238]
          Length = 784

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 51/143 (35%), Gaps = 27/143 (18%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            + + I+AD +E  +   KA +KGNV + +    ++AD +T+            I     
Sbjct: 62  QQPVLIQADSVEAHN-NSKATYKGNVHVIKGRQEIKADNITLH-------QQENIA--IA 111

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           E N+   S ++   +     D       +         +  +       ++   + T  A
Sbjct: 112 EGNVDYSSMDMRSTSDKVTTDLNTEDTTMINTSYK---MSCQPIRGTASRV---LKTGQA 165

Query: 162 --SLQ---------GCESDQVQS 173
              L+         G +S +V++
Sbjct: 166 IYQLEDASFTTCPAGDKSWRVKA 188


>gi|330958012|gb|EGH58272.1| OstA-like protein [Pseudomonas syringae pv. maculicola str.
          ES4326]
          Length = 173

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 19 FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
           + L A L  A+A  +       ++ IHI++D  ++ D    A ++GNV +TQ    +  
Sbjct: 1  MLGLGAALGSASAWSLPT---DRDQPIHIQSDDAQLDDKKGVATYRGNVVITQGSMKVTG 57

Query: 79 DKMTIDYNNTN 89
          + +TI  N   
Sbjct: 58 NTVTITRNAQG 68


>gi|327392690|dbj|BAK10112.1| organic solvent tolerance protein precursor Lmp [Pantoea ananatis
           AJ13355]
          Length = 805

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 46/118 (38%), Gaps = 8/118 (6%)

Query: 37  FKVLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                N+  + I +D L+       A F G+V + Q +  + AD++ +         +  
Sbjct: 54  VNGDPNQLPVTIHSDSLKGNYPDD-AVFTGDVDVQQGNSRMLADEVQLHQRQPE-GQTVP 111

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTFLGCKL 152
           +  +D   N+     ++ +     + +   +   V NGD   +++ ++      G ++
Sbjct: 112 VRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWNGDY--QMVGRQGRG--TGDQM 165


>gi|291616239|ref|YP_003518981.1| Imp [Pantoea ananatis LMG 20103]
 gi|291151269|gb|ADD75853.1| Imp [Pantoea ananatis LMG 20103]
          Length = 802

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 46/118 (38%), Gaps = 8/118 (6%)

Query: 37  FKVLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                N+  + I +D L+       A F G+V + Q +  + AD++ +         +  
Sbjct: 54  VNGDPNQLPVTIHSDSLKGNYPDD-AVFTGDVDVQQGNSRMLADEVQLHQRQPE-GQTVP 111

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTFLGCKL 152
           +  +D   N+     ++ +     + +   +   V NGD   +++ ++      G ++
Sbjct: 112 VRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWNGDY--QMVGRQGRG--TGDQM 165


>gi|238897973|ref|YP_002923653.1| organic solvent tolerance [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465731|gb|ACQ67505.1| organic solvent tolerance [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 780

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           +  I+I+++     D      F GNV + Q + +L A+KMT++   +   + N +     
Sbjct: 48  DLPIYIQSNQTSA-DYPGTIIFSGNVTVKQGNSTLNANKMTLNKTQSPNSLHNPVRTTVA 106

Query: 102 ERNIFIQSGEINVIASNGYVDFQKR 126
             ++     EI +  +    +   +
Sbjct: 107 TGDVQYFDPEIKLEGTQARSNIDTK 131


>gi|86153470|ref|ZP_01071674.1| OstA family protein [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|85843196|gb|EAQ60407.1| OstA family protein [Campylobacter jejuni subsp. jejuni HB93-13]
          Length = 153

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 47/131 (35%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   + +  +  + +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKPIRYEAMQ-NASFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 138 SKDQKPARFVF 148


>gi|293390770|ref|ZP_06635104.1| organic solvent tolerance protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951304|gb|EFE01423.1| organic solvent tolerance protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 780

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 48/120 (40%), Gaps = 12/120 (10%)

Query: 14  LLALVFVLLKADLSQ---AAASYMTRFKVLGN---EKIHIKADMLEVKDAVQKAFFKGNV 67
           L AL      ADL+Q   +   + T   V G+   + ++I+AD  E+      A ++GNV
Sbjct: 14  LTALYTADSAADLNQQCLSGVPHFTGEVVSGDPNDQPVYIEADKAEINQP-SSAIYQGNV 72

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDFQKR 126
            + Q +  L++  + +            + R    R  F       N++ S+  +    +
Sbjct: 73  DIKQGNRHLKSAAVEV----QQSGEGGNVQRYAFARGGFDYRDNQINLLGSDAKIHLNSK 128


>gi|308185632|ref|YP_003929763.1| LPS-assembly protein precursor [Pantoea vagans C9-1]
 gi|308056142|gb|ADO08314.1| LPS-assembly protein precursor [Pantoea vagans C9-1]
          Length = 765

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 43/117 (36%), Gaps = 4/117 (3%)

Query: 37  FKVLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                N+  + I +D  +       A F GNV + Q +  +QAD++ +         +  
Sbjct: 16  VNGDTNQLPVTIHSDAAKGNYPND-AVFTGNVNIEQGNSRMQADEVQLHQRQQEGQTA-P 73

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           +  +D   N+     ++ +     + +   +      +   +++ ++   T    KL
Sbjct: 74  VRTVDALGNVHYDDNQVILKGPKAWSNLNSKD-TNVWNGQYQMVDRQGRGTADQMKL 129


>gi|329298199|ref|ZP_08255535.1| lipopolysaccharide transport periplasmic protein LptA [Plautia
           stali symbiont]
          Length = 172

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 62/167 (37%), Gaps = 17/167 (10%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            +L+ A L+ +  +         N+ ++I +    +      A F GNV +TQ    + A
Sbjct: 1   MLLVSALLATSLPAL--ALTGDSNKPVNIDSVKQALDLQGNVATFTGNVIVTQGTIKITA 58

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNG 132
           DK+ +         S+KI  +D   N      +      +   A+  + +     + L G
Sbjct: 59  DKVVVT---RPGGDSHKII-VDAYGNPATFYQMQDNGKPVQGHAAKLHYELANDFVELTG 114

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASL-QGCESDQVQSIIRYD 178
           +      ++++ +   G ++   +           +S +V +++   
Sbjct: 115 NA----FIEQQDSNIKGDRITYLVKEQKMQAYSQGQSKRVTTVLVPS 157


>gi|168234848|ref|ZP_02659906.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736733|ref|YP_002113110.1| organic solvent tolerance protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194712235|gb|ACF91456.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197291737|gb|EDY31087.1| LPS-assembly protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 784

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 42/105 (40%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +            +  +D
Sbjct: 48  NDLPVTINADNAKGNYPDD-AVFTGNVDIMQGNSRLQADEVQLH-QKQAEGQPEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
           V  N+     ++ +    G+ +   +   V  GD   +++ ++  
Sbjct: 106 VLGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|238785094|ref|ZP_04629089.1| hypothetical protein yberc0001_150 [Yersinia bercovieri ATCC 43970]
 gi|238713986|gb|EEQ06003.1| hypothetical protein yberc0001_150 [Yersinia bercovieri ATCC 43970]
          Length = 165

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 47/149 (31%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ +++ +    +        F  NV + Q    ++ADK+ +       D S  
Sbjct: 9   ALTGDTDQPVNVVSGKQALDMQANTVTFTDNVIIKQGTIEIKADKVVV--TRPGGDQSKM 66

Query: 96  INRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           +  ++   N             +         +     +VL G+      L++  +   G
Sbjct: 67  V--IEGFGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDSNIKG 120

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   +          + ++V +++   
Sbjct: 121 DRITYLVKKQHMEAFSDKGNRVTTVLLPS 149


>gi|71734892|ref|YP_276271.1| OstA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257483490|ref|ZP_05637531.1| OstA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|298488493|ref|ZP_07006523.1| Protein yhbN precursor [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|71555445|gb|AAZ34656.1| OstA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298156834|gb|EFH97924.1| Protein yhbN precursor [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320322491|gb|EFW78584.1| OstA family protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|330869983|gb|EGH04692.1| OstA family protein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330987093|gb|EGH85196.1| OstA family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 182

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 57/155 (36%), Gaps = 14/155 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSN 94
                 ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N     DV  
Sbjct: 24  SLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRNAQGEVDVFT 83

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
            +  +            I    +     +  +  ++  D+A   ++ +  NT  G K++ 
Sbjct: 84  SVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLIDKAK--VINDG-NTSEGEKIVY 140

Query: 155 N---------IDTSFASLQGCESDQVQSIIRYDGR 180
           +              A +      ++  +I+   +
Sbjct: 141 DTVRQVVSAGRANGGAKVTTPR-PRIDMVIQPKKK 174


>gi|28871586|ref|NP_794205.1| ostA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213966610|ref|ZP_03394761.1| ostA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301383119|ref|ZP_07231537.1| ostA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|28854838|gb|AAO57900.1| ostA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213928460|gb|EEB62004.1| ostA family protein [Pseudomonas syringae pv. tomato T1]
          Length = 182

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 56/151 (37%), Gaps = 14/151 (9%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSNKINR 98
             ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N     DV   +  
Sbjct: 28  DRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRNAQGEVDVFTSVGN 87

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN--- 155
           +            I    +     +  +  ++  D+A  V   +  NT  G K++ +   
Sbjct: 88  LAYYEQKPAVDKPIVQAYAITIQYYAGQDRIVLIDKAKVV--NDG-NTSEGEKIVYDTVR 144

Query: 156 ------IDTSFASLQGCESDQVQSIIRYDGR 180
                      A +      ++  +I+   +
Sbjct: 145 QVVSAGRANGGAKVTTPR-PRIDMVIQPKKK 174


>gi|307132629|ref|YP_003884645.1| exported protein required for envelope biosynthesis and integrity
           [Dickeya dadantii 3937]
 gi|306530158|gb|ADN00089.1| exported protein required for envelope biosynthesis and integrity
           [Dickeya dadantii 3937]
          Length = 791

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 42/111 (37%), Gaps = 18/111 (16%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            +HIKAD  +       A F GNV + Q +  L AD++ +         ++ I  +    
Sbjct: 50  PVHIKADQSQANYPDS-AVFTGNVNVEQGNRVLTADQVQLH-QKQQPGQADPIRTVTAIG 107

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
           N               + D  +  ++L G RA   +  +  +   G  L+V
Sbjct: 108 N--------------AHYDDNQ--VILKGPRAWSNLNTKDTDVENGDYLMV 142


>gi|238893027|ref|YP_002917761.1| organic solvent tolerance protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238545343|dbj|BAH61694.1| organic solvent tolerance protein precursor [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 782

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 43/108 (39%), Gaps = 5/108 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G+  + I AD  +       A F GNV + Q +  L+AD++ +         +  +  +D
Sbjct: 48  GDLPVTINADHAKGNYPDN-AVFTGNVDINQGNSRLRADEVQLH-QQQAAGQAQPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTF 147
              N+     ++ +     + +   +   V  GD   +++ ++   T 
Sbjct: 106 ALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDY--QMVGRQGRGTA 151


>gi|66047372|ref|YP_237213.1| OstA-like protein [Pseudomonas syringae pv. syringae B728a]
 gi|63258079|gb|AAY39175.1| OstA-like protein [Pseudomonas syringae pv. syringae B728a]
          Length = 182

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 57/155 (36%), Gaps = 14/155 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDVSN 94
                 ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N     DV  
Sbjct: 24  SLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRNAQGEVDVFT 83

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
            +  +            I    +     +  +  ++  D+A   ++ +  NT  G K++ 
Sbjct: 84  SVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLIDKAK--VINDG-NTSEGEKIVY 140

Query: 155 N---------IDTSFASLQGCESDQVQSIIRYDGR 180
           +              A +      ++  +I+   +
Sbjct: 141 DTVRQVVTAGRANGGAKVTTPR-PRIDMVIQPKKK 174


>gi|317493317|ref|ZP_07951739.1| organic solvent tolerance protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918710|gb|EFV40047.1| organic solvent tolerance protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 800

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 49/124 (39%), Gaps = 14/124 (11%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  +HI+AD  +       A F GNV + Q + +L AD++ +D     +D  + +  + 
Sbjct: 55  NDLPVHIQADKSDANYPDN-AVFSGNVNIEQGNSTLTADQVQLD-QKFLKDKPDPLRTVT 112

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG--CKLIVNIDT 158
              N+     ++ +   N + +          ++   V   +    F+G   +   ++  
Sbjct: 113 ATGNVNYSDNQVKLKGPNAWSNLN--------NKDTNV--WQGDYQFVGRQGRGTADLMK 162

Query: 159 SFAS 162
           + A 
Sbjct: 163 TRAE 166


>gi|262044913|ref|ZP_06017955.1| LPS-assembly protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259037640|gb|EEW38869.1| LPS-assembly protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 782

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 43/108 (39%), Gaps = 5/108 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G+  + I AD  +       A F GNV + Q +  L+AD++ +         +  +  +D
Sbjct: 48  GDLPVTINADHAKGNYPDN-AVFTGNVDINQGNSRLRADEVQLH-QQQAAGQAQPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTF 147
              N+     ++ +     + +   +   V  GD   +++ ++   T 
Sbjct: 106 ALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDY--QMVGRQGRGTA 151


>gi|152968632|ref|YP_001333741.1| organic solvent tolerance protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|330009277|ref|ZP_08306493.1| organic solvent tolerance protein [Klebsiella sp. MS 92-3]
 gi|150953481|gb|ABR75511.1| organic solvent tolerance protein precursor [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238774062|dbj|BAH66558.1| organic solvent tolerance protein precursor [Klebsiella pneumoniae]
 gi|328534854|gb|EGF61396.1| organic solvent tolerance protein [Klebsiella sp. MS 92-3]
          Length = 782

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 43/108 (39%), Gaps = 5/108 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G+  + I AD  +       A F GNV + Q +  L+AD++ +         +  +  +D
Sbjct: 48  GDLPVTINADHAKGNYPDN-AVFTGNVDINQGNSRLRADEVQLH-QQQAAGQAQPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKLNTF 147
              N+     ++ +     + +   +   V  GD   +++ ++   T 
Sbjct: 106 ALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDY--QMVGRQGRGTA 151


>gi|146310267|ref|YP_001175341.1| organic solvent tolerance protein [Enterobacter sp. 638]
 gi|145317143|gb|ABP59290.1| Organic solvent tolerance protein [Enterobacter sp. 638]
          Length = 781

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +         +  +  +D
Sbjct: 48  NSLPVTITADNAKGNYPDN-ATFTGNVDINQGNSRLQADEVQLH-QKQPEGAAAPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +     + +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKAWSNLNTKDTNVWEGDY--QMVGRQGR 148


>gi|54293812|ref|YP_126227.1| hypothetical protein lpl0868 [Legionella pneumophila str. Lens]
 gi|53753644|emb|CAH15102.1| hypothetical protein lpl0868 [Legionella pneumophila str. Lens]
          Length = 169

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 48/142 (33%), Gaps = 11/142 (7%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI--NRMDVE 102
           + + +D  ++     +  + GNV   Q   +L+A+K  I   +    ++  I     D +
Sbjct: 32  VQVVSDSADLNQKNHQGVYIGNVEFVQGSTNLRAEK-AITQGDAKNQLTLAIAEGSKDKQ 90

Query: 103 RNIFIQSGEIN----VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
            + +  +          A        K ++ L G+   +    +  N+    K+  +   
Sbjct: 91  AHYWTTTAPDKPPFHAYADTIKYYPLKHLIELIGNARIE----QGPNSLSAAKISYDTQE 146

Query: 159 SFASLQGCESDQVQSIIRYDGR 180
                   E  +   II  + +
Sbjct: 147 QHVLSHSDEKTRTTIIIYPEKK 168


>gi|261338951|ref|ZP_05966809.1| hypothetical protein ENTCAN_05152 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318778|gb|EFC57716.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Enterobacter cancerogenus ATCC 35316]
          Length = 783

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 41/105 (39%), Gaps = 5/105 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F GNV + Q +  LQAD++ +         +  +  +D
Sbjct: 48  NSLPVTITADSSKGNYPDN-ATFTGNVDINQGNSRLQADEVQLH-QKQPDGAAEPVRTVD 105

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGDRADKVILKEKL 144
              N+     ++ +     + +   +   V  GD   +++ ++  
Sbjct: 106 ALGNVHYDDNQVILKGPKAWSNLNTKDTNVWEGDY--QMVGRQGR 148


>gi|302036696|ref|YP_003797018.1| hypothetical protein NIDE1342 [Candidatus Nitrospira defluvii]
 gi|300604760|emb|CBK41092.1| conserved protein of unknown function [Candidatus Nitrospira
           defluvii]
          Length = 156

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/154 (12%), Positives = 49/154 (31%), Gaps = 36/154 (23%)

Query: 52  LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK---------------- 95
           + V +    A F G V +T+    + +D M + ++       +K                
Sbjct: 1   MTVSNQANTAIFDGAVVLTRGLLVVHSDHMVVSFHPNRNGADSKNANGATKPKNNSSASK 60

Query: 96  ----------------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
                           I  ++    + I+  +             ++ ++L GD     +
Sbjct: 61  PEPQGLDAAPAVSERSIRMVEATGRVRIEKEDGRATCQKAVYYEDEKKIILTGDP----V 116

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
             +K     G ++I+ +D   + ++G     ++ 
Sbjct: 117 AWQKGTRVSGKRIIMFLDEDRSVVEGDSQVVIEG 150


>gi|238918642|ref|YP_002932156.1| organic solvent tolerance protein [Edwardsiella ictaluri 93-146]
 gi|238868210|gb|ACR67921.1| Organic solvent tolerance protein, putative [Edwardsiella ictaluri
           93-146]
          Length = 795

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 36/86 (41%), Gaps = 2/86 (2%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  +HI AD  E       A F GNV + Q + +L ADK+ +D     +   N +  + 
Sbjct: 55  NSLPVHITADQSEANYPNN-ALFHGNVDIQQGNSTLTADKVQLD-QKAIQGQPNPLRTVT 112

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR 126
              N+     +I +   + + +   +
Sbjct: 113 AIGNVHYADSQIRLQGPSAWSNLNNK 138


>gi|238751360|ref|ZP_04612853.1| hypothetical protein yrohd0001_15460 [Yersinia rohdei ATCC 43380]
 gi|238710418|gb|EEQ02643.1| hypothetical protein yrohd0001_15460 [Yersinia rohdei ATCC 43380]
          Length = 161

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/149 (10%), Positives = 46/149 (30%), Gaps = 14/149 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ + + +    +  A     F  NV + Q    ++ADK+ +    T       
Sbjct: 5   ALTGDSDQPVLVDSVKQALDMAANTVTFTDNVVIKQGTIEIKADKVVV----TRPGGDQN 60

Query: 96  INRMDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              ++   N             +         +    +++L GD      L++  +   G
Sbjct: 61  KMVIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEVANDLVILTGDAY----LEQLDSNIKG 116

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            ++   +          + ++V +++   
Sbjct: 117 DRITYLVKKQQMEAFSNKGNRVTTVLLPS 145


>gi|330877184|gb|EGH11333.1| ostA family protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 173

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 62/177 (35%), Gaps = 27/177 (15%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            + L A L  A+A  +       ++ IHI++D  ++ D    A ++GNV +TQ    +  
Sbjct: 1   MLGLSAALGSASAWSLPN---DRDQPIHIQSDDAQLDDKKGVATYRGNVIITQGSMKVTG 57

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +TI      R+   +++      N  +   E         V      +     +   V
Sbjct: 58  NTVTIT-----RNAQGEVDVFTSVGN--LAYYEQKPAPDKPIVQAYAVTIQYYAGQDRIV 110

Query: 139 ------ILKEKLNTFLGCKLIVN---------IDTSFASLQGCESDQVQSIIRYDGR 180
                 ++ +  NT  G K++ +                L      ++  +I+   +
Sbjct: 111 LIDKAKVINDG-NTSEGEKIVYDTVRQVVSAGRANGGTKLTAPR-PRIDMVIQPKNK 165


>gi|262166554|ref|ZP_06034291.1| LptA protein [Vibrio mimicus VM223]
 gi|262026270|gb|EEY44938.1| LptA protein [Vibrio mimicus VM223]
          Length = 126

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 47/127 (37%), Gaps = 14/127 (11%)

Query: 57  AVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS------G 110
              +  F G+V + Q   ++ ADK+ +  N      + KI  ++   N+   S       
Sbjct: 2   KSNRVTFLGDVKLKQGSININADKLIVIRNAN----NGKIEEIEGYGNVATFSQLTDEGK 57

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
            +   A   Y   +   LV+     +K +L +  +   G K+   I +           +
Sbjct: 58  TLYGEAKELYYKVRDDELVM----INKAMLSQDDSEIRGSKIRYKISSQKLIADSDGKGR 113

Query: 171 VQSIIRY 177
           V ++++ 
Sbjct: 114 VSTVLQP 120


>gi|261344901|ref|ZP_05972545.1| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rustigianii DSM 4541]
 gi|282567041|gb|EFB72576.1| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rustigianii DSM 4541]
          Length = 185

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 52/150 (34%), Gaps = 18/150 (12%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + + I +    +        F  +V + Q    ++A+K+ +         S+ 
Sbjct: 27  ALKTDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRANKVVVT------RPSSD 80

Query: 96  INRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
            +++ +E      +          I   AS    +  ++++ L GD      L++  +  
Sbjct: 81  SDKIVIEAFGTPVTFFQLQDDGKPIKGHASKARYEVDQQLVTLTGDAY----LEQLDSNI 136

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            G K+   + T        +  +V +++  
Sbjct: 137 KGDKITYVVPTQKMEAFSDKGKRVTTVLLP 166


>gi|117919126|ref|YP_868318.1| OstA family protein [Shewanella sp. ANA-3]
 gi|117611458|gb|ABK46912.1| OstA family protein [Shewanella sp. ANA-3]
          Length = 183

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 57/157 (36%), Gaps = 19/157 (12%)

Query: 32  SYMTRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           + M+ F  +G+  +++ IKA          +  F G V +TQ    + AD++      + 
Sbjct: 15  TSMSAFAKVGDLQQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHADQLRAF---SA 71

Query: 90  RDVSNKINRMDVERN------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
              ++KI  +    N      I       +  A     +   R L L G       L + 
Sbjct: 72  EGENSKI--LVATGNPATYSQILDDGRPASASAKEIRYEMATRTLTLTGSAT----LDQA 125

Query: 144 LNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
            +   G  +  +I      A   G   D+V +II+ D
Sbjct: 126 GSQVTGNLIRYDIIQQKLIAESTGSGDDRVITIIQPD 162


>gi|237748918|ref|ZP_04579398.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes OXCC13]
 gi|229380280|gb|EEO30371.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes OXCC13]
          Length = 184

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 63/182 (34%), Gaps = 28/182 (15%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             +LA    L    L++         +   N+  +I+AD + V D  Q   F GNV +T+
Sbjct: 9   FLILAFCIGLSFPALAE---------RADANKPTNIEADQMTVDDVKQVTTFTGNVIVTK 59

Query: 72  EDFSLQADKMTID-----------YNNTNRDVSNKINRMDVERNIFIQSGEINVIASN-- 118
               ++A K  I            Y    +  S +  ++D   N++++     +   N  
Sbjct: 60  GTLLIKAAKAVIVQDPEGYQYVTLYAAPGKLASMR-QKLDGGPNLWMEGYGEKIEYDNKH 118

Query: 119 --GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS-LQGCESDQVQSII 175
                    R+  + G      ++          K       + +  +    + +V+++I
Sbjct: 119 EVAKFYTHARVKRMEGSVVTDDLM--GEFIAYDGKSESYRANNTSQGVSKPGAGRVKAVI 176

Query: 176 RY 177
           + 
Sbjct: 177 QP 178


>gi|307311492|ref|ZP_07591134.1| Organic solvent tolerance protein [Escherichia coli W]
 gi|306908471|gb|EFN38969.1| Organic solvent tolerance protein [Escherichia coli W]
 gi|315059280|gb|ADT73607.1| exported protein required for envelope biosynthesis and integrity
           [Escherichia coli W]
 gi|323380163|gb|ADX52431.1| Organic solvent tolerance protein [Escherichia coli KO11]
          Length = 784

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWKGDY--QMVGRQGR 148


>gi|145220481|ref|YP_001131190.1| hypothetical protein Cvib_1678 [Prosthecochloris vibrioformis DSM
           265]
 gi|145206645|gb|ABP37688.1| conserved hypothetical protein [Chlorobium phaeovibrioides DSM 265]
          Length = 322

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 19/137 (13%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEV-KDAVQ--K 60
            L S  L    L L+ + L     Q             ++ I   ADM+E  +DAV   +
Sbjct: 3   RLFSPILLAAGLTLLQLALTPPGGQ------NTLHAENSKIILRHADMIEGGEDAVGPYR 56

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           A   GNV M + + ++   + T DY+          NR+ +  ++ I  G + V   +G 
Sbjct: 57  AA-IGNVEMLKGELTMTCRRTT-DYDGQ--------NRIIMNGDVSISDGSMEVFGDDGV 106

Query: 121 VDFQKRILVLNGDRADK 137
               + +L L+G+   +
Sbjct: 107 FYTDREVLELSGNVRGR 123


>gi|307609629|emb|CBW99133.1| hypothetical protein LPW_09181 [Legionella pneumophila 130b]
          Length = 155

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 48/142 (33%), Gaps = 11/142 (7%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI--NRMDVE 102
           + + +D  ++     +  + GNV   Q   +L+A+K  I   +    ++  I     D +
Sbjct: 18  VQVVSDSADLNQKNHQGVYIGNVEFVQGSTNLRAEK-AITQGDAKNQLTLAIAEGSKDKQ 76

Query: 103 RNIFIQSGEIN----VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
            + +  +          A        K ++ L G+   +    +  N+    K+  +   
Sbjct: 77  AHYWTTTAPDKPPFHAYADTIKYYPLKHLIELIGNARIE----QGPNSLSAAKISYDTQE 132

Query: 159 SFASLQGCESDQVQSIIRYDGR 180
                   E  +   II  + +
Sbjct: 133 QHVLSHSDEKTRTTIIIYPEKK 154


>gi|315926767|gb|EFV06141.1| ostA-like family protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315928940|gb|EFV08194.1| ostA-like family protein [Campylobacter jejuni subsp. jejuni 305]
 gi|315931847|gb|EFV10802.1| ostA-like family protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 145

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 47/131 (35%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   + +  +  + +    
Sbjct: 13  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKPIRYEAMQ-NARFK 71

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 72  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 129

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 130 SKDQKPARFVF 140


>gi|238796185|ref|ZP_04639695.1| OstA family protein [Yersinia mollaretii ATCC 43969]
 gi|238719878|gb|EEQ11684.1| OstA family protein [Yersinia mollaretii ATCC 43969]
          Length = 171

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/154 (11%), Positives = 50/154 (32%), Gaps = 20/154 (12%)

Query: 35  TRFKVLGN--EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
             F + G+  + + + +    +        F  NV + Q    ++ADK+ +     ++  
Sbjct: 12  PAFALTGDTEQPVKVDSAKQALDMEANTITFTDNVIIKQGTIEIKADKVVVTRPGGDQS- 70

Query: 93  SNKINRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                +M +E      +          +         +     +VL G+      L++  
Sbjct: 71  -----KMVIEGYGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLD 121

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +   G ++   +          + ++V +++   
Sbjct: 122 SNIKGDRITYLVKKQQMEAFSDKGNRVTTVLLPS 155


>gi|163802668|ref|ZP_02196559.1| organic solvent tolerance protein [Vibrio sp. AND4]
 gi|159173556|gb|EDP58376.1| organic solvent tolerance protein [Vibrio sp. AND4]
          Length = 781

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 49/132 (37%), Gaps = 17/132 (12%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           N  + ++AD L+  +  + A + GNV +TQ    + AD +T+           + N +  
Sbjct: 53  NSPVVVQADSLQAINGDK-AQYSGNVEVTQGPKKITADNVTLH---------QQENVVVA 102

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT----FLGCKLIVNID 157
           E N+    G++   +     +  +    L  +   + + ++   T        + +  ++
Sbjct: 103 EGNVNFNDGKVKARSDRVTNNINEDTFSLE-NTNYQFLCQQGRGTAAYIARTGQSVYELE 161

Query: 158 TSFASLQGCESD 169
                +  C   
Sbjct: 162 DGT--ITSCPQG 171


>gi|57236962|ref|YP_178763.1| OstA family protein [Campylobacter jejuni RM1221]
 gi|148926633|ref|ZP_01810314.1| hypothetical protein Cj8486_0661 [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|205355499|ref|ZP_03222270.1| hypothetical protein Cj8421_0651 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|57165766|gb|AAW34545.1| OstA family protein [Campylobacter jejuni RM1221]
 gi|145845152|gb|EDK22247.1| hypothetical protein Cj8486_0661 [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|205346733|gb|EDZ33365.1| hypothetical protein Cj8421_0651 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|315058063|gb|ADT72392.1| OstA family organic solvent tolerance protein [Campylobacter jejuni
           subsp. jejuni S3]
          Length = 153

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 47/131 (35%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   + +  +  + +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKPIRYEAMQ-NARFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 138 SKDQKPARFVF 148


>gi|86149888|ref|ZP_01068117.1| OstA family protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151578|ref|ZP_01069792.1| OstA family protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|88596952|ref|ZP_01100188.1| OstA family protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613362|ref|YP_001000350.1| OstA family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|157414928|ref|YP_001482184.1| OstA family protein [Campylobacter jejuni subsp. jejuni 81116]
 gi|167005295|ref|ZP_02271053.1| hypothetical protein Cjejjejuni_03430 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|218562299|ref|YP_002344078.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|85839706|gb|EAQ56966.1| OstA family protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841207|gb|EAQ58455.1| OstA family protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|87250491|gb|EAQ73449.1| OstA family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88190641|gb|EAQ94614.1| OstA family protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360005|emb|CAL34794.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|157385892|gb|ABV52207.1| hypothetical protein C8J_0608 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|284925909|gb|ADC28261.1| OstA family protein [Campylobacter jejuni subsp. jejuni IA3902]
 gi|307747566|gb|ADN90836.1| OstA family protein [Campylobacter jejuni subsp. jejuni M1]
          Length = 153

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 47/131 (35%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   + +  +  + +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKPIRYEAMQ-NARFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 138 SKDQKPARFVF 148


>gi|291280880|ref|YP_003497698.1| LPS-assembly protein precursor [Escherichia coli O55:H7 str.
           CB9615]
 gi|290760753|gb|ADD54714.1| LPS-assembly protein precursor [Escherichia coli O55:H7 str.
           CB9615]
 gi|320663491|gb|EFX30775.1| LPS assembly outer membrane complex protein LptD [Escherichia coli
           O55:H7 str. USDA 5905]
          Length = 782

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 51/147 (34%), Gaps = 16/147 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +       +    +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLHQAPGQPEP---VRTVDALGNVHYDDNQVILKGPK 121

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 122 GWANLNTKDTNVWEGDY--QMVGRQGR 146


>gi|330964013|gb|EGH64273.1| ostA family protein [Pseudomonas syringae pv. actinidiae str.
          M302091]
          Length = 155

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 19 FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
           + L A L  A+A  +       ++ IHI++D  ++ D    A +KGNV +TQ    +  
Sbjct: 1  MLGLSAALGSASAWSLPN---DRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITG 57

Query: 79 DKMTIDYNNTN 89
          + +TI  N   
Sbjct: 58 NTVTITRNAQG 68


>gi|212711082|ref|ZP_03319210.1| hypothetical protein PROVALCAL_02151 [Providencia alcalifaciens DSM
           30120]
 gi|212686250|gb|EEB45778.1| hypothetical protein PROVALCAL_02151 [Providencia alcalifaciens DSM
           30120]
          Length = 185

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/167 (13%), Positives = 58/167 (34%), Gaps = 20/167 (11%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
             +  A L+ +  +     K    + + I +    +        F  +V + Q    ++A
Sbjct: 12  GAVASAILALSLPAM--ALKTDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRA 69

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIFIQS--------GEINVIASNGYVDFQKRILVL 130
           +K+ +         S+  +++ +E      +          I   AS    +  K+++ L
Sbjct: 70  NKVIVT------RPSSDSDKIVIEAFGTPVTFYQLQDDGKPIKGHASKARYEVDKQLVTL 123

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            GD      L++  +   G K+   + T        +  +V +++  
Sbjct: 124 TGDAY----LEQLDSNIKGDKITYVVPTQQMEAFSDKGKRVTTVLLP 166


>gi|123443940|ref|YP_001007911.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|332163085|ref|YP_004299662.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|122090901|emb|CAL13783.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604035|emb|CBY25533.1| lpta, protein essential for LPS transport across the periplasm
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667315|gb|ADZ43959.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862759|emb|CBX72901.1| lipopolysaccharide export system protein lptA [Yersinia
           enterocolitica W22703]
          Length = 181

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/146 (10%), Positives = 45/146 (30%), Gaps = 14/146 (9%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
              ++ + + +    +        F  NV + Q    ++ADK+ +       D S  +  
Sbjct: 28  GDTDQPVLVDSVKQALDMGANTVTFTDNVVIKQGTIEIKADKVVV--TRPGGDQSKMV-- 83

Query: 99  MDVERNIF------IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           ++   N             +         +     +VL G+      L++  +   G ++
Sbjct: 84  IEGFGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDSNIKGDRI 139

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYD 178
              +          +  +V +++   
Sbjct: 140 TYLVKKQQMEAFSDKGKRVTTVLLPS 165


>gi|118579590|ref|YP_900840.1| organic solvent tolerance protein [Pelobacter propionicus DSM 2379]
 gi|118502300|gb|ABK98782.1| Organic solvent tolerance protein [Pelobacter propionicus DSM 2379]
          Length = 686

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 41/121 (33%), Gaps = 15/121 (12%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I I+AD +    A       GNV M     ++ A + T  YN   R        +    +
Sbjct: 26  ITIRADAMTHNQADDSVSADGNVRMEWGGMTMTARRAT--YNRETRI-------LTAYED 76

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI-LKEKLNTFLGCKLIVNIDTSFASL 163
           + I  GE  +       D         G+    V  + +   T  G +++ N D    +L
Sbjct: 77  VVITKGEDTLRGDKATWDMASG----RGELNHAVAGVADSNMTLTGDRIVRN-DDGTLTL 131

Query: 164 Q 164
            
Sbjct: 132 S 132


>gi|262401816|ref|ZP_06078381.1| LptA protein [Vibrio sp. RC586]
 gi|262351788|gb|EEZ00919.1| LptA protein [Vibrio sp. RC586]
          Length = 126

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 47/127 (37%), Gaps = 14/127 (11%)

Query: 57  AVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS------G 110
              +  F G+V + Q   ++ ADK+ +  N      + KI  ++   N+   S       
Sbjct: 2   KSNRVTFLGDVKLKQGSININADKLIVIRNAD----NGKIEEIEGYGNVATFSQLTDEGK 57

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
            +   A   Y   +   LV+     +K +L +  +   G K+   I +           +
Sbjct: 58  TLYGEAKELYYKVRDDELVM----INKAMLSQDDSEIRGSKIRYKISSQKLIADSEGKGR 113

Query: 171 VQSIIRY 177
           V ++++ 
Sbjct: 114 VSTVLQP 120


>gi|170768414|ref|ZP_02902867.1| LPS-assembly protein [Escherichia albertii TW07627]
 gi|170122518|gb|EDS91449.1| LPS-assembly protein [Escherichia albertii TW07627]
          Length = 774

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 37/94 (39%), Gaps = 3/94 (3%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +  + I AD  +       A F G+V + Q +  LQAD++ +         +  +  +D
Sbjct: 37  NDLPVTINADHAKGNYPDD-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQAEPVRTVD 94

Query: 101 VERNIFIQSGEINVIASNGYVDFQKR-ILVLNGD 133
              N+     ++ +    G+ +   +   V  GD
Sbjct: 95  ALGNVHYDDNQVILKGPKGWANLNTKDTNVWKGD 128


>gi|145297404|ref|YP_001140245.1| hypothetical protein ASA_0313 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850176|gb|ABO88497.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 175

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 55/138 (39%), Gaps = 6/138 (4%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT-NRDVSNKINRMDV 101
           EK+++ A     +    +  F  +V +TQ    ++ADK+ +  +     +V     +   
Sbjct: 26  EKVYVDAVRQVAEMQDNRITFSDDVIITQGTIKIKADKVVVIRSGDKGAEVMTAYGKPAT 85

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              I      +N   ++   + + R++ + G+      LK++ +   G  +  +I     
Sbjct: 86  FFQILDNGKPVNAHGNSIRYELKNRLVTITGNGQ----LKQEDSQVNGDLIRYDIVKQKM 141

Query: 162 SLQG-CESDQVQSIIRYD 178
             +    + +V+++   D
Sbjct: 142 IAESKGPTQRVKTVFLPD 159


>gi|254443754|ref|ZP_05057230.1| OstA-like protein [Verrucomicrobiae bacterium DG1235]
 gi|198258062|gb|EDY82370.1| OstA-like protein [Verrucomicrobiae bacterium DG1235]
          Length = 216

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 47/127 (37%), Gaps = 10/127 (7%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF--KGNVFMTQEDFSLQADKMTIDYN 86
           AA S   + K        I++  L+V++  + A+F     V +   + +++ D + +   
Sbjct: 15  AAVSSFAQIKEKPQIATEIESVRLQVENDGENAYFHFSEAVLLKATNMTVECDSLEVFAT 74

Query: 87  NTNRDVSN-----KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
               + SN      I  +    N+ I   E         V   +  +VL+G+    V+++
Sbjct: 75  REAEEQSNIGKFSAIKEIIASGNVRIVQAERTATCQKAVVKPNEERIVLSGN---PVVVQ 131

Query: 142 EKLNTFL 148
                  
Sbjct: 132 PGGRIVT 138


>gi|317401283|gb|EFV81923.1| exported protein [Achromobacter xylosoxidans C54]
          Length = 213

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 59/196 (30%), Gaps = 23/196 (11%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH-----IKADMLEVK 55
           M+ F   I     LL  V ++  A     AA                    I +D L   
Sbjct: 1   MTDFRIRIAPTTRLLGAVLLMASAVAPALAADPKPAAGASKTAPAEEPTTTILSDTLHYD 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE---- 111
           D  +++ F GNV MT+   +L +D + +  +               +  +     E    
Sbjct: 61  DVKKQSVFTGNVNMTRGLMTLTSDNLEMREDAAGNQYGTATAN---KGKVVTIRQERPEN 117

Query: 112 ---INVIASNGYVDFQKRILVLNGDRADKVILKEKL--NTFLGCKLIVNIDTSFASLQG- 165
              I         D  K    L G +A  V        +T  G ++  N  +     QG 
Sbjct: 118 FELIEGKGLRAEYDGTKSTFDLIG-QAVVVRYVCGKPFDTIRGDRVRYNEKSGTYEAQGG 176

Query: 166 ----CESDQVQSIIRY 177
                   +V+S+   
Sbjct: 177 PNSSAAGGRVRSVAEP 192


>gi|254673983|emb|CBA09767.1| hypothetical protein NMW_2210 [Neisseria meningitidis alpha275]
          Length = 119

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 25/62 (40%)

Query: 30 AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
          +AS     +    + I I+AD   +  A Q   F GNV + Q    + A ++ +      
Sbjct: 16 SASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLDISAARVNVTRGGKG 75

Query: 90 RD 91
           +
Sbjct: 76 GE 77


>gi|322514701|ref|ZP_08067728.1| LPS-assembly protein [Actinobacillus ureae ATCC 25976]
 gi|322119350|gb|EFX91463.1| LPS-assembly protein [Actinobacillus ureae ATCC 25976]
          Length = 776

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 45/123 (36%), Gaps = 11/123 (8%)

Query: 31  ASYMTRFKVLGNE---KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
             +    ++ G++    + I+AD   +      A + G+V + Q + S+ AD++ ++ N 
Sbjct: 33  VPHFQGEEIQGDQTLLPVEIEADSAVINQPKD-ATYTGDVAIKQGNRSILADEVRVEQNG 91

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                     R  ++     Q   I     +  +D       L  +   +++ ++   T 
Sbjct: 92  EQS------RRAFLKGKYQYQDNLIQAQGRDAAMDLSAETADLQ-NTEFQLVGRQGRGTA 144

Query: 148 LGC 150
              
Sbjct: 145 ESG 147


>gi|119477366|ref|ZP_01617557.1| possible OstA-like protein [marine gamma proteobacterium HTCC2143]
 gi|119449292|gb|EAW30531.1| possible OstA-like protein [marine gamma proteobacterium HTCC2143]
          Length = 182

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 59/161 (36%), Gaps = 21/161 (13%)

Query: 30  AASYMTRFKVLGNEKIHIKADM--LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
            +S++        + I+I++D   L+     +   + GNV MTQ    +  + +TI  NN
Sbjct: 16  VSSHVAALPDDNEKPINIQSDSASLKTLANGKTTEYFGNVQMTQGSLKITGEHITIYSNN 75

Query: 88  TNRDVSNKINRMDVERNIFI-------QSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
                  +I  +       I       +S  I   A       +  ++VL  +   K   
Sbjct: 76  ------REITSITATGTPAIFEQQPDSESSPIEAQAETLDYQLKDEVVVLLINACVK--- 126

Query: 141 KEKLNTFLGCKLIVNIDTS--FASLQGCESDQVQSIIRYDG 179
            +  +   G ++   I +    AS     S +V  I+  +G
Sbjct: 127 -QNGSVVTGGRIEYGIASEKIKASRGDTNSSRVNMILPPEG 166


>gi|333000024|gb|EGK19607.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-218]
 gi|333014562|gb|EGK33909.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-304]
          Length = 139

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 6/124 (4%)

Query: 57  AVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINV 114
                 F GNV +TQ    + ADK+ +        ++V +   +      +      +  
Sbjct: 2   QGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEG 61

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSI 174
            AS  + +  K  +VL G+      L++  +   G K+   +          +  +V ++
Sbjct: 62  HASQMHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTV 117

Query: 175 IRYD 178
           +   
Sbjct: 118 LVPS 121


>gi|238786687|ref|ZP_04630488.1| hypothetical protein yfred0001_16510 [Yersinia frederiksenii ATCC
           33641]
 gi|238725055|gb|EEQ16694.1| hypothetical protein yfred0001_16510 [Yersinia frederiksenii ATCC
           33641]
          Length = 757

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 37/101 (36%), Gaps = 3/101 (2%)

Query: 39  VLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
              N+  + I AD  E       A F GNV + Q + +L AD++ +         +  + 
Sbjct: 14  GDPNQLPVRINADKTEANYPDN-ALFTGNVIVQQGNSTLTADQVKLT-QVQKSGEAIPVR 71

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
            +    ++     +I +     + +   +   ++  +   V
Sbjct: 72  TVTATGDVNYDDPQIKLKGPTAWSNLNTKDTDMDKGKYQMV 112


>gi|332098897|gb|EGJ03848.1| LPS-assembly protein [Shigella boydii 3594-74]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|332098219|gb|EGJ03192.1| LPS-assembly protein [Shigella dysenteriae 155-74]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|324008402|gb|EGB77621.1| organic solvent tolerance protein [Escherichia coli MS 57-2]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|323160074|gb|EFZ46036.1| LPS-assembly protein [Escherichia coli E128010]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|320642096|gb|EFX11447.1| LPS assembly outer membrane complex protein LptD [Escherichia coli
           O157:H7 str. G5101]
 gi|320647459|gb|EFX16254.1| LPS assembly outer membrane complex protein LptD [Escherichia coli
           O157:H- str. 493-89]
 gi|320652793|gb|EFX21031.1| LPS assembly outer membrane complex protein LptD [Escherichia coli
           O157:H- str. H 2687]
 gi|320668803|gb|EFX35598.1| LPS assembly outer membrane complex protein LptD [Escherichia coli
           O157:H7 str. LSU-61]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|312966177|ref|ZP_07780403.1| LPS-assembly protein [Escherichia coli 2362-75]
 gi|312289420|gb|EFR17314.1| LPS-assembly protein [Escherichia coli 2362-75]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|331681440|ref|ZP_08382077.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Escherichia coli H299]
 gi|331081661|gb|EGI52822.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Escherichia coli H299]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|331671574|ref|ZP_08372372.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Escherichia coli TA280]
 gi|331071419|gb|EGI42776.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Escherichia coli TA280]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLLQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|331661425|ref|ZP_08362349.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Escherichia coli TA143]
 gi|331061340|gb|EGI33303.1| LPS-assembly protein (Organic solvent tolerance protein)
           [Escherichia coli TA143]
          Length = 789

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|300948658|ref|ZP_07162742.1| organic solvent tolerance protein [Escherichia coli MS 116-1]
 gi|300451884|gb|EFK15504.1| organic solvent tolerance protein [Escherichia coli MS 116-1]
 gi|323939724|gb|EGB35926.1| hypothetical protein ERDG_03581 [Escherichia coli E482]
          Length = 784

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 50/147 (34%), Gaps = 14/147 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRF---------KVLGNEKIHIKADMLEVKDAV 58
             L   ++A      +   +  A+  M                +  + I AD  +     
Sbjct: 6   PTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPD 65

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             A F G+V + Q +  LQAD++ +            +  +D   N+     ++ +    
Sbjct: 66  D-AVFTGSVDIMQGNSRLQADEVQLH-QKEAPGQPEPVRTVDALGNVHYDDNQVILKGPK 123

Query: 119 GYVDFQKR-ILVLNGDRADKVILKEKL 144
           G+ +   +   V  GD   +++ ++  
Sbjct: 124 GWANLNTKDTNVWEGDY--QMVGRQGR 148


>gi|300905458|ref|ZP_07123224.1| organic solvent tol