BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780745|ref|YP_003065158.1| OstA family protein
[Candidatus Liberibacter asiaticus str. psy62]
         (181 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040422|gb|ACT57218.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 181

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 181/181 (100%), Positives = 181/181 (100%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK
Sbjct: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY
Sbjct: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR
Sbjct: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180

Query: 181 P 181
           P
Sbjct: 181 P 181


>gi|260429201|ref|ZP_05783178.1| lipopolysaccharide transport periplasmic protein LptA [Citreicella
           sp. SE45]
 gi|260419824|gb|EEX13077.1| lipopolysaccharide transport periplasmic protein LptA [Citreicella
           sp. SE45]
          Length = 170

 Score =  123 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 74/171 (43%), Gaps = 10/171 (5%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  ++   A +F+L    L+Q A           +  + + AD L+V      A ++GNV
Sbjct: 1   MFRFLTAAATLFLLSGPALAQGAQVAFGGMSQDTSAPVEVSADSLQVNQTDGTALYEGNV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q +  L A ++ I Y         +I RM+    + + SG+    A N        +
Sbjct: 61  VIGQGEMRLAAPRVLIVYAEGE--GQGRIERMEASGGVTLVSGDEAAEAENADYTIATGV 118

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +V+ G+    V+L +  N     ++ VN++   A + G    +V+++I+  
Sbjct: 119 VVMTGN----VLLTQGPNALTSERMTVNLEDGTAQMTG----RVRTVIQQG 161


>gi|294675673|ref|YP_003576288.1| OstA family protein [Rhodobacter capsulatus SB 1003]
 gi|294474493|gb|ADE83881.1| OstA family protein [Rhodobacter capsulatus SB 1003]
          Length = 161

 Score =  120 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 70/173 (40%), Gaps = 12/173 (6%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             ++  LA + + L    + A        +   + ++ + AD L V  A   A F GNV 
Sbjct: 1   MRFLPALAGLTLALGFGAALAQEVAFPGLRTDPDAQVEVTADSLSVHQADGSAVFTGNVL 60

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           + Q    L+A+K+ ++Y      ++     +     + + SG+    A     +     +
Sbjct: 61  IVQGPMRLKAEKVEVEYGADRSRIAK----LHASGGVTLVSGKDAAEAREAVYEVAAGAV 116

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
            L GD    V+L +  N   G  + +++ T    + G    +V++I++    P
Sbjct: 117 ELTGD----VLLTQGPNVLSGQHMTIDLKTGTGRMDG----RVRTILQPGETP 161


>gi|114764078|ref|ZP_01443317.1| hypothetical protein 1100011001333_R2601_15507 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543436|gb|EAU46451.1| hypothetical protein R2601_15507 [Roseovarius sp. HTCC2601]
          Length = 165

 Score =  120 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 78/171 (45%), Gaps = 12/171 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  ++ + A++F L    L+Q A       +   +  + + AD L+V  +   A + GNV
Sbjct: 1   MFRFLTIAAMLFALSGPALAQGAQVAFGGMQQDTSAPVEVSADQLQVNQSDGTALYTGNV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q +  L A ++ + ++       N+I R++    + + SGE    +     D  +  
Sbjct: 61  VIGQGEMRLAAPRVLVVFDE----AGNRIARLEATGGVTLVSGEEAAESERADYDIDEGT 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +V+ G+    V+L +  N     +++VN++   A + G    +V+++I   
Sbjct: 117 VVMTGN----VLLTQGPNALTSERMVVNLEGGTAQMTG----RVRTVISQG 159


>gi|156935724|ref|YP_001439640.1| lipopolysaccharide transport periplasmic protein LptA [Cronobacter
           sakazakii ATCC BAA-894]
 gi|156533978|gb|ABU78804.1| hypothetical protein ESA_03593 [Cronobacter sakazakii ATCC BAA-894]
          Length = 185

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M + +N + L + L + +        +               + IHI++D   +      
Sbjct: 1   MKSRINKLSLNLVLTSTLLAAGFPAFA---------LTGDTEQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +          +      +   A+ 
Sbjct: 52  VTFTGNVVVTQGSIKINADKVVVTRPGGEKGKEVIDGYGNPATFYQMQDNGKPVKGHAAK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + + Q   +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELQNDFVVLTGNAY----LEQLDSNIKGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 167



 Score = 35.7 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 9/79 (11%), Positives = 25/79 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  +         GN ++ Q D +++ DK+T           ++  +
Sbjct: 99  QDNGKPVKGHAAKMHYELQNDFVVLTGNAYLEQLDSNIKGDKITYLVKEQKMQAFSEKGK 158

Query: 99  MDVERNIFIQSGEINVIAS 117
                 +  Q    +  + 
Sbjct: 159 RVTTVLVPSQLQNKDGTSQ 177


>gi|158425551|ref|YP_001526843.1| hypothetical protein AZC_3927 [Azorhizobium caulinodans ORS 571]
 gi|158332440|dbj|BAF89925.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 79/188 (42%), Gaps = 20/188 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAAS------YMTRFKVLGNEKIHIKADMLEVKDAV 58
           +  + L +   A V  L    L+Q  A+       +  F    +E I I +D LEVKD  
Sbjct: 1   MTFLSLRLAAAACVLSLAVPALAQQPAANSGPPNALQGFARNRDEPIRINSDTLEVKDKE 60

Query: 59  QKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--------SNKINRMDVERNIFIQSG 110
           ++A F G V + Q D +L   ++ + Y+              S+KI +++    + +Q+ 
Sbjct: 61  KQATFSGKVVVVQGDTTLHCPQLVVYYDGDVAAGVQGGAPSDSSKIRKLEALGGVVVQTK 120

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           +       G  + +   + L G     V+L +  N   G KL+V++ T  +  +G    +
Sbjct: 121 DQTATGDTGVFEMKTNTVTLTGKP---VVLTQGPNVVRGQKLVVDLTTGVSKFEG---GR 174

Query: 171 VQSIIRYD 178
           V  ++   
Sbjct: 175 VDMLLTPG 182


>gi|254466650|ref|ZP_05080061.1| cell envelope biogenesis protein YhbN [Rhodobacterales bacterium
           Y4I]
 gi|206687558|gb|EDZ48040.1| cell envelope biogenesis protein YhbN [Rhodobacterales bacterium
           Y4I]
          Length = 170

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 10/176 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++ +   I  L  + V      +Q A+      K   ++ + + AD L V  A   A F 
Sbjct: 1   MSYLRTLIFCLP-LAVFPGLAAAQTASVAFGAVKADPSQPVEVTADNLAVNQADGSAEFT 59

Query: 65  GNVFMTQEDFSLQADKMTIDYNN-TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           GNV + Q    L AD + + Y    +      I R++   N+ + SG     A       
Sbjct: 60  GNVLIVQGIMRLSADTVLVIYKTADDSGAKAGIERLEAAGNVVLVSGPDAAEAERAEYTI 119

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
               +V+ G+    V+L ++  T    +L VN+ +  A + G    +V++I+   G
Sbjct: 120 DTGTIVMTGN----VLLNQEGGTLASNRLEVNLTSGTAKMAG----RVKTILNPSG 167


>gi|110635994|ref|YP_676202.1| OstA-like protein [Mesorhizobium sp. BNC1]
 gi|110286978|gb|ABG65037.1| OstA-like protein [Chelativorans sp. BNC1]
          Length = 186

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 77/186 (41%), Gaps = 12/186 (6%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMT--RFKVLGNEKIHIKADMLEVKDAVQKA 61
            +  +H     + L+ +     L+Q + S  +     +  +E I I    +EV      A
Sbjct: 1   MMGRVHGLAFAMGLLMLWPAGGLAQTSESRPSQLGLNLSSDEPIQIDGARVEVDQTQNLA 60

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNT---NRDVSNKINRMDVERNIFIQSGEINVIASN 118
              G+V + Q    L+  ++ I Y          +  I R++ +  ++++S         
Sbjct: 61  TLTGDVQVVQGPTLLKTARLKIFYAEGSGLPTSGAANIKRLEADGGVYVKSETQVATGDQ 120

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ----GCESDQVQSI 174
           G  D    +LVL+G    +V+L E  N  +GCKL V + T  A+L+    G    +V+ +
Sbjct: 121 GTFDMGTEVLVLSG---KEVVLTEGENVIVGCKLTVQMKTGQATLESCKDGGSGGRVRML 177

Query: 175 IRYDGR 180
           +    +
Sbjct: 178 LTPSSQ 183


>gi|26249786|ref|NP_755826.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli CFT073]
 gi|91212625|ref|YP_542611.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UTI89]
 gi|110807066|ref|YP_690586.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 5 str. 8401]
 gi|26110214|gb|AAN82400.1|AE016767_160 Protein yhbN precursor [Escherichia coli CFT073]
 gi|91074199|gb|ABE09080.1| conserved hypothetical protein [Escherichia coli UTI89]
 gi|110616614|gb|ABF05281.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281602583|gb|ADA75567.1| putative ABC superfamily transport protein [Shigella flexneri
           2002017]
          Length = 192

 Score =  117 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 67/180 (37%), Gaps = 8/180 (4%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    + +    + L+L  VL  + L+  A+          ++ IHI++D   +      
Sbjct: 1   MKRLEHPMKFKTNKLSLNLVLASSLLA--ASIPAFAVTGDTDQPIHIESDQQSLDMQGNV 58

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 59  VTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 118

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 119 MHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 174



 Score = 36.8 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 106 QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 165

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 166 RVTTVLVPSQLQDKNNKGQT 185


>gi|157148771|ref|YP_001456090.1| lipopolysaccharide transport periplasmic protein LptA [Citrobacter
           koseri ATCC BAA-895]
 gi|157085976|gb|ABV15654.1| hypothetical protein CKO_04603 [Citrobacter koseri ATCC BAA-895]
          Length = 184

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 59/180 (32%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +               + IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASTLLAASLPAFA---------VTGDTEQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +          +      +   A  
Sbjct: 52  VTFTGNVVVTQGTIKINADKVVVTRPGGEQGKEVIDGFGNPATFYQMQDNGKPVKGHAQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 167


>gi|283836253|ref|ZP_06355994.1| lipopolysaccharide transport periplasmic protein LptA [Citrobacter
           youngae ATCC 29220]
 gi|291067617|gb|EFE05726.1| lipopolysaccharide transport periplasmic protein LptA [Citrobacter
           youngae ATCC 29220]
          Length = 182

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 60/180 (33%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +  N + L + L + +        +               + IHI++D   +      
Sbjct: 1   MKSKTNKLSLNLVLASSLLAASIPAFA---------VTGDTEQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +          +      +   AS 
Sbjct: 52  VTFTGNVVVTQGTIKINADKVVVTRPGGEDGKEVIDGYGNPATFYQMQDNGKPVKGRASQ 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G       L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGKAY----LEQLDSNITGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|255262551|ref|ZP_05341893.1| lipopolysaccharide transport periplasmic protein LptA
           [Thalassiobium sp. R2A62]
 gi|255104886|gb|EET47560.1| lipopolysaccharide transport periplasmic protein LptA
           [Thalassiobium sp. R2A62]
          Length = 161

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L +  +AL+F L  A  +Q     +       +  + I AD L +     +A F GNV
Sbjct: 1   MILRVVSIALLFCLPFAVSAQGTNITLGGINAQPDAPVEISADNLNIDQDSGRAVFSGNV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q D  L A  + + Y++    +S     ++    +   +      A++   D     
Sbjct: 61  VIGQGDLRLAAGTVQVTYSDEQGKISA----LNASGGVTFVTESEQAEAASAVYDLDGEQ 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           L L+G+    V+L +  +     K+ +N+ T  A ++G    +V+++     
Sbjct: 117 LTLSGN----VLLTQGASALTADKMTINLSTGNARMEG----RVRTVFEQGD 160


>gi|163745217|ref|ZP_02152577.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
 gi|161382035|gb|EDQ06444.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
          Length = 164

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 79/171 (46%), Gaps = 13/171 (7%)

Query: 9   HLYIHLLALVFVL-LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           HL+I +L L+F L      +Q+A       +   +  + + AD L V +A   A F GNV
Sbjct: 3   HLFILMLPLLFALQAAPVTAQSANVAFGALEQDTSLPVEVTADNLSVDNASGTAIFTGNV 62

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            ++Q + +L A K+ + Y   ++     I +++    + + +GE    +     D     
Sbjct: 63  LISQGEMTLSAGKVQVIYRAEDQ----GIAKLEATGGVVLVAGEDAAESQRADYDIDAGT 118

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           LV++GD    V++ +  +     ++ VN++   A + G     V++I++  
Sbjct: 119 LVMSGD----VLMTQGPSALSAQEMTVNLNDGTAQMSGG----VKTILQPG 161


>gi|307943002|ref|ZP_07658347.1| OstA family protein [Roseibium sp. TrichSKD4]
 gi|307773798|gb|EFO33014.1| OstA family protein [Roseibium sp. TrichSKD4]
          Length = 183

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 4   FLNSIHLYIHLLALVFVLL-KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
             N+++  + ++  +  L      +Q  ++    F    ++ I I+A  L+V+D    A 
Sbjct: 1   MYNTLYRLMGIVVTLGALAIAPVSAQTFSNAFEGFGSNDDDPIQIEASELQVEDKNNLAI 60

Query: 63  FKGNVFMTQEDFSLQADKMTIDYN-----NTNRDVSNKINRMDVERNIFIQSGEINVIAS 117
           F GNV +TQ +  L+  ++ + Y+              I+R++    +FI S        
Sbjct: 61  FTGNVVVTQGEAQLKTHRLKVFYDGQGGGAGTGTGQRDISRLEASGRVFISSEGQTATGD 120

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
               D ++ I+V+ G    +V+L +  N  +G KL VN+ T  A LQ  +S +V+ +I+ 
Sbjct: 121 EASFDMKRDIMVMTG---KEVVLSQGPNVVVGNKLTVNLVTGQADLQAPKSGRVKVLIKP 177

Query: 178 D 178
           +
Sbjct: 178 N 178


>gi|237730120|ref|ZP_04560601.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908726|gb|EEH94644.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 182

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +  N + L + L + +       L+               + IHI++D   +      
Sbjct: 1   MKSKTNKLSLNLVLASSLLAASIPALA---------VTGDTEQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + A+K+ +        ++V +          +      +   AS+
Sbjct: 52  VTFTGNVIVTQGTIKINANKVVVTRPGGEDGKEVIDGYGDPATFYQMQDNGKPVKGRASH 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G       L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGKAY----LEQLDSNITGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|283788161|ref|YP_003368026.1| organic solvent tolerance protein [Citrobacter rodentium ICC168]
 gi|282951615|emb|CBG91315.1| putative organic solvent tolerance protein [Citrobacter rodentium
           ICC168]
          Length = 184

 Score =  115 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +          +      +   AS 
Sbjct: 52  VTFTGNVVVTQGTIKINADKVVVTRPGGEEGKEVIDGFGNPATFYQMQDNGKPVKGHASK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          + ++V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGNRVTTVLVPS 167


>gi|15803740|ref|NP_289774.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 EDL933]
 gi|15833333|ref|NP_312106.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. Sakai]
 gi|16131090|ref|NP_417667.1| periplasmic LPS-binding protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30064538|ref|NP_838709.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2a str. 2457T]
 gi|56480284|ref|NP_708999.2| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2a str. 301]
 gi|74313737|ref|YP_312156.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           sonnei Ss046]
 gi|82545562|ref|YP_409509.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii Sb227]
 gi|82778514|ref|YP_404863.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae Sd197]
 gi|89109963|ref|AP_003743.1| predicted transporter subunit [Escherichia coli str. K-12 substr.
           W3110]
 gi|110643441|ref|YP_671171.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 536]
 gi|117625492|ref|YP_858815.1| hypothetical protein APECO1_3235 [Escherichia coli APEC O1]
 gi|157156158|ref|YP_001464678.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E24377A]
 gi|157162684|ref|YP_001460002.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli HS]
 gi|168751606|ref|ZP_02776628.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|168754182|ref|ZP_02779189.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|168763737|ref|ZP_02788744.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769056|ref|ZP_02794063.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777255|ref|ZP_02802262.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|168781344|ref|ZP_02806351.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786086|ref|ZP_02811093.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC869]
 gi|168800914|ref|ZP_02825921.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC508]
 gi|170018550|ref|YP_001723504.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli ATCC 8739]
 gi|170082734|ref|YP_001732054.1| ABC transporter periplasmic-binding protein [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170682501|ref|YP_001745472.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli SMS-3-5]
 gi|187731673|ref|YP_001881885.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii CDC 3083-94]
 gi|188493941|ref|ZP_03001211.1| OstA family protein [Escherichia coli 53638]
 gi|191168640|ref|ZP_03030422.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B7A]
 gi|191174473|ref|ZP_03035973.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           F11]
 gi|193065329|ref|ZP_03046400.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E22]
 gi|193070327|ref|ZP_03051270.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E110019]
 gi|194429131|ref|ZP_03061661.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B171]
 gi|194434477|ref|ZP_03066737.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Shigella dysenteriae
           1012]
 gi|194439203|ref|ZP_03071284.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           101-1]
 gi|195940056|ref|ZP_03085438.1| hypothetical protein EscherichcoliO157_27295 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808977|ref|ZP_03251314.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4206]
 gi|208813997|ref|ZP_03255326.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4045]
 gi|208819233|ref|ZP_03259553.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4042]
 gi|209396095|ref|YP_002272670.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4115]
 gi|209920675|ref|YP_002294759.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli SE11]
 gi|215488516|ref|YP_002330947.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217326728|ref|ZP_03442811.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. TW14588]
 gi|218555770|ref|YP_002388683.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli IAI1]
 gi|218560270|ref|YP_002393183.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli S88]
 gi|218691490|ref|YP_002399702.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli ED1a]
 gi|218696905|ref|YP_002404572.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 55989]
 gi|218701969|ref|YP_002409598.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli IAI39]
 gi|218706820|ref|YP_002414339.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UMN026]
 gi|227887921|ref|ZP_04005726.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, periplasmic lipopolysaccharide-binding
           protein [Escherichia coli 83972]
 gi|237706048|ref|ZP_04536529.1| yhbN [Escherichia sp. 3_2_53FAA]
 gi|238902302|ref|YP_002928098.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli BW2952]
 gi|254038365|ref|ZP_04872423.1| yhbN [Escherichia sp. 1_1_43]
 gi|254795149|ref|YP_003079986.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. TW14359]
 gi|256018881|ref|ZP_05432746.1| lipopolysaccharide transport periplasmic protein LptA [Shigella sp.
           D9]
 gi|256024225|ref|ZP_05438090.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           sp. 4_1_40B]
 gi|260846013|ref|YP_003223791.1| putative transporter subunit [Escherichia coli O103:H2 str. 12009]
 gi|260857327|ref|YP_003231218.1| putative transporter subunit [Escherichia coli O26:H11 str. 11368]
 gi|260869951|ref|YP_003236353.1| putative transporter subunit [Escherichia coli O111:H- str. 11128]
 gi|261228211|ref|ZP_05942492.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255067|ref|ZP_05947600.1| putative transporter subunit [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284574|ref|YP_003501392.1| Protein yhbN precursor [Escherichia coli O55:H7 str. CB9615]
 gi|293406809|ref|ZP_06650735.1| hypothetical protein ECGG_02119 [Escherichia coli FVEC1412]
 gi|293412571|ref|ZP_06655294.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293416629|ref|ZP_06659268.1| hypothetical protein ECDG_03389 [Escherichia coli B185]
 gi|293449533|ref|ZP_06663954.1| hypothetical protein ECCG_02566 [Escherichia coli B088]
 gi|298382550|ref|ZP_06992147.1| hypothetical protein ECFG_02311 [Escherichia coli FVEC1302]
 gi|300817545|ref|ZP_07097761.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 107-1]
 gi|300823834|ref|ZP_07103958.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 119-7]
 gi|300897968|ref|ZP_07116344.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 198-1]
 gi|300904392|ref|ZP_07122240.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 84-1]
 gi|300918962|ref|ZP_07135517.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 115-1]
 gi|300926055|ref|ZP_07141877.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 182-1]
 gi|300929896|ref|ZP_07145338.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 187-1]
 gi|300938116|ref|ZP_07152890.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 21-1]
 gi|300948855|ref|ZP_07162920.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 116-1]
 gi|300955789|ref|ZP_07168131.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 175-1]
 gi|300979951|ref|ZP_07174803.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 200-1]
 gi|300990930|ref|ZP_07179382.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 45-1]
 gi|301022102|ref|ZP_07186028.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 69-1]
 gi|301047953|ref|ZP_07194998.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 185-1]
 gi|301306746|ref|ZP_07212800.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 124-1]
 gi|301326367|ref|ZP_07219731.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 78-1]
 gi|301644914|ref|ZP_07244883.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 146-1]
 gi|306816458|ref|ZP_07450590.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli NC101]
 gi|307139886|ref|ZP_07499242.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H736]
 gi|307313095|ref|ZP_07592721.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli W]
 gi|309793779|ref|ZP_07688205.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 145-7]
 gi|331643898|ref|ZP_08345029.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H736]
 gi|331649000|ref|ZP_08350088.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M605]
 gi|331654804|ref|ZP_08355804.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M718]
 gi|331659487|ref|ZP_08360429.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA206]
 gi|331664813|ref|ZP_08365718.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA143]
 gi|331670027|ref|ZP_08370872.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA271]
 gi|331674729|ref|ZP_08375488.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA280]
 gi|331679279|ref|ZP_08379951.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H591]
 gi|331684847|ref|ZP_08385439.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H299]
 gi|332279969|ref|ZP_08392382.1| yhbN [Shigella sp. D9]
 gi|83288016|sp|P0ADV3|LPTA_ECO57 RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|83288017|sp|P0ADV2|LPTA_ECOL6 RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|83288018|sp|P0ADV1|LPTA_ECOLI RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|83288019|sp|P0ADV4|LPTA_SHIFL RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|12517818|gb|AAG58334.1|AE005548_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|551336|gb|AAB60161.1| orf185 [Escherichia coli str. K12 substr. W3110]
 gi|606139|gb|AAA58002.1| ORF_o185 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789592|gb|AAC76232.1| periplasmic LPS-binding protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13363552|dbj|BAB37502.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30042797|gb|AAP18520.1| hypothetical protein S3458 [Shigella flexneri 2a str. 2457T]
 gi|56383835|gb|AAN44706.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|73857214|gb|AAZ89921.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242662|gb|ABB63372.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246973|gb|ABB67681.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85675994|dbj|BAE77244.1| predicted transporter subunit [Escherichia coli str. K12 substr.
           W3110]
 gi|110345033|gb|ABG71270.1| hypothetical protein ECP_3288 [Escherichia coli 536]
 gi|115514616|gb|ABJ02691.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli APEC O1]
 gi|157068364|gb|ABV07619.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli HS]
 gi|157078188|gb|ABV17896.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E24377A]
 gi|169753478|gb|ACA76177.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli ATCC 8739]
 gi|169890569|gb|ACB04276.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli str. K-12 substr. DH10B]
 gi|170520219|gb|ACB18397.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           SMS-3-5]
 gi|187428665|gb|ACD07939.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Shigella boydii CDC
           3083-94]
 gi|187767477|gb|EDU31321.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014365|gb|EDU52487.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|188489140|gb|EDU64243.1| OstA family protein [Escherichia coli 53638]
 gi|189001064|gb|EDU70050.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4076]
 gi|189358723|gb|EDU77142.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361851|gb|EDU80270.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|189366148|gb|EDU84564.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|189374133|gb|EDU92549.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC869]
 gi|189376819|gb|EDU95235.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC508]
 gi|190901334|gb|EDV61101.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B7A]
 gi|190905228|gb|EDV64867.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           F11]
 gi|192926970|gb|EDV81593.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E22]
 gi|192956386|gb|EDV86846.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           E110019]
 gi|194412856|gb|EDX29148.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           B171]
 gi|194417256|gb|EDX33365.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Shigella dysenteriae
           1012]
 gi|194421899|gb|EDX37905.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           101-1]
 gi|208728778|gb|EDZ78379.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4206]
 gi|208735274|gb|EDZ83961.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4045]
 gi|208739356|gb|EDZ87038.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4042]
 gi|209157495|gb|ACI34928.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. EC4115]
 gi|209758038|gb|ACI77331.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758040|gb|ACI77332.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758042|gb|ACI77333.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758044|gb|ACI77334.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209758046|gb|ACI77335.1| hypothetical protein ECs4079 [Escherichia coli]
 gi|209913934|dbj|BAG79008.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266588|emb|CAS11027.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli O127:H6 str. E2348/69]
 gi|217319095|gb|EEC27520.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           O157:H7 str. TW14588]
 gi|218353637|emb|CAU99848.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli 55989]
 gi|218362538|emb|CAR00162.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli IAI1]
 gi|218367039|emb|CAR04810.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli S88]
 gi|218371955|emb|CAR19811.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli IAI39]
 gi|218429054|emb|CAR09861.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli ED1a]
 gi|218433917|emb|CAR14834.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia coli UMN026]
 gi|222034917|emb|CAP77660.1| Protein yhbN [Escherichia coli LF82]
 gi|226839989|gb|EEH72010.1| yhbN [Escherichia sp. 1_1_43]
 gi|226899088|gb|EEH85347.1| yhbN [Escherichia sp. 3_2_53FAA]
 gi|227835317|gb|EEJ45783.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, periplasmic lipopolysaccharide-binding
           protein [Escherichia coli 83972]
 gi|238863248|gb|ACR65246.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli BW2952]
 gi|254594549|gb|ACT73910.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli O157:H7 str. TW14359]
 gi|257755976|dbj|BAI27478.1| predicted transporter subunit [Escherichia coli O26:H11 str. 11368]
 gi|257761160|dbj|BAI32657.1| predicted transporter subunit [Escherichia coli O103:H2 str. 12009]
 gi|257766307|dbj|BAI37802.1| predicted transporter subunit [Escherichia coli O111:H- str. 11128]
 gi|260447773|gb|ACX38195.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli DH1]
 gi|281180242|dbj|BAI56572.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284923222|emb|CBG36316.1| putative organic solvent tolerance protein [Escherichia coli 042]
 gi|290764447|gb|ADD58408.1| Protein yhbN precursor [Escherichia coli O55:H7 str. CB9615]
 gi|291322623|gb|EFE62052.1| hypothetical protein ECCG_02566 [Escherichia coli B088]
 gi|291426815|gb|EFE99847.1| hypothetical protein ECGG_02119 [Escherichia coli FVEC1412]
 gi|291431985|gb|EFF04968.1| hypothetical protein ECDG_03389 [Escherichia coli B185]
 gi|291469342|gb|EFF11833.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490504|gb|ADE89260.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia coli
           IHE3034]
 gi|298277690|gb|EFI19206.1| hypothetical protein ECFG_02311 [Escherichia coli FVEC1302]
 gi|300300185|gb|EFJ56570.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 185-1]
 gi|300307886|gb|EFJ62406.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 200-1]
 gi|300317335|gb|EFJ67119.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 175-1]
 gi|300358316|gb|EFJ74186.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 198-1]
 gi|300397698|gb|EFJ81236.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 69-1]
 gi|300403666|gb|EFJ87204.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 84-1]
 gi|300407006|gb|EFJ90544.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 45-1]
 gi|300413904|gb|EFJ97214.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 115-1]
 gi|300417913|gb|EFK01224.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 182-1]
 gi|300451660|gb|EFK15280.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 116-1]
 gi|300456879|gb|EFK20372.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 21-1]
 gi|300462182|gb|EFK25675.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 187-1]
 gi|300523602|gb|EFK44671.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 119-7]
 gi|300529843|gb|EFK50905.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 107-1]
 gi|300838025|gb|EFK65785.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 124-1]
 gi|300846931|gb|EFK74691.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 78-1]
 gi|301076765|gb|EFK91571.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 146-1]
 gi|305850023|gb|EFM50482.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli NC101]
 gi|306907006|gb|EFN37514.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli W]
 gi|307625201|gb|ADN69505.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UM146]
 gi|308122736|gb|EFO59998.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 145-7]
 gi|309703626|emb|CBJ02966.1| putative organic solvent tolerance protein [Escherichia coli ETEC
           H10407]
 gi|312947757|gb|ADR28584.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O83:H1 str. NRG 857C]
 gi|315062506|gb|ADT76833.1| periplasmic LPS-binding protein [Escherichia coli W]
 gi|315137786|dbj|BAJ44945.1| protein yhbN precursor [Escherichia coli DH1]
 gi|315257128|gb|EFU37096.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 85-1]
 gi|315289001|gb|EFU48399.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 110-3]
 gi|315294860|gb|EFU54199.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 153-1]
 gi|315297934|gb|EFU57204.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 16-3]
 gi|320186686|gb|EFW61410.1| LptA, protein essential for LPS transport across the periplasm
           [Shigella flexneri CDC 796-83]
 gi|320189553|gb|EFW64212.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli O157:H7 str. EC1212]
 gi|320194685|gb|EFW69315.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli WV_060327]
 gi|320202114|gb|EFW76689.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli EC4100B]
 gi|320640271|gb|EFX09843.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. G5101]
 gi|320645568|gb|EFX14577.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H- str. 493-89]
 gi|320650878|gb|EFX19335.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H- str. H 2687]
 gi|320656259|gb|EFX24171.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
 gi|320661949|gb|EFX29357.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O55:H7 str. USDA 5905]
 gi|320666784|gb|EFX33763.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli O157:H7 str. LSU-61]
 gi|323154415|gb|EFZ40616.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli EPECa14]
 gi|323376906|gb|ADX49174.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli KO11]
 gi|323936106|gb|EGB32400.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E1520]
 gi|323941700|gb|EGB37879.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E482]
 gi|323946946|gb|EGB42962.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H120]
 gi|323951281|gb|EGB47156.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H252]
 gi|323957653|gb|EGB53367.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H263]
 gi|323961145|gb|EGB56759.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H489]
 gi|323966380|gb|EGB61814.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M863]
 gi|323970237|gb|EGB65508.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA007]
 gi|323979083|gb|EGB74161.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TW10509]
 gi|324008712|gb|EGB77931.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 57-2]
 gi|324012156|gb|EGB81375.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 60-1]
 gi|324018348|gb|EGB87567.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 117-3]
 gi|324119565|gb|EGC13447.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E1167]
 gi|326337900|gb|EGD61734.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli O157:H7 str. 1125]
 gi|326347470|gb|EGD71195.1| LptA, protein essential for LPS transport across the periplasm
           [Escherichia coli O157:H7 str. 1044]
 gi|327251291|gb|EGE62980.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli STEC_7v]
 gi|330909252|gb|EGH37766.1| lptA, protein essential for LPS transport across the periplasm
           [Escherichia coli AA86]
 gi|331037369|gb|EGI09593.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H736]
 gi|331042747|gb|EGI14889.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M605]
 gi|331048186|gb|EGI20263.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli M718]
 gi|331054069|gb|EGI26098.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA206]
 gi|331058061|gb|EGI30043.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA143]
 gi|331062940|gb|EGI34854.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA271]
 gi|331068168|gb|EGI39564.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli TA280]
 gi|331073344|gb|EGI44667.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H591]
 gi|331078462|gb|EGI49668.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli H299]
 gi|332086225|gb|EGI91383.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii 5216-82]
 gi|332102321|gb|EGJ05667.1| yhbN [Shigella sp. D9]
 gi|332345157|gb|AEE58491.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli UMNK88]
 gi|332754506|gb|EGJ84872.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2747-71]
 gi|332998842|gb|EGK18438.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri VA-6]
          Length = 185

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 52  VTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 99  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 159 RVTTVLVPSQLQDKNNKGQT 178


>gi|62181826|ref|YP_218243.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|62129459|gb|AAX67162.1| putative ABC superfamily (bind_prot) transport protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322716315|gb|EFZ07886.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323131678|gb|ADX19108.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326629341|gb|EGE35684.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 191

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 64/180 (35%), Gaps = 8/180 (4%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M      +    + L+L  +L  + L+  A+           + IHI +D   +      
Sbjct: 1   MKRLEPLMKFKTNKLSLNLMLAGSLLA--ASIPAFAVTGDTEQPIHIDSDQQSLDMQGNV 58

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV MTQ    + ADK+ +        ++V +          +      +   AS+
Sbjct: 59  VTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASH 118

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 119 MHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 174


>gi|238910112|ref|ZP_04653949.1| hypothetical protein SentesTe_03100 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 184

 Score =  114 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 59/180 (32%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L   +        +               + IHI +D   +      
Sbjct: 1   MKFKTNKLSLNLMLAGSLLAASIPAFA---------VTGDTEQPIHIDSDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV MTQ    + ADK+ +        ++V +          +      +   AS+
Sbjct: 52  VTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASH 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLLKEQKMQAFSEKGKRVTTVLVPS 167


>gi|170765506|ref|ZP_02900317.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia albertii
           TW07627]
 gi|170124652|gb|EDS93583.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Escherichia albertii
           TW07627]
          Length = 185

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 52  VTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      LK+  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAF----LKQIDSNITGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167



 Score = 36.4 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 24/80 (30%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN F+ Q D ++  DK+T           +   +
Sbjct: 99  QDNGKPVEGHASQMHYELAKDFVVLTGNAFLKQIDSNITGDKITYLVKEQKMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 159 RVTTVLVPSQLQDKNNKGQT 178


>gi|161506119|ref|YP_001573231.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|160867466|gb|ABX24089.1| hypothetical protein SARI_04307 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 184

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 59/180 (32%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L   +        +               + IHI +D   +      
Sbjct: 1   MKFKTNKLSLNLMLAGSLLAASIPAFA---------VTGDTEQPIHIDSDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV MTQ    + ADK+ +        ++V +          +      +   AS+
Sbjct: 52  VTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASH 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LEQLDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|320181475|gb|EFW56393.1| LptA, protein essential for LPS transport across the periplasm
           [Shigella boydii ATCC 9905]
          Length = 185

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 52  VTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V S++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTSVLVPS 167



 Score = 36.1 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 99  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 159 RVTSVLVPSQLQDKNNKGQT 178


>gi|320174566|gb|EFW49702.1| LptA, protein essential for LPS transport across the periplasm
           [Shigella dysenteriae CDC 74-1112]
          Length = 185

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 62/180 (34%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFAVI---------GDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 52  VTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 99  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 159 RVTTVLVPSQLQDKNNKGQT 178


>gi|126732865|ref|ZP_01748656.1| hypothetical protein SSE37_18342 [Sagittula stellata E-37]
 gi|126706641|gb|EBA05715.1| hypothetical protein SSE37_18342 [Sagittula stellata E-37]
          Length = 164

 Score =  113 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 72/169 (42%), Gaps = 12/169 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             L A+   +  A     +           +  + + AD L V  A   A + GNV + Q
Sbjct: 4   ALLAAICMAIFPAVTLAQSQVSFGGGGQDTSAPVEVTADSLSVNQADGTALYSGNVVIVQ 63

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            +  L A ++ + Y++T     ++I RM+    + +  GE          +     +VL+
Sbjct: 64  GEMRLAAPRVLVIYSDTR----SEITRMEATGGVVMVRGEEAAEGERADYNIDDGQIVLS 119

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           G+    V++ +  +     +++VN+D   A + G    +V+++++  GR
Sbjct: 120 GN----VLVTQGESAMTSERMVVNLDDGTAQMSG----RVKTVLQQGGR 160


>gi|16766613|ref|NP_462228.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167552032|ref|ZP_02345785.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167994511|ref|ZP_02575602.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231929|ref|ZP_02656987.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238020|ref|ZP_02663078.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168243154|ref|ZP_02668086.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168262669|ref|ZP_02684642.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168463456|ref|ZP_02697373.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168819612|ref|ZP_02831612.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194444431|ref|YP_002042576.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194450949|ref|YP_002047347.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194468742|ref|ZP_03074726.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737776|ref|YP_002116268.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197248482|ref|YP_002148243.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197262981|ref|ZP_03163055.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242711|ref|YP_002217289.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200388115|ref|ZP_03214727.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204931154|ref|ZP_03221948.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205354219|ref|YP_002228020.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207858566|ref|YP_002245217.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|213021918|ref|ZP_03336365.1| hypothetical protein Salmonelentericaenterica_04022 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213053147|ref|ZP_03346025.1| hypothetical protein Salmoneentericaenterica_09610 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213419715|ref|ZP_03352781.1| hypothetical protein Salmonentericaenterica_18743 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213426639|ref|ZP_03359389.1| hypothetical protein SentesTyphi_14118 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213622832|ref|ZP_03375615.1| hypothetical protein SentesTyp_37147 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213648389|ref|ZP_03378442.1| hypothetical protein SentesTy_14559 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855448|ref|ZP_03383688.1| hypothetical protein SentesT_15920 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289825829|ref|ZP_06544997.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|16421875|gb|AAL22187.1| putative ABC superfamily transport protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|194403094|gb|ACF63316.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194409253|gb|ACF69472.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194455106|gb|EDX43945.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194713278|gb|ACF92499.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195633360|gb|EDX51774.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197212185|gb|ACH49582.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197241236|gb|EDY23856.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289161|gb|EDY28530.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197937227|gb|ACH74560.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199605213|gb|EDZ03758.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204319921|gb|EDZ05127.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205274000|emb|CAR39006.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205323170|gb|EDZ11009.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327638|gb|EDZ14402.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333933|gb|EDZ20697.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337868|gb|EDZ24632.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205343318|gb|EDZ30082.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205348536|gb|EDZ35167.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206710369|emb|CAR34727.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261248483|emb|CBG26320.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995517|gb|ACY90402.1| hypothetical protein STM14_4006 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159867|emb|CBW19386.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914345|dbj|BAJ38319.1| lipopolysaccharide ABC transporter substrate binding protein LptA
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320087763|emb|CBY97527.1| Lipopolysaccharide export system protein lptA Flags: Precursor
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321225259|gb|EFX50318.1| LptA, protein essential for LPS transport across the periplasm
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322615322|gb|EFY12243.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618319|gb|EFY15210.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622876|gb|EFY19720.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322626802|gb|EFY23599.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631371|gb|EFY28131.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322635362|gb|EFY32076.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322643361|gb|EFY39925.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647067|gb|EFY43568.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648870|gb|EFY45315.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322655062|gb|EFY51373.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657665|gb|EFY53933.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322664161|gb|EFY60359.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322667444|gb|EFY63606.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322674692|gb|EFY70784.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322675675|gb|EFY71748.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682311|gb|EFY78334.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322684914|gb|EFY80912.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323195881|gb|EFZ81052.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323198998|gb|EFZ84095.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323204302|gb|EFZ89311.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323207649|gb|EFZ92596.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323211298|gb|EFZ96142.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323214760|gb|EFZ99509.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323221240|gb|EGA05666.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224018|gb|EGA08311.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230332|gb|EGA14451.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233308|gb|EGA17402.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239345|gb|EGA23395.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323242404|gb|EGA26430.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246914|gb|EGA30880.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323254153|gb|EGA37973.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255270|gb|EGA39047.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262733|gb|EGA46289.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264043|gb|EGA47551.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323269429|gb|EGA52884.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326625068|gb|EGE31413.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|332990176|gb|AEF09159.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 184

 Score =  113 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 59/180 (32%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L   +        +               + IHI +D   +      
Sbjct: 1   MKFKTNKLSLNLMLAGSLLAASIPAFA---------VTGDTEQPIHIDSDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV MTQ    + ADK+ +        ++V +          +      +   AS+
Sbjct: 52  VTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASH 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 167


>gi|159046126|ref|YP_001534920.1| OstA family protein [Dinoroseobacter shibae DFL 12]
 gi|157913886|gb|ABV95319.1| OstA family protein [Dinoroseobacter shibae DFL 12]
          Length = 170

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 72/152 (47%), Gaps = 8/152 (5%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +Q +   +   +V  +  + I AD L V      A F GNV +TQ    L+AD++T+ Y+
Sbjct: 27  AQGSQVALGTARVDRDAPVEIDADSLSVNQQNGSAVFSGNVQVTQGALRLEADEVTVSYD 86

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
             +   +++I  +  E N+ + SG     + +         + L+GD    V+L +    
Sbjct: 87  PGSDTTASEIREVRAEGNVLMVSGPDAAESQSAVYTPASNEIRLSGD----VLLSQGPVV 142

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G  L+V++ T    ++G    +V+++++ +
Sbjct: 143 IAGDALVVDLLTGIGEMEG----RVRTVLQPE 170


>gi|253771966|ref|YP_003034797.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163142|ref|YP_003046250.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli B str. REL606]
 gi|297520034|ref|ZP_06938420.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli OP50]
 gi|242378743|emb|CAQ33533.1| LptA, subunit of LptABCFG ABC transporter [Escherichia coli
           BL21(DE3)]
 gi|253323010|gb|ACT27612.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975043|gb|ACT40714.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli B str. REL606]
 gi|253979199|gb|ACT44869.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Escherichia coli BL21(DE3)]
          Length = 185

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 63/180 (35%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ+   + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 52  VTFTGNVIVTQDTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K  +VL G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 99  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 159 RVTTVLVPSQLQDKNNKGQT 178


>gi|296104913|ref|YP_003615059.1| lipopolysaccharide export system protein LptA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295059372|gb|ADF64110.1| lipopolysaccharide export system protein LptA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 184

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 63/180 (35%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + + + +       L+               + IHI++D   +      
Sbjct: 1   MKFKTNKLSLKVIIASAMLAASLPALA---------VTGDTEQPIHIESDTQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV MTQ    + ADK+ +        +++ +          +      +   AS+
Sbjct: 52  VTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIIDGYGNPATFYQMQDNGKPVKGHASH 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +  K +++L G+      L++  +   G K+   +          +  +V +++   
Sbjct: 112 MHYELAKDLVILTGNAY----LEQLDSNITGDKITYLVKEQKMQASSEKGKRVTTVLVPS 167


>gi|242241053|ref|YP_002989234.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech703]
 gi|242133110|gb|ACS87412.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech703]
          Length = 202

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 65/181 (35%), Gaps = 16/181 (8%)

Query: 1   MSAFLNSIHL-YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQ 59
           M + LN+  L  I + + +F +    L+              ++ IHI +D   +     
Sbjct: 1   MKSNLNNNVLHSILVASALFAVSLPALA---------LTGDTDQPIHIDSDQQALDMQSN 51

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIAS 117
              F GNV +TQ    +QADK+ +   N     ++            +      +   A 
Sbjct: 52  VVTFTGNVIVTQGSIKVQADKVVVTRPNGQQGHEIIEGYGNPATFYQMQDNGKPVKGHAQ 111

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
               +  K++++L G+      L++  +   G ++   +          +  +V +++  
Sbjct: 112 KMRYELDKQLVILTGNAY----LEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVP 167

Query: 178 D 178
            
Sbjct: 168 S 168



 Score = 34.5 bits (77), Expect = 7.1,   Method: Composition-based stats.
 Identities = 10/79 (12%), Positives = 27/79 (34%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  +   Q     GN ++ Q D +++ D++T        +  +   +
Sbjct: 100 QDNGKPVKGHAQKMRYELDKQLVILTGNAYLEQLDSNVKGDRITYLVQQQQMEAFSDKGK 159

Query: 99  MDVERNIFIQSGEINVIAS 117
                 +  Q  +    A+
Sbjct: 160 RVTTVLVPSQLQDKGTQAN 178


>gi|328545551|ref|YP_004305660.1| OstA-like protein [polymorphum gilvum SL003B-26A1]
 gi|326415292|gb|ADZ72355.1| OstA-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 178

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 4/158 (2%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                 Q  ++    F     E I I+A  L+V+D    A F G+V ++Q D  L+  ++
Sbjct: 19  PATAAGQTFSNAFAGFGSNDKEPIQIEARELQVEDKTNSATFVGDVVVSQGDTRLKTQRL 78

Query: 82  TIDYNNTNRDVSNKI-NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
            + Y+        +   R++    ++I S +      +   D  ++++V+ G    +V+L
Sbjct: 79  RVFYDGKAAGGVQQRITRLEASGRVYISSKDQTATGDDASFDMNRKVMVMTG---QEVVL 135

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +  N  +G +L +N+DT  A L+   S +V+ +I+ +
Sbjct: 136 SQGPNVVVGNRLTINLDTGKADLEAPRSGRVKVLIQPN 173


>gi|116250189|ref|YP_766027.1| outer membrane OstA family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254837|emb|CAK05911.1| putative outer membrane OstA family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 213

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 82/191 (42%), Gaps = 21/191 (10%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +I     + +      +Q A + M   K+  ++ I I++D LE++D    A F GNV + 
Sbjct: 16  FIAGAFALILTASGAGAQQATATMPGMKLSNDQPIQIESDKLEIRDQEHTALFTGNVKVV 75

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI--------------------FIQSG 110
           Q   ++Q+ KMT+ Y +     +    +   + +                     F+ SG
Sbjct: 76  QGTTTMQSGKMTVYYKDKAAKPAADGAQPAAQPDQSASLASGSADIDKILVTDKVFLSSG 135

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
                A +G  D   +  +L  D  +KVIL +  N F GCKL V++ T  A L+ C   +
Sbjct: 136 TQTATADDGNFDMASQTFILTADEGNKVILSDGPNVFTGCKLTVHMQTGQAELESC-GGR 194

Query: 171 VQSIIRYDGRP 181
           VQ  +    +P
Sbjct: 195 VQIQLDPKSQP 205


>gi|316931444|ref|YP_004106426.1| OstA family protein [Rhodopseudomonas palustris DX-1]
 gi|315599158|gb|ADU41693.1| OstA family protein [Rhodopseudomonas palustris DX-1]
          Length = 221

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 79/189 (41%), Gaps = 26/189 (13%)

Query: 12  IHLLALVFVLLKADLSQAA----ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
             L+A+  +  +   +Q+A     + M  F    ++ I I++D LEV+D  ++A F GNV
Sbjct: 19  AALIAVSTLGPRPAAAQSAVQGVPNAMQGFSQNRDKPIQIESDTLEVRDKKKEATFSGNV 78

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD-----------------VERNIFIQSG 110
            + Q D ++ +  + + Y+           +                    + ++ +   
Sbjct: 79  KVVQGDTTMTSQTLVVFYDQDQAPAKGAKGKPMAAAAPGPDGASSIRRLEAKGHVVVTQK 138

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           +  V       + +  ++ + G+    V+L +  N   G +L+V++ T  + ++   S +
Sbjct: 139 DQVVTGDKAVFETKTNLVTMTGN----VVLTQARNVVRGDRLMVDMTTGVSRVESD-SGR 193

Query: 171 VQSIIRYDG 179
           VQ + +  G
Sbjct: 194 VQGLFQSSG 202


>gi|254486869|ref|ZP_05100074.1| lipopolysaccharide transport periplasmic protein LptA [Roseobacter
           sp. GAI101]
 gi|214043738|gb|EEB84376.1| lipopolysaccharide transport periplasmic protein LptA [Roseobacter
           sp. GAI101]
          Length = 164

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 66/169 (39%), Gaps = 12/169 (7%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           YI L   + +   +  +Q         +   +  + + AD L V  A   A F GNV + 
Sbjct: 6   YILLPIFLILSAMSVAAQGTNVAFGTIRQDTSLPVEVTADNLSVDQATGTAIFTGNVVIG 65

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q +  L A ++ + Y          I R++    + + SG     +     D     +V+
Sbjct: 66  QGEMRLSAARVLVVYRADAE----GIARLEATGGVTLVSGADAAESQRADYDIDSGTIVM 121

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            G+    V+L +  N     K+ VN+    A + G    +V++ ++  G
Sbjct: 122 TGN----VLLAQGRNALSSDKMSVNLSDGTAQMSG----RVKTTLQPGG 162


>gi|39933128|ref|NP_945404.1| OstA-like protein [Rhodopseudomonas palustris CGA009]
 gi|39652753|emb|CAE25492.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 221

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 70/176 (39%), Gaps = 22/176 (12%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
                  Q   + M  F    ++ I I++D LEV+D  ++A F GNV + Q D ++ +  
Sbjct: 32  ATAQSAVQGVPNAMQGFSQNRDKPIQIESDTLEVRDKNKEATFTGNVKVVQGDTTMTSQT 91

Query: 81  MTIDYNNTNRDVSNKINRMD-----------------VERNIFIQSGEINVIASNGYVDF 123
           + + Y+           +                    + ++ +   +  V       + 
Sbjct: 92  LVVFYDQDQAPAKGAKGKPMPAAAPGPDGASSIRRLEAKGHVVVTQKDQVVTGDKAVFET 151

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           +  ++ + G+    V+L +  N   G +L+V++ T  + ++   S +VQ + +  G
Sbjct: 152 KTNLVTMTGN----VVLTQARNVVRGDRLLVDMTTGVSRVESD-SGRVQGLFQSSG 202


>gi|192288482|ref|YP_001989087.1| OstA family protein [Rhodopseudomonas palustris TIE-1]
 gi|192282231|gb|ACE98611.1| OstA family protein [Rhodopseudomonas palustris TIE-1]
          Length = 221

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 70/176 (39%), Gaps = 22/176 (12%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
                  Q   + M  F    ++ I I++D LEV+D  ++A F GNV + Q D ++ +  
Sbjct: 32  ATAQSAVQGVPNAMQGFSQNRDKPIQIESDTLEVRDKNKEATFTGNVKVVQGDTTMTSQT 91

Query: 81  MTIDYNNTNRDVSNKINRMD-----------------VERNIFIQSGEINVIASNGYVDF 123
           + + Y+           +                    + ++ +   +  V       + 
Sbjct: 92  LVVFYDQDQAPAKGAKGKPMPAAAPGPDGASSIRRLEAKGHVVVTQKDQVVTGDKAVFET 151

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           +  ++ + G+    V+L +  N   G +L+V++ T  + ++   S +VQ + +  G
Sbjct: 152 KTNLVTMTGN----VVLTQARNVVRGDRLLVDMTTGVSRVESD-SGRVQGLFQSSG 202


>gi|300113013|ref|YP_003759588.1| lipopolysaccharide transport periplasmic protein lptA
           [Nitrosococcus watsonii C-113]
 gi|299538950|gb|ADJ27267.1| lipopolysaccharide transport periplasmic protein LptA
           [Nitrosococcus watsonii C-113]
          Length = 272

 Score =  111 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 63/179 (35%), Gaps = 15/179 (8%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            L + L A  F++    +                + IHI+AD  E+ D  Q A + GNV 
Sbjct: 4   RLSLKLTAAWFIIGSLSI-----ETALALSSDSEQPIHIEADRGELDDREQVAVYSGNVH 58

Query: 69  MTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           +TQ    + +D +TI Y  +        +       +       +I   A          
Sbjct: 59  LTQGTLRIDSDTLTIYYTLDKKLEKAVAEGQPAWYRQRPDNSKEDIRAKALRMEYHADTT 118

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY--DGRP 181
            + L      K  + +  N F G +++ N +      +G E+   ++   I    DG P
Sbjct: 119 TIHL----LQKAHIWQGTNEFTGDRIVYNTERDIVRGEGSETGVGRIHVTIHPADDGPP 173


>gi|241202816|ref|YP_002973912.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856706|gb|ACS54373.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 204

 Score =  111 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 83/195 (42%), Gaps = 25/195 (12%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +I     + +      +Q A + M   K+  ++ I I++D LE+ D    A F GNV + 
Sbjct: 3   FIAGAFALILTASGAGAQQATATMPGMKLSNDQPIQIESDKLEIHDQEHTALFTGNVKVV 62

Query: 71  QEDFSLQADKMTIDYNNTNRD------------------------VSNKINRMDVERNIF 106
           Q   ++Q+ KMT+ Y +                             S  I+++ V   +F
Sbjct: 63  QGATTMQSGKMTVYYKDKAAKPATDGTQPAAQPAAQPQQSASLASGSADIDKILVTDKVF 122

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           + SG     A +G  D   +  +L  D   KVIL +  N F GCKL V++ T  A L+ C
Sbjct: 123 LTSGTQTATADDGNFDMASQTFILTADEGKKVILSDGPNVFTGCKLTVHMQTGQAELESC 182

Query: 167 ESDQVQSIIRYDGRP 181
              +VQ  +    +P
Sbjct: 183 -GGRVQIQLDPKSKP 196


>gi|126738423|ref|ZP_01754128.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
 gi|126720222|gb|EBA16928.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
          Length = 154

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 9/161 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +F L  +  +Q A+      K   ++ + + +D L V  A   A F GNV + Q    L 
Sbjct: 1   MFWLTASAWAQNASVAFGSVKADPSQPVEVTSDALAVNQANGSAEFNGNVVIVQGVMRLS 60

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           ADK+ + Y          I R++   N+ + SG     A           +VL G+    
Sbjct: 61  ADKVLVIYKTDES-GKRGIERLEATGNVLLVSGPDAAEAQKADYSIDSGTIVLTGN---- 115

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           V+L +   T    +L VN+ T  A + G    +V++I+   
Sbjct: 116 VLLNQGAGTLTSQRLEVNLTTGTAKMAG----RVKTILAPS 152


>gi|119385333|ref|YP_916389.1| OstA family protein [Paracoccus denitrificans PD1222]
 gi|119375100|gb|ABL70693.1| OstA family protein [Paracoccus denitrificans PD1222]
          Length = 161

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 11/165 (6%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           LL ++  L+ A  +    +          + + + AD L V     +A F GNV + Q  
Sbjct: 7   LLPVILSLVLAAGAALGQTAGFGNAQDIKQPVEVTADALTVDQKTGRATFSGNVLIGQGA 66

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             L AD +T+ Y   ++   +    +  E N+ + SGE    A     D +   +VL GD
Sbjct: 67  MRLSADSVTVTYAQGDQRRISA---LHAEGNVTLASGEDAAEAQAADYDVETGTIVLTGD 123

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
               V+L +  N   G K+ VN+++  A+  G    +V+S+++ +
Sbjct: 124 ----VLLTQGGNLLAGDKVTVNLESGTANASG----RVRSVLQPE 160


>gi|292490480|ref|YP_003525919.1| lipopolysaccharide transport periplasmic protein LptA
           [Nitrosococcus halophilus Nc4]
 gi|291579075|gb|ADE13532.1| lipopolysaccharide transport periplasmic protein LptA
           [Nitrosococcus halophilus Nc4]
          Length = 275

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 60/168 (35%), Gaps = 12/168 (7%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA ++++      + A            + IHI+AD  E+ D  Q A ++GNV +TQ   
Sbjct: 9   LATLWLIFGGLNGETAW----ALSSDQEQPIHIEADRGELDDRKQIAVYRGNVHLTQGTL 64

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS--GEINVIASNGYVDFQKRILVLNG 132
            + +D +TI Y    +                  +   +I   A           + L  
Sbjct: 65  RIDSDILTIYYTPGKKLEKAIAEGQPAWYRQRPDNSDEDIRAKALRMEYHANTATIYL-- 122

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYD 178
               K  + +  N F G +++   +      +G +    +V   IR D
Sbjct: 123 --LQKAHVWQGANEFTGDRIVYETEHDIVRGEGSKTGDGRVHVTIRPD 168


>gi|332999279|gb|EGK18865.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-272]
          Length = 179

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 57/157 (36%), Gaps = 6/157 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A    AA+          ++ IHI++D   +        F GNV +TQ    + ADK+ +
Sbjct: 3   ASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVV 62

Query: 84  DYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                   ++V +   +      +      +   AS  + +  K  +VL G+      L+
Sbjct: 63  TRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY----LQ 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +   G K+   +          +  +V +++   
Sbjct: 119 QVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 155



 Score = 36.8 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 87  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 146

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 147 RVTTVLVPSQLQDKNNKGQT 166


>gi|332559629|ref|ZP_08413951.1| OstA family protein precursor [Rhodobacter sphaeroides WS8N]
 gi|332277341|gb|EGJ22656.1| OstA family protein precursor [Rhodobacter sphaeroides WS8N]
          Length = 158

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 65/169 (38%), Gaps = 13/169 (7%)

Query: 14  LLALVFVLLKADLSQAAASYMTR-FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
             A    L  A  +Q A        K      + I +D L+V  A   A F GNV + Q 
Sbjct: 2   AAAAALWLPMAAHAQGAEVAFGGGLKQDTTLPVEIGSDQLQVNQADGTAVFSGNVRVAQG 61

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
              L A  + ++Y          I R+     + + +G     A       +   +V+ G
Sbjct: 62  PMRLGAQSVRVEY----APGGGAIRRLHASGGVTLANGSEAAEAKEAVYTIESGEVVMTG 117

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           D    V+L +  NT  G KL++++      ++G    +VQ++ +    P
Sbjct: 118 D----VLLTQGPNTLAGQKLVIDLSAGTGRMEG----RVQTVFQPGKAP 158


>gi|260460503|ref|ZP_05808754.1| OstA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259033608|gb|EEW34868.1| OstA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 196

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 54/190 (28%), Positives = 88/190 (46%), Gaps = 19/190 (10%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQA-AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +S  L     AL+ + L    +Q+ AAS M+  K+ G++ I I++D LEV  A   A F 
Sbjct: 5   SSTRLVAATSALLLLGLAPSSAQSGAASQMSGLKLSGDQPIQIESDKLEVHQADSTAIFT 64

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTN--------------RDVSNKINRMDVERNIFIQSG 110
           GNV + Q    ++A KMT+ Y                     S  I+ ++V   ++I+S 
Sbjct: 65  GNVTVVQGATMMKAGKMTVYYVKDPNAGAKGTEAAGAAAMTGSANIDHLEVSSKVYIKSN 124

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           +      NG  D + ++LVL+G    +V+L +  N   GCKL V + +  A +  C   +
Sbjct: 125 DQVATGDNGTFDMKTQVLVLSG---KEVVLSQGDNVLKGCKLTVQMKSGLAQVDAC-GGR 180

Query: 171 VQSIIRYDGR 180
           V   I    +
Sbjct: 181 VIMSITPPPK 190


>gi|91774496|ref|YP_544252.1| OstA-like protein [Methylobacillus flagellatus KT]
 gi|91708483|gb|ABE48411.1| OstA-like protein [Methylobacillus flagellatus KT]
          Length = 176

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 66/168 (39%), Gaps = 11/168 (6%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L+ A L+   +      K   ++ I ++AD ++V DA + + + GNV +TQ    ++ DK
Sbjct: 8   LVLAILAGMLSVSAFAEKADRDKPIELEADAVQVNDAKKTSTYTGNVILTQGTLVIRGDK 67

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
           + +  +      S         R     ++  +         D +   + L  +      
Sbjct: 68  LIVREDKEGFQHSTSYGNPTTFRQKRDGKNEYMEGGGQRIEYDGRMDKVQLFTNA----W 123

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCES------DQVQSIIRYDGRP 181
           +K   +   G  ++ + +  +A +    S       +V++II+   +P
Sbjct: 124 VKRGDDIVHGDYIMYDANAEYAEVISGGSQATTPTGRVRAIIQPRKKP 171


>gi|254503827|ref|ZP_05115978.1| OstA-like protein [Labrenzia alexandrii DFL-11]
 gi|222439898|gb|EEE46577.1| OstA-like protein [Labrenzia alexandrii DFL-11]
          Length = 193

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 79/183 (43%), Gaps = 16/183 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +   + + + +    +Q  +     F     + I I+++ L+V+D  + A F G+V + Q
Sbjct: 10  LVAFSALMLAIAPLSAQTFSDSFAGFGSSDGQPIEIESNELKVEDQTKVATFIGDVVVIQ 69

Query: 72  EDFSLQADKMTIDYNNTNR------------DVSNKINRMDVERNIFIQSGEINVIASNG 119
            D  L+  ++ + Y+   +                +I+R++    + I S +        
Sbjct: 70  GDTRLETSQLKVFYDGDGQSSEGADTSNGAVPAQQEISRLEASGGVHISSEDQTATGDEA 129

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRYD 178
             D +  ++V+ G    +V+LK+  N  +G +L VN+ T  A+L    +  +V+  I  +
Sbjct: 130 NFDMKTEVMVMTG---KEVVLKQGGNVVVGNRLTVNLKTGQANLNAPADDGRVRVRILPN 186

Query: 179 GRP 181
             P
Sbjct: 187 SAP 189


>gi|333015003|gb|EGK34347.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-227]
          Length = 171

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 57/157 (36%), Gaps = 6/157 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A    AA+          ++ IHI++D   +        F GNV +TQ    + ADK+ +
Sbjct: 3   ASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVV 62

Query: 84  DYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                   ++V +   +      +      +   AS  + +  K  +VL G+      L+
Sbjct: 63  TRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY----LQ 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +   G K+   +          +  +V +++   
Sbjct: 119 QVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 155



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 87  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 146

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 147 RVTTVLVPSQLQDKNNKGQT 166


>gi|301025898|ref|ZP_07189385.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 196-1]
 gi|309785528|ref|ZP_07680159.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae 1617]
 gi|312968461|ref|ZP_07782670.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 2362-75]
 gi|312972526|ref|ZP_07786700.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1827-70]
 gi|299879920|gb|EFI88131.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli MS 196-1]
 gi|307555293|gb|ADN48068.1| lipopolysaccharide ABC transporter [Escherichia coli ABU 83972]
 gi|308926648|gb|EFP72124.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae 1617]
 gi|310334903|gb|EFQ01108.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1827-70]
 gi|312286679|gb|EFR14590.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 2362-75]
 gi|313648557|gb|EFS12999.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2a str. 2457T]
 gi|315617283|gb|EFU97892.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 3431]
 gi|323162892|gb|EFZ48727.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli E128010]
 gi|323165161|gb|EFZ50951.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           sonnei 53G]
 gi|323173540|gb|EFZ59169.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli LT-68]
 gi|323178624|gb|EFZ64200.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1180]
 gi|323183154|gb|EFZ68552.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli 1357]
 gi|323189179|gb|EFZ74463.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           coli RN587/1]
 gi|332086471|gb|EGI91618.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           dysenteriae 155-74]
 gi|332090699|gb|EGI95793.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           boydii 3594-74]
 gi|332752359|gb|EGJ82749.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 4343-70]
 gi|332752885|gb|EGJ83270.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-671]
 gi|332765196|gb|EGJ95423.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri 2930-71]
          Length = 173

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 57/157 (36%), Gaps = 6/157 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A    AA+          ++ IHI++D   +        F GNV +TQ    + ADK+ +
Sbjct: 3   ASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVV 62

Query: 84  DYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                   ++V +   +      +      +   AS  + +  K  +VL G+      L+
Sbjct: 63  TRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY----LQ 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +   G K+   +          +  +V +++   
Sbjct: 119 QVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 155



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 87  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 146

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 147 RVTTVLVPSQLQDKNNKGQT 166


>gi|190890074|ref|YP_001976616.1| hypothetical protein RHECIAT_CH0000444 [Rhizobium etli CIAT 652]
 gi|190695353|gb|ACE89438.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327193442|gb|EGE60340.1| hypothetical protein RHECNPAF_159005 [Rhizobium etli CNPAF512]
          Length = 212

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 21/190 (11%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
               A   +L  +  +   A+ M+  K+  ++ I I++D LE+ D    A F G V + Q
Sbjct: 16  FIAGAFALILTVSGAAAQQATTMSGMKLSNDQPIQIESDKLEIHDQEHTALFTGKVKVVQ 75

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDV--------------------ERNIFIQSGE 111
              ++Q+ KMT+ Y +     +    +                          + + SG 
Sbjct: 76  GTTTMQSGKMTVYYKDKAAKPAADGAQPAAQPEKSASLASGSADIDKILVTDKVLLTSGT 135

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
               A +G  D   +   L  D+ +KVIL +  N F GCKL V++ T  A L+ C   +V
Sbjct: 136 QTATADDGKFDMASQTFTLTADQGNKVILSDGPNVFTGCKLTVHMQTGQAELESC-GGRV 194

Query: 172 QSIIRYDGRP 181
           Q  +    +P
Sbjct: 195 QIQLDPKSQP 204


>gi|91974658|ref|YP_567317.1| OstA-like protein [Rhodopseudomonas palustris BisB5]
 gi|91681114|gb|ABE37416.1| OstA-like protein [Rhodopseudomonas palustris BisB5]
          Length = 221

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 80/188 (42%), Gaps = 24/188 (12%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++   A +   L     Q   + M  F    ++ I I++D LEV+D  ++A F G+V + 
Sbjct: 21  FLAGSANLSGALAQSAVQGVPNAMQGFSQNRDQPIQIESDTLEVRDKKKEATFTGSVKVV 80

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKI-------------------NRMDVERNIFIQSGE 111
           Q D ++ +  + + Y+    + S K                     R++ + N+ +   +
Sbjct: 81  QGDTTMTSKTLVVFYDQDQSETSAKQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQKD 140

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
             V   +   D +  ++ + G     V+L +  N   G +L+V++ T  + ++   S +V
Sbjct: 141 QVVTGDSAVFDTKTNLVTMLG----SVVLTQGKNVVRGDRLLVDMTTGVSRVES-NSGRV 195

Query: 172 QSIIRYDG 179
           Q + +  G
Sbjct: 196 QGLFQSSG 203


>gi|86136832|ref|ZP_01055410.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
 gi|85826156|gb|EAQ46353.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
          Length = 168

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L+I L++ ++  L    + A        K   +  + + +D L V  A   A F G+V +
Sbjct: 7   LFIFLISTLWFTLP---AAAQNVAFGAVKADPSLPVEVTSDALSVNQADGSAEFTGSVLI 63

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
            Q    L AD++ + Y   +      I+R++   ++ + SG     A        +  +V
Sbjct: 64  VQGVMKLSADRVLVIYKTDDT-GKRAIDRLEATGSVLLVSGPDAAEAQRADYTIDEGTIV 122

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L GD    V+L +   T    +++VN+ T  AS+ G    +V++I+   
Sbjct: 123 LTGD----VLLNQSAGTLASQRMVVNLTTGTASMAG----RVKTILNPS 163


>gi|253686681|ref|YP_003015871.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753259|gb|ACT11335.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 190

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 60/180 (33%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +  N++     + + +F +  +  +              N+ I I +    +      
Sbjct: 1   MKSKTNNLMRNTLIASSLFAVSVSAFA---------VTGDSNQPIRIDSAQQSLDMQGNT 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV + Q    ++ADK+ +      +  +V            +      +   A  
Sbjct: 52  VTFTGNVVVKQGTIEVKADKVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGHAQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              +  K +LVL G+      L+++ +   G ++   +          +  +V +++   
Sbjct: 112 IRYELAKDLLVLTGNAY----LEQQDSNVKGDRITYLVKQQQMEATSEKGKRVTTVLVPS 167



 Score = 34.1 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 9/91 (9%), Positives = 31/91 (34%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q+D +++ D++T        + +++  +
Sbjct: 99  QDNGKPVKGHAQKIRYELAKDLLVLTGNAYLEQQDSNVKGDRITYLVKQQQMEATSEKGK 158

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILV 129
                 +  Q  +    +        +  + 
Sbjct: 159 RVTTVLVPSQLQDKENKSQPSRSQQPQPRVT 189


>gi|95928725|ref|ZP_01311471.1| OstA-like protein [Desulfuromonas acetoxidans DSM 684]
 gi|95135070|gb|EAT16723.1| OstA-like protein [Desulfuromonas acetoxidans DSM 684]
          Length = 162

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 73/171 (42%), Gaps = 13/171 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L   ++  V V     +++         +   ++ IH+ +  LE  DA     F G V
Sbjct: 1   MRLLFLIICTVLVGFTPAMAE------PDMEHDASQPIHVTSQRLEANDAKGFFIFTGEV 54

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
              Q D ++ A KMTI Y++  +    +++R+  E+++ I          N     +   
Sbjct: 55  QAQQGDVTMYAHKMTIYYSDGEQ---RQVDRVVAEKDVRIVQLNRVATGQNAVFWQKDGR 111

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           + L GD      + +  N   G K+IV ++ S + ++G +  +V+++    
Sbjct: 112 VELTGDPR----VVQGENVVEGEKIIVYLNESRSIVEGGKQGRVKAVFVPG 158


>gi|50119250|ref|YP_048417.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium atrosepticum SCRI1043]
 gi|49609776|emb|CAG73210.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 190

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 58/180 (32%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +  N++     + + +F +  +  +              N+ IHI +    +      
Sbjct: 1   MKSKTNNLMRNTLIASSLFAVSISTFA---------VTGDSNQPIHIDSAQQSLDMQGNT 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNN--TNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV + Q    ++ADK+ +         +V            +      +   A  
Sbjct: 52  VTFTGNVVVKQGTIEVKADKVVVTRPQGGQGSEVVEGYGNPVTFYQMQDNGKPVKGHAQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              +     LVL G+      L+++ +   G ++   +          +  +V +++   
Sbjct: 112 IRYELATDFLVLTGNAY----LEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTVLVPS 167


>gi|261819637|ref|YP_003257743.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium wasabiae WPP163]
 gi|261603650|gb|ACX86136.1| lipopolysaccharide transport periplasmic protein LptA
           [Pectobacterium wasabiae WPP163]
          Length = 190

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/180 (12%), Positives = 58/180 (32%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +  N++     + + +F +  +  +              N+ I I +    +      
Sbjct: 1   MKSKTNNLMRNTLIASSLFAVSVSAFA---------VTGDSNQPIRIDSAQQSLDMQGNT 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV + Q    ++ADK+ +      +  +V            +      +   A  
Sbjct: 52  VTFTGNVVVKQGTIEVKADKVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGHAQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              +     LVL G+      L+++ +   G ++   +          +  +V +++   
Sbjct: 112 IRYELATDFLVLTGNAY----LEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTVLVPS 167


>gi|85705767|ref|ZP_01036864.1| hypothetical protein ROS217_10717 [Roseovarius sp. 217]
 gi|85669757|gb|EAQ24621.1| hypothetical protein ROS217_10717 [Roseovarius sp. 217]
          Length = 167

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 66/171 (38%), Gaps = 13/171 (7%)

Query: 9   HLYIHLLALVFVLLKAD-LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
            +   +LA   +L     L+Q A       +   N  + + +D L V  A   A F GNV
Sbjct: 6   RISSLILAFALLLPPVVTLAQGAQVAFGNTQADRNLPVEVTSDSLSVNQADNTATFTGNV 65

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q    L A ++ + Y        + I  +     + + SGE    A     D    +
Sbjct: 66  VIGQGAMRLAAPEVLVVYLPD----KSGIESLKATGGVTLVSGEDAAEAERADYDITTGM 121

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           + L G+    V+L +  N   G  + V+     A + G    +V++I++  
Sbjct: 122 IELRGN----VLLVQGTNAITGETVFVDTAAGTAQVSG----RVKTILQPG 164


>gi|254476217|ref|ZP_05089603.1| OstA family protein [Ruegeria sp. R11]
 gi|214030460|gb|EEB71295.1| OstA family protein [Ruegeria sp. R11]
          Length = 159

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 10/166 (6%)

Query: 8   IHLYIHLLALVFVLLKADL-SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           ++L + +  L F LL A + +Q A+      K   +  + + AD L+V      A F GN
Sbjct: 1   MYLRVLMFCLPFALLSAGVSAQNASIAFGAVKADPSLPVEVTADALDVNQQDGSARFVGN 60

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           V + Q    L AD + + Y   +      + R++   N+ + +G     A          
Sbjct: 61  VIIIQGVMRLSADDVLVIYKQDDG-GKTGVERLEAAGNVILVNGPDAAEADKAEYTIDSG 119

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
            +V+ G+    V+L +   T    +L+VN+ T  AS+    S +V+
Sbjct: 120 TVVMTGN----VLLSQGTGTLTSNRLVVNLTTGTASM----SRRVR 157


>gi|16762080|ref|NP_457697.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29143569|ref|NP_806911.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56415247|ref|YP_152322.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|161616328|ref|YP_001590293.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|224585115|ref|YP_002638914.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|25352006|pir||AE0905 conserved hypothetical protein STY3497 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504383|emb|CAD07835.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139204|gb|AAO70771.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129504|gb|AAV79010.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161365692|gb|ABX69460.1| hypothetical protein SPAB_04136 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|224469643|gb|ACN47473.1| hypothetical protein SPC_3388 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 172

 Score =  108 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 55/157 (35%), Gaps = 6/157 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A    AA+           + IHI +D   +        F GNV MTQ    + ADK+ +
Sbjct: 3   AGSLLAASIPAFAVTGDTEQPIHIDSDQQSLDMQGNVVTFTGNVVMTQGTIKINADKVVV 62

Query: 84  DYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                   ++V +          +      +   AS+ + +  K  +VL G+      L+
Sbjct: 63  TRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDFVVLTGNAY----LE 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +   G K+   +          +  +V +++   
Sbjct: 119 QLDSNITGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 155


>gi|311277827|ref|YP_003940058.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cloacae SCF1]
 gi|308747022|gb|ADO46774.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cloacae SCF1]
          Length = 185

 Score =  108 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 57/164 (34%), Gaps = 6/164 (3%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L   L    +  AA+          ++ IHI++D   +      A F GNV +TQ    +
Sbjct: 8   LSLKLALTSVLLAASLPALALTGDTDQPIHIESDQQSLDMQGNVATFTGNVIVTQGSIKI 67

Query: 77  QADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            ADK+ +        ++  +          +      +   +S  + +     +VL G+ 
Sbjct: 68  NADKVVVTRPGGEKGKETIDGYGNPATFYQMQDNGKPVKGHSSKMHYETANDFVVLTGNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L++  +   G K+   +          +  +V +++   
Sbjct: 128 Y----LEQLDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPS 167


>gi|317494039|ref|ZP_07952455.1| lipopolysaccharide transport periplasmic protein LptA
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917812|gb|EFV39155.1| lipopolysaccharide transport periplasmic protein LptA
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 209

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 23/180 (12%), Positives = 54/180 (30%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N   L + +   +       L+               + IHI +    +      
Sbjct: 1   MKFKTNHKILSLIVAGTLLTASVPALA---------LTGDTEQPIHIDSAQQSLDMQGNT 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASN 118
             F G+V +TQ    + ADK+ +   N  +                +      ++     
Sbjct: 52  VTFTGDVVVTQGTIKINADKVVVIRPNGAQGKEVVEGYGNPVTFYQMQDNGKPVSGHGQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              +  K  ++L G+      L++  ++  G K+   +          +  +V +++   
Sbjct: 112 LRYELDKDFVILTGNAF----LQQVDSSIKGDKITYLVKQQQMEAFSDKGKRVTTVLIPS 167


>gi|159184263|ref|NP_353366.2| hypothetical protein Atu0334 [Agrobacterium tumefaciens str. C58]
 gi|159139590|gb|AAK86151.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 187

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/168 (29%), Positives = 82/168 (48%), Gaps = 7/168 (4%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
                L     +Q   S M   K+ G++ I I++D LE++D  +KA+F GNV + Q   +
Sbjct: 21  LFFSCLATVAFAQNTTSSMQGVKLSGDQPIAIESDQLEIRDQERKAYFTGNVKVVQGTTT 80

Query: 76  LQADKMTIDYNNTN---RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           LQA KMT++Y             I ++ V+ N+++ S      A +G  D   +  +L G
Sbjct: 81  LQAGKMTVNYKGQGSSLTSGDANIEKIFVDNNVYLTSETQKATADHGEFDMAAQTFILTG 140

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
               +V+L E  N F GCKL V ++T  A L+ C    V+ ++    +
Sbjct: 141 ---KQVVLSEGTNVFTGCKLTVLMNTGQAKLESC-GGPVRIMLDPKSQ 184


>gi|163738081|ref|ZP_02145497.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
 gi|161388697|gb|EDQ13050.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
          Length = 165

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 74/169 (43%), Gaps = 10/169 (5%)

Query: 8   IHLYIHLLAL-VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           ++L + +  L V +      +Q+A+      K   ++ + + A+ L+V  A   A F G+
Sbjct: 1   MYLRVLMFCLPVTLFSTGLSAQSASIAFGAVKADPSQPVEVTAETLDVNQADGSARFIGD 60

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           V + Q    L A+ + + Y          + R++   N+ + +G     A          
Sbjct: 61  VVIIQGVMRLSANDVLVIYKQDET-GKTGVERLEASGNVILVNGPDAAEADKAEYTIDSG 119

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            +V+ G+    V+L +   T    +L+V++ T  ASL G    +V++I+
Sbjct: 120 TVVMTGN----VLLSQSTGTLTSNRLVVDLTTGTASLSG----RVKTIL 160


>gi|260596170|ref|YP_003208741.1| lipopolysaccharide export system protein lptA [Cronobacter
           turicensis z3032]
 gi|260215347|emb|CBA27339.1| Lipopolysaccharide export system protein lptA [Cronobacter
           turicensis z3032]
          Length = 167

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 54/153 (35%), Gaps = 6/153 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN- 86
            AA            + IHI++D   +        F GNV +TQ    + ADK+ +    
Sbjct: 1   MAAGFPAFALTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTRPS 60

Query: 87  -NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            +  ++V +          +      +   AS  + + Q   +VL G+      L++  +
Sbjct: 61  GDKGKEVIDGYGNPATFYQMQDNGKPVKGHASTMHYELQSDFVVLTGNAY----LEQLDS 116

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G K+   +          +  +V +++   
Sbjct: 117 NIKGDKITYLVKEQKMQAFSEKGKRVTTVLVPS 149



 Score = 35.3 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 10/79 (12%), Positives = 25/79 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  +         GN ++ Q D +++ DK+T           ++  +
Sbjct: 81  QDNGKPVKGHASTMHYELQSDFVVLTGNAYLEQLDSNIKGDKITYLVKEQKMQAFSEKGK 140

Query: 99  MDVERNIFIQSGEINVIAS 117
                 +  Q    +  A 
Sbjct: 141 RVTTVLVPSQLQNKDGAAQ 159


>gi|163742523|ref|ZP_02149909.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
 gi|161384108|gb|EDQ08491.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
          Length = 165

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 71/168 (42%), Gaps = 10/168 (5%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + + +  L +         +Q+A+      K   ++ + + A+ L+V  A   A F G+V
Sbjct: 3   LRVLMFCLPVTLFYTGLS-AQSASIAFGAVKADPSQPVEVTAETLDVNQADGSARFIGDV 61

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q    L A+ + + Y          + R++   N+ + +G     A           
Sbjct: 62  VIIQGVMRLSANDVLVIYKQDET-GKTGVERLEASGNVILVNGPDAAEADKAEYTIDSGT 120

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           +V+ G+    V+L +   T    +L+V++ T  ASL G    +V++I+
Sbjct: 121 VVMTGN----VLLSQSTGTLTSNRLVVDLTTGTASLSG----RVKTIL 160


>gi|271498864|ref|YP_003331889.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech586]
 gi|270342419|gb|ACZ75184.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya
           dadantii Ech586]
          Length = 192

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 56/165 (33%), Gaps = 6/165 (3%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           + ++  +L A    A +           + IHI +D   +        F GNV +TQ   
Sbjct: 7   INVLHSILIASSLFAVSIPALALTGDTEQPIHITSDQQALDMQGNVVTFTGNVIVTQGSI 66

Query: 75  SLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
             QADK+ +   N     ++            +      +   A     +  K+++ L G
Sbjct: 67  KAQADKVVVTRPNGQQGHEIIEGYGNPATFYQMQDNGKPVKGHAQKIRYEMDKQLVTLTG 126

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           +      L++  +   G ++   +          +  +V +++  
Sbjct: 127 NAY----LEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVP 167



 Score = 34.9 bits (78), Expect = 5.4,   Method: Composition-based stats.
 Identities = 9/77 (11%), Positives = 25/77 (32%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  +   Q     GN ++ Q D +++ D++T        +  +   +
Sbjct: 100 QDNGKPVKGHAQKIRYEMDKQLVTLTGNAYLEQLDSNVKGDRITYLVQQQQMEAFSDKGK 159

Query: 99  MDVERNIFIQSGEINVI 115
                 +  Q  +    
Sbjct: 160 RVTTVLVPTQLQDKGAQ 176


>gi|149201446|ref|ZP_01878421.1| hypothetical protein RTM1035_17512 [Roseovarius sp. TM1035]
 gi|149145779|gb|EDM33805.1| hypothetical protein RTM1035_17512 [Roseovarius sp. TM1035]
          Length = 152

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/164 (19%), Positives = 66/164 (40%), Gaps = 12/164 (7%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           + +L     +QA      + +      + + +D L V  A   A F GNV + Q +  L 
Sbjct: 1   MALLPVGAWAQAGQVAFGKTQADRGLPVEVTSDNLSVNQADNTATFTGNVVIGQGEMRLA 60

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           A ++ + Y        + I  ++    + + SGE    A     +    ++ L G+    
Sbjct: 61  APRVLVVYLPDR----SGIESLEATGGVTLVSGEDAAEAERADYNISTGLIELRGN---- 112

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           V+L +  +   G  ++V+     A + G    +V++I++    P
Sbjct: 113 VLLVQGTSAIAGETVLVDTAAGTAQVSG----RVKTILQPGTTP 152


>gi|325291769|ref|YP_004277633.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
 gi|325059622|gb|ADY63313.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
          Length = 218

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 86/173 (49%), Gaps = 8/173 (4%)

Query: 12  IHLLALVF-VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +   A  F  L     +Q   S MT  K+ G++ I I++D LE++D  +KA+F GNV + 
Sbjct: 46  VTAAAFAFSCLATVAFAQNTTSNMTGVKLSGDQPIAIESDQLEIRDQERKAYFTGNVKVV 105

Query: 71  QEDFSLQADKMTIDYNNTN---RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
           Q   +LQA KMT++Y             I ++ V+ N+++ S      A +G  D   + 
Sbjct: 106 QGTTTLQAGKMTVNYKGEGSSLTSGDANIEKIFVDNNVYLTSETQKATADHGEFDMAAQT 165

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +L G    +V+L E  N F GCKL V +++  A L+ C    V+ ++    +
Sbjct: 166 FILTG---KQVVLSEGANVFTGCKLTVLMNSGQAKLESC-GGPVRIMLDPKSQ 214


>gi|227326632|ref|ZP_03830656.1| hypothetical protein PcarcW_04634 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 182

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 52/159 (32%), Gaps = 6/159 (3%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L A    A +          N+ IHI +    +        F GNV + Q    ++ADK+
Sbjct: 5   LIASSLFAVSVSAVALTGDSNQPIHIDSAQQSLDMQGNTVTFTGNVVVKQGTIEVKADKV 64

Query: 82  TIDYNNTNR--DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
            +      +  +V            +      +   A     +  K  LVL G+      
Sbjct: 65  VVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGHAQKIRYELAKDFLVLTGNAY---- 120

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L+++ +   G ++   +          +  +V +++   
Sbjct: 121 LEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTVLVPS 159


>gi|220925753|ref|YP_002501055.1| OstA family protein [Methylobacterium nodulans ORS 2060]
 gi|219950360|gb|ACL60752.1| OstA family protein [Methylobacterium nodulans ORS 2060]
          Length = 239

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/181 (19%), Positives = 64/181 (35%), Gaps = 35/181 (19%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN- 89
            S    F   G E I I AD L+V D   KA F GNV   Q + +++   MT+ Y     
Sbjct: 33  NSGFGAFGSSGKEPIKIDADRLDVFDHENKAIFAGNVVAVQGESTIRCSSMTVHYQRNRD 92

Query: 90  ------------------------------RDVSNKINRMDVERNIFIQSGEINVIASNG 119
                                            S  I ++     + + + +      N 
Sbjct: 93  KDAKDGAKSADKPADGKAPDAKTSDAKPADPTDSGAIKQVVCAGPVTVVNKDQVATGDNA 152

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             D     ++L G+    V+L +  N   G +L+ +++T  A++      +V ++    G
Sbjct: 153 VFDKAANRVILTGN----VVLSQCQNVTRGNRLVYDMNTGRANMDPTAGGRVSAMFVPGG 208

Query: 180 R 180
           +
Sbjct: 209 K 209


>gi|218550483|ref|YP_002384274.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           fergusonii ATCC 35469]
 gi|218358024|emb|CAQ90670.1| putative lipopolysaccharide transport protein A:
           periplasmic-binding component of ABC superfamily
           [Escherichia fergusonii ATCC 35469]
 gi|324115196|gb|EGC09160.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           fergusonii B253]
 gi|325498781|gb|EGC96640.1| lipopolysaccharide transport periplasmic protein LptA [Escherichia
           fergusonii ECD227]
          Length = 185

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 51/148 (34%), Gaps = 6/148 (4%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNR 90
                     + IHI++D   +        F GNV +TQ    + ADK+ +        +
Sbjct: 24  PALAVTGDTEQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTRPGGEQGK 83

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
           +V +          +      +   AS  + +  K  +VL G+      L++  +   G 
Sbjct: 84  EVIDGYGNPATFYQMQDNGKPVEGHASKMHYELAKDFVVLTGNAY----LQQVDSNIKGD 139

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           K+   +          +  +V +++   
Sbjct: 140 KITYLVKEQKMQAFSDKGKRVTTVLVPS 167



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/79 (13%), Positives = 25/79 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 99  QDNGKPVEGHASKMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVIAS 117
                 +  Q  + N    
Sbjct: 159 RVTTVLVPSQLQDKNNKGQ 177


>gi|251791371|ref|YP_003006092.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya zeae
           Ech1591]
 gi|247539992|gb|ACT08613.1| lipopolysaccharide transport periplasmic protein LptA [Dickeya zeae
           Ech1591]
          Length = 189

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 57/165 (34%), Gaps = 6/165 (3%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           + ++  +L A    A +           + IHI +D   +        F GNV +TQ   
Sbjct: 7   INVLHSILIASSLFAVSIPALALTGDTEQPIHITSDQQALDMQGNVVTFTGNVLVTQGSI 66

Query: 75  SLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
             QADK+ +   N     +V            +      +   A     +  K++++L G
Sbjct: 67  KAQADKVVVTRPNGQQGHEVIEGYGNPATFYQMQDNGKPVKGHAQKMRYEMDKQLVILTG 126

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D      L++  +   G ++   +          +  +V +++  
Sbjct: 127 DAY----LEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVP 167


>gi|77166243|ref|YP_344768.1| OstA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|254435695|ref|ZP_05049202.1| cell envelope biogenesis protein YhbN, putative [Nitrosococcus
           oceani AFC27]
 gi|76884557|gb|ABA59238.1| OstA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|207088806|gb|EDZ66078.1| cell envelope biogenesis protein YhbN, putative [Nitrosococcus
           oceani AFC27]
          Length = 275

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 63/178 (35%), Gaps = 12/178 (6%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            L + L A+ F++         A           + IHI+A+  E+ D    A + GNV 
Sbjct: 4   RLSLKLTAVGFIISSNLSIIETAL---ALSSDSEQPIHIEANRGELDDREHVAVYSGNVH 60

Query: 69  MTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           +TQ    + +D +TI Y  +        +       +     + +I   A          
Sbjct: 61  LTQGTLRIDSDTLTIYYTPDKKLEKAVAEGQPAWYRQRPDNSNEDIRAKALRMEYHADTA 120

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY-DGRP 181
            + L      K  + +  N F G +++ + +      +G E+   ++   I   D  P
Sbjct: 121 TIHL----LQKAQVWQGTNEFTGDRIVYDTERDIVRGEGSETGVGRIHVTIHPADDSP 174



 Score = 38.4 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 12/122 (9%), Positives = 30/122 (24%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
            +++   ++  +     NE I  KA  +E               + Q       D++  D
Sbjct: 86  AVAEGQPAWYRQRPDNSNEDIRAKALRMEYHADTATIHLLQKAQVWQGTNEFTGDRIVYD 145

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                         +         + +      +   +           + D+  L +  
Sbjct: 146 TERDIVRGEGSETGVGRIHVTIHPADDSPSTGESTPENTTSTTSPPENKKNDRQELTDGR 205

Query: 145 NT 146
            T
Sbjct: 206 TT 207


>gi|307129065|ref|YP_003881081.1| periplasmic component of an ABC-type LPS transporter complex
           [Dickeya dadantii 3937]
 gi|306526594|gb|ADM96524.1| periplasmic component of an ABC-type LPS transporter complex
           [Dickeya dadantii 3937]
          Length = 192

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 58/165 (35%), Gaps = 6/165 (3%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           + ++  +L A    A +          ++ IHI +D   +        F GNV +TQ   
Sbjct: 7   INVLHSILIASSLFAVSVPALALTGDTDQPIHITSDQQALDMQGNVVTFTGNVIVTQGSI 66

Query: 75  SLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
             QADK+ +   N     +V            +      +   +     +  K++++L G
Sbjct: 67  KAQADKVVVTRPNGQQGHEVIEGYGNPATFYQMQDNGKPVKGHSQKMRYEMDKQLVILTG 126

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D      L++  +   G ++   +          +  +V +++  
Sbjct: 127 DAY----LEQLDSNVKGDRITYLVQQQQMEAFSDKGKRVTTVLVP 167


>gi|308274285|emb|CBX30884.1| hypothetical protein N47_E43960 [uncultured Desulfobacterium sp.]
          Length = 543

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/175 (22%), Positives = 78/175 (44%), Gaps = 10/175 (5%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           Y  +++ + V L   ++ A  +         +EKIHI AD L      + A F GNV   
Sbjct: 6   YYSIISFLMVFLILSVASAEDTA--SLNAESSEKIHITADSLISDSNAKFAEFIGNVEAI 63

Query: 71  QEDFSLQADKMTIDY-----NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
           Q +F + +DK+ I Y     +      S+ I ++    N+FI+S +++ +      +   
Sbjct: 64  QGEFVINSDKLKIFYKGDAKDKAASGTSDSIEKIIATGNVFIKSKDMSAVTQQAQYNTDT 123

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            I+ L G+ +    + ++ N   G K+I+        ++G +S +V ++     +
Sbjct: 124 MIITLTGEGSK---VFDQKNFVTGSKIILYRKEGVTKVEGDKSKRVTAVFYPKEK 175


>gi|86747783|ref|YP_484279.1| OstA-like protein [Rhodopseudomonas palustris HaA2]
 gi|86570811|gb|ABD05368.1| OstA-like protein [Rhodopseudomonas palustris HaA2]
          Length = 219

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 78/188 (41%), Gaps = 25/188 (13%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
               A           Q   + M  F    ++ I I++D LEV+D  ++A F G+V + Q
Sbjct: 19  FLAGATCGGAWAQSAVQGVPNAMQGFSQNKDQPIQIESDTLEVRDKKKEATFAGSVKVIQ 78

Query: 72  EDFSLQADKMTIDYNNTNRD--------------------VSNKINRMDVERNIFIQSGE 111
            D ++ +  + + Y+    D                     ++ I R++ + N+ +   +
Sbjct: 79  GDTTMTSKSLVVFYDQDQPDAAAKPQAKRKTMPAATPGPGGASAIRRLEAKGNVVVTQKD 138

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
             V   +   D +  ++ + G+    V+L +  N   G +LIV++ T  + ++   S +V
Sbjct: 139 QVVTGDSAVFDTKTNLVTMLGN----VVLTQAKNVVRGDRLIVDMTTGVSRVES-NSGRV 193

Query: 172 QSIIRYDG 179
           Q + +  G
Sbjct: 194 QGLFQSSG 201


>gi|189425227|ref|YP_001952404.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           lovleyi SZ]
 gi|189421486|gb|ACD95884.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           lovleyi SZ]
          Length = 182

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 76/176 (43%), Gaps = 9/176 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGN-EKIHIKADMLEVKDAVQKAFF 63
           +  I   + L+++  + +   ++ +  +         +   I IKAD L+  +  + A F
Sbjct: 1   MGKIERILVLVSVWLLGVLPAVAASQPASGGAAARDRSSRPITIKADELKADNKGKIATF 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            G V   QED ++ +DK+ I Y +    V    ++++   ++ I          +   + 
Sbjct: 61  TGRVVARQEDVTIYSDKLVIYYGDKQDQV----DKIEAIGSVRILQTNRIGTGGHALYES 116

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           ++  + L+G+      + +  ++  G  ++  +D   + + G E+ +V+++I    
Sbjct: 117 REGKITLSGNPK----VTQDKDSITGKVIVYYLDDDRSVVIGGENARVEAVIHPTK 168


>gi|89067361|ref|ZP_01154874.1| hypothetical protein OG2516_10991 [Oceanicola granulosus HTCC2516]
 gi|89046930|gb|EAR52984.1| hypothetical protein OG2516_10991 [Oceanicola granulosus HTCC2516]
          Length = 161

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 63/156 (40%), Gaps = 12/156 (7%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           +     +   +       +  + + AD L V      A F GNV + Q +  + A ++ +
Sbjct: 17  SAGWAQSNVDLGGISADPDAPVEVTADSLSVNREEGTAVFSGNVLIGQGELRISAAEVQV 76

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            Y+      +  I R+     + + +      A     D     LV+ GD    V+L + 
Sbjct: 77  IYSEE----TGDITRLLASGGVTMVTETEQAEAQTADYDIDAGQLVMEGD----VLLTQG 128

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            +     +++V++DT  A + G    +V+++ + DG
Sbjct: 129 ASALSAGRMVVDLDTGAAQMDG----RVRTVFQQDG 160


>gi|294634658|ref|ZP_06713191.1| lipopolysaccharide transport periplasmic protein LptA [Edwardsiella
           tarda ATCC 23685]
 gi|291091904|gb|EFE24465.1| lipopolysaccharide transport periplasmic protein LptA [Edwardsiella
           tarda ATCC 23685]
          Length = 185

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 53/160 (33%), Gaps = 6/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L+ A     A++         ++ IHI +    +      A F G+V +TQ    + ADK
Sbjct: 13  LILAASLLTASASALAVTGDTDQPIHINSMQQSLDMQGNVATFTGDVIVTQGTIKITADK 72

Query: 81  MTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +   N  +                +      +   +     +  K  ++L G+     
Sbjct: 73  VVVTRPNGEQGKEIVEAYGNPVTFYQMQDNGKPVEGHSQKLRYELAKDYVILTGNA---- 128

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +L +  +   G ++   +          +  +V +++   
Sbjct: 129 VLTQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTTVLLPS 168


>gi|262273850|ref|ZP_06051663.1| LptA protein [Grimontia hollisae CIP 101886]
 gi|262222265|gb|EEY73577.1| LptA protein [Grimontia hollisae CIP 101886]
          Length = 170

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 68/178 (38%), Gaps = 15/178 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N     +  + ++ +L  + L+               + I+I +D   +        F 
Sbjct: 1   MNKKRTNVFAV-VLMLLSGSALA---------LSTDSEQPIYIDSDSQNLDMKTNTVVFT 50

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           GNV++ Q    L+ADK+ +         +V +   +            +IN  A +   +
Sbjct: 51  GNVYLRQGSIRLRADKVVVTRPSGEEGAEVIDAYGKPAAFEQTMDDGKKINGEAFDLRYE 110

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             K  L++  +    V+ +E  N   G K+  NID      +  +S +V ++++   +
Sbjct: 111 TAKSFLIMKRNA---VLTQEGGNQVEGQKITYNIDKQLLVAESDDSSRVTTVLQPQTK 165


>gi|186972769|pdb|2R19|A Chain A, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Orthorhombic Form
 gi|186972770|pdb|2R19|B Chain B, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Orthorhombic Form
 gi|186972771|pdb|2R1A|A Chain A, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972772|pdb|2R1A|B Chain B, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972773|pdb|2R1A|C Chain C, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972774|pdb|2R1A|D Chain D, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972775|pdb|2R1A|E Chain E, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972776|pdb|2R1A|F Chain F, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972777|pdb|2R1A|G Chain G, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
 gi|186972778|pdb|2R1A|H Chain H, Crystal Structure Of The Periplasmic Lipopolysaccharide
           Transport Protein Lpta (Yhbn), Trigonal Form
          Length = 159

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 53/145 (36%), Gaps = 6/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVS 93
                 ++ IHI++D   +        F GNV +TQ    + ADK+ +        ++V 
Sbjct: 1   AVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVI 60

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +   +      +      +   AS  + +  K  +VL G+      L++  +   G K+ 
Sbjct: 61  DGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAY----LQQVDSNIKGDKIT 116

Query: 154 VNIDTSFASLQGCESDQVQSIIRYD 178
             +          +  +V +++   
Sbjct: 117 YLVKEQKMQAFSDKGKRVTTVLVPS 141



 Score = 36.4 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 73  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 132

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 133 RVTTVLVPSQLQDKNNKGQT 152


>gi|152972124|ref|YP_001337270.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206580902|ref|YP_002236388.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Klebsiella
           pneumoniae 342]
 gi|238896707|ref|YP_002921452.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           pneumoniae NTUH-K2044]
 gi|262042760|ref|ZP_06015914.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288933372|ref|YP_003437431.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           variicola At-22]
 gi|290511577|ref|ZP_06550946.1| hypothetical protein HMPREF0485_03348 [Klebsiella sp. 1_1_55]
 gi|329997610|ref|ZP_08302879.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           sp. MS 92-3]
 gi|150956973|gb|ABR79003.1| putative transport protein (ABC superfamily, peri_bind) [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206569960|gb|ACI11736.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Klebsiella
           pneumoniae 342]
 gi|238549034|dbj|BAH65385.1| putative ABC transpor system periplasmic binding protein
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259039985|gb|EEW41102.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|288888101|gb|ADC56419.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           variicola At-22]
 gi|289776570|gb|EFD84569.1| hypothetical protein HMPREF0485_03348 [Klebsiella sp. 1_1_55]
 gi|328538951|gb|EGF65004.1| lipopolysaccharide transport periplasmic protein LptA [Klebsiella
           sp. MS 92-3]
          Length = 181

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY--NNTNRDVSNK 95
               ++ IHI++D   +        F GNV +TQ    + ADK+ +    N   ++V   
Sbjct: 29  TGDTDQPIHIESDQQSLDMQGNVVTFTGNVVVTQGTIKINADKVVVTRPGNEKGKEVIEG 88

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                    +      +   AS    + Q   +VL G+      L++  +   G K+   
Sbjct: 89  FGNPATFYQMQDNGKPVKGRASKMRYELQNDYVVLTGNAY----LEQLDSNIKGDKITYL 144

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V +++   
Sbjct: 145 VKEQKMQAFSDKGRRVTTVLVPS 167



 Score = 34.5 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +  +A  +  +         GN ++ Q D +++ DK+T           +   R
Sbjct: 99  QDNGKPVKGRASKMRYELQNDYVVLTGNAYLEQLDSNIKGDKITYLVKEQKMQAFSDKGR 158

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  +  + +     
Sbjct: 159 RVTTVLVPSELQDKSGNQQK 178


>gi|90420563|ref|ZP_01228470.1| possible OstA family protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90335291|gb|EAS49044.1| possible OstA family protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 205

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/189 (21%), Positives = 78/189 (41%), Gaps = 26/189 (13%)

Query: 12  IHLLALVFVLLKADLSQAAAS----YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L+ L    L    +Q             +V G++ I I+++ L V DA   A F GNV
Sbjct: 15  VFLVGLALGALAPAQAQQTEPGLGKSFGGLQVDGDQPISIESNQLVVDDAKAVATFTGNV 74

Query: 68  FMTQEDFSLQADKMTIDYNNTNR------------DVSNKINRMDVERNIFIQSGEINVI 115
            + Q +  L+  ++ + Y                   SN+I R++    ++++S +    
Sbjct: 75  QVEQGETELRTGRLVVTYKKDETGGSQPAGGGGLPGGSNQIERLEASEKVYVKSADQVAT 134

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC------ESD 169
           A     D   +++V+ G+    V+L +  N   GC+L + +DT  A L+           
Sbjct: 135 ADQADFDMGTQVVVMRGN----VVLTQGQNVAEGCRLTIQMDTGLARLESACDGGAETGG 190

Query: 170 QVQSIIRYD 178
           +V+ ++   
Sbjct: 191 RVRLMLTPG 199


>gi|115522456|ref|YP_779367.1| OstA-like protein [Rhodopseudomonas palustris BisA53]
 gi|115516403|gb|ABJ04387.1| OstA family protein [Rhodopseudomonas palustris BisA53]
          Length = 229

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/206 (19%), Positives = 83/206 (40%), Gaps = 35/206 (16%)

Query: 4   FLNSIHLYIHLLALVFVLLK--ADLSQAAAS----YMTRFKVLGNEKIHIKADMLEVKDA 57
            + S+ +   +   V  LL     L+Q A S     M  F    ++ I I+A  LEV+D 
Sbjct: 12  LMKSLLIAAAVTGCVAGLLGGTPALAQGAVSGVPNAMQGFSQNRDQPIQIEAASLEVRDK 71

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN------------------------RDVS 93
            ++A F G+V + Q D ++ +  + + Y+                               
Sbjct: 72  KKEATFTGDVKVVQGDTTMTSKVLVVFYDQDPASGSAAPAAKAKAGAKPQMAASPGPGGG 131

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           + I R++ + N+ +   +  V       D +  ++ + G    +V+L +  N   G +L+
Sbjct: 132 SSIRRLEAKGNVVVTQKDQVVTGDTAVFDTKTNLVTMLG----RVVLTQGGNVLRGDRLL 187

Query: 154 VNIDTSFASLQGCESDQVQSIIRYDG 179
           V++ T  + ++   S +VQ + +   
Sbjct: 188 VDMTTGVSRVESG-SGRVQGLFQSGP 212


>gi|260577295|ref|ZP_05845268.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
 gi|259020476|gb|EEW23799.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
          Length = 169

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 78/177 (44%), Gaps = 12/177 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++     I + +++ +L  A  +Q A       KV  +  + I++D L+V  A   A F 
Sbjct: 1   MSRPLRAIIVASMLGLLPLAAAAQGANVAFGGLKVDSSLPVEIESDQLDVDQATGVAVFT 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV + Q +  L A  + ++Y+         I+++     + + +      +S       
Sbjct: 61  GNVLVGQGELRLSAATVRVEYDAE----GKAISKLHASGGVTLANATEAAESSEAVYTIA 116

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
              +V+ G+    V+L +  +   G +L+++++    +++G    +VQ++     +P
Sbjct: 117 SGSVVMTGN----VLLTQGESAITGQRLVIDVNAGTGTMEG----RVQTVFVPAKKP 165


>gi|221640650|ref|YP_002526912.1| OstA family protein [Rhodobacter sphaeroides KD131]
 gi|221161431|gb|ACM02411.1| OstA family protein precursor [Rhodobacter sphaeroides KD131]
          Length = 163

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 62/156 (39%), Gaps = 13/156 (8%)

Query: 27  SQAAASYMTR-FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           +Q A        K      + I +D L+V  A   A F GNV + Q    L A  + ++Y
Sbjct: 20  AQGAEVAFGGGLKQDTTLPVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEY 79

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
                     I R+     + + +G     A       +   +V+ GD    V+L +  N
Sbjct: 80  ----APGGGAIRRLHASGGVTLANGSEAAEAKEAVYTIESGEVVMTGD----VLLTQGPN 131

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           T  G KL++++      ++G    +VQ++ +    P
Sbjct: 132 TLAGQKLVIDLTAGTGRMEG----RVQTVFQPGKAP 163


>gi|77464736|ref|YP_354240.1| OstA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463576|ref|YP_001044690.1| OstA family protein [Rhodobacter sphaeroides ATCC 17029]
 gi|77389154|gb|ABA80339.1| OstA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105240|gb|ABN77918.1| OstA family protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 163

 Score =  105 bits (260), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 62/156 (39%), Gaps = 13/156 (8%)

Query: 27  SQAAASYMTR-FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           +Q A        K      + I +D L+V  A   A F GNV + Q    L A  + ++Y
Sbjct: 20  AQGAEVAFGGGLKQDTTLPVEIGSDQLQVNQADGTAVFSGNVRVAQGPMRLGAQSVRVEY 79

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
                     I R+     + + +G     A       +   +V+ GD    V+L +  N
Sbjct: 80  ----APGGGAIRRLHASGGVTLANGSEAAEAKQAVYTIESGEVVMTGD----VLLTQGPN 131

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           T  G KL++++      ++G    +VQ++ +    P
Sbjct: 132 TLAGQKLVIDLTAGTGRMEG----RVQTVFQPGKAP 163


>gi|322418291|ref|YP_004197514.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M18]
 gi|320124678|gb|ADW12238.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M18]
          Length = 165

 Score =  105 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 74/177 (41%), Gaps = 18/177 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
            +  +  +I L+          LS + A       V G E + +K+D L   +  + A F
Sbjct: 1   MMRRMLSFIVLV----------LSLSTAVAYAAQGVSGKEPLKVKSDTLTTDNEKKTAIF 50

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           +G V   Q D  L  D++ + Y+       N+++R++   N+ I   E     ++G    
Sbjct: 51  EGKVVAHQGDMVLYTDRLVVSYSG----PGNEVSRVEAFGNVRIVQQERQATGAHGVYQP 106

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           ++  +VL+G+      +    +   G  +   ++   + +     ++V+++I   G+
Sbjct: 107 KEGRVVLDGNPK----VVSGDDVITGKVITYYVNEQKSVVTSGPKERVEAVIHPGGK 159


>gi|330446807|ref|ZP_08310458.1| lipopolysaccharide transport periplasmic protein LptA
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490998|dbj|GAA04955.1| lipopolysaccharide transport periplasmic protein LptA
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 168

 Score =  105 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 62/176 (35%), Gaps = 17/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N I   I  L  +  +     +          K    + I+I +D  E+      A F 
Sbjct: 1   MNRIK--ISALLCLLCVSAPSWA---------LKSDTKQPINIDSDSQEIDVQNNIATFT 49

Query: 65  GNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           GNV + Q    ++A+K+ +    + +                I      I+  A     +
Sbjct: 50  GNVKLRQGTIDIRANKVVVTRPNSKSKEQTIVAYGNPATFHQIMDDGKPIDGEALKMRYE 109

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   L +     DK +L +  +   G  +   ID      +  ++++V ++I+ +
Sbjct: 110 TKTEFLKMT----DKAVLNQDGSEIKGNVITYKIDEQRLMAKSGDNERVTTVIQPN 161


>gi|253997917|ref|YP_003049980.1| lipopolysaccharide transport periplasmic protein LptA [Methylovorus
           sp. SIP3-4]
 gi|313199982|ref|YP_004038640.1| lipopolysaccharide transport periplasmic protein lpta [Methylovorus
           sp. MP688]
 gi|253984596|gb|ACT49453.1| lipopolysaccharide transport periplasmic protein LptA [Methylovorus
           sp. SIP3-4]
 gi|312439298|gb|ADQ83404.1| lipopolysaccharide transport periplasmic protein LptA [Methylovorus
           sp. MP688]
          Length = 185

 Score =  105 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 68/194 (35%), Gaps = 31/194 (15%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M+    S    + ++A +                   K   ++ I+++AD + V DA + 
Sbjct: 1   MTTLPRSFLPLLLMMACL--------------PAHAEKADKDKPINLEADAVTVNDAKKT 46

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS----GEINVIA 116
           + + GNV +TQ    ++ DK+ +  +      S              +       +    
Sbjct: 47  SIYTGNVILTQGTLIIRGDKLVVREDKEGFQHSTTYGNPQTPSTFKQKMEGKNEYMEGSG 106

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-------- 168
                D +   + L      K  +K+  +   G  ++ + +  +A + G  S        
Sbjct: 107 QRIEYDGRMDKVQL----YTKAWVKKGDDIVHGDYIMYDANAEYAEVIGGGSQAATPATP 162

Query: 169 -DQVQSIIRYDGRP 181
             +V+++I+   +P
Sbjct: 163 TGRVRAVIQPKKKP 176


>gi|254470648|ref|ZP_05084051.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
 gi|211959790|gb|EEA94987.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
          Length = 169

 Score =  104 bits (259), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 82/166 (49%), Gaps = 14/166 (8%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
              +Q  +     F     E I I+A  L+V+D  + A F GNV +TQ +  L+A ++ +
Sbjct: 1   MAHAQTFSDSFAGFGSDNKEPIEIEATNLQVRDKDKSAIFSGNVVVTQGEAKLEAQRLIV 60

Query: 84  DY-------NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            Y       N   + V   I+R++ + ++ + S +      +   D +K+I+V+ G    
Sbjct: 61  FYSGSMANGNADGQPVQQSISRLEAKGDVLVSSKDQVATGDDASFDMEKQIVVMTG---K 117

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASL----QGCESDQVQSIIRYD 178
           +V L +  N  +G +L++N++T  A+L     G  + +V+ +++ +
Sbjct: 118 RVTLSQGPNVIVGKRLVINLETGKANLDSSGTGGNTGRVRMLLQPN 163


>gi|209547658|ref|YP_002279575.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533414|gb|ACI53349.1| OstA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 211

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 79/192 (41%), Gaps = 21/192 (10%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L     A   VL  +      A+ M+  K+  ++ I I++D LE+ D    A F G V +
Sbjct: 14  LAFIAGAFALVLTASGAGAQQAATMSGMKLSNDQPIQIESDKLEIHDQEHTALFTGKVKV 73

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI--------------------FIQS 109
            Q   ++Q+ KMT+ Y +     +    +   +                        + S
Sbjct: 74  VQGTTTMQSGKMTVYYKDKAAKPAADGTQPAAQPQQSASLASGSADIDKILVTDKVLLTS 133

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
           G     A +G  D   +  +L  D+ +KVIL +  N F GCKL V++ T  A L+ C   
Sbjct: 134 GTQTATADDGKFDMASQTFILTADQGNKVILSDGPNVFTGCKLTVHMQTGQAELESC-GG 192

Query: 170 QVQSIIRYDGRP 181
           +VQ  +    +P
Sbjct: 193 RVQIQLDPKSQP 204


>gi|254509814|ref|ZP_05121881.1| OstA family protein [Rhodobacteraceae bacterium KLH11]
 gi|221533525|gb|EEE36513.1| OstA family protein [Rhodobacteraceae bacterium KLH11]
          Length = 151

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 64/157 (40%), Gaps = 12/157 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q A       +   +  + + ++ L V      A F GNV + Q +  L A+++
Sbjct: 5   SVPVSAQEAQVAFGSVEADPSLPVEVTSETLNVNQENGSAEFVGNVIVIQGEMRLTAERV 64

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + YN       + I RM+   N+ + S                 ++ + G+    V+L 
Sbjct: 65  LVIYNEDR----SAIERMEATENVVLVSPPDAAEGDWAEYTIDSGVIRMRGN----VLLT 116

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +   G ++I N+ +  A++ G    +V++I++  
Sbjct: 117 QGPSIISGDQMIANLTSGTATMSG----RVKTILQQG 149


>gi|220933908|ref|YP_002512807.1| OstA-like protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995218|gb|ACL71820.1| OstA-like protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 180

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 70/173 (40%), Gaps = 9/173 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  I L   L+A +F  L   L  A AS         +  I I++D  E+ D    + ++
Sbjct: 4   MPRISLKRPLVATLFAGLMLALITALASA-----SERDLPIRIQSDSAELDDQRGVSVYR 58

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +TQ D  + AD +T+   +           +   R +     E+   A +      
Sbjct: 59  GNVEVTQGDLVIHADTLTVHSPSRVLQRMEAEGNLARLRTLTEDGREVRAEARHMEYLAA 118

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           +R +VL  D      + +  + F G +++ ++D         +S +V+ I+  
Sbjct: 119 ERRMVLTRDAR----IWQAQDEFRGARIVYDMDRETLDAASGDSGRVEVILTP 167


>gi|254490069|ref|ZP_05103262.1| cell envelope biogenesis protein YhbN, putative [Methylophaga
           thiooxidans DMS010]
 gi|224464733|gb|EEF80989.1| cell envelope biogenesis protein YhbN, putative [Methylophaga
           thiooxydans DMS010]
          Length = 269

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 57/169 (33%), Gaps = 15/169 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L   L     S +        + I+I+AD  ++ D      +KG+  +TQ    ++ D +
Sbjct: 7   LITVLLLMLPSLVWALPSDREQPINIEADHAQLDDREGVTQYKGDAILTQGTLRIEGDII 66

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVI 139
           T  Y+   +                 + GE      A        ++ + L G       
Sbjct: 67  TFYYDENKQIEKMVAQGKLATYKQVHKPGEAPVRAKALQMEYFAGRQKIYLIGQG----H 122

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGC---------ESDQVQSIIRYDG 179
           + +  + F G ++  +I+ +  +             E  +V  II+  G
Sbjct: 123 VWQSGDEFTGNRIEYDIERNVVTANSAPVSVGGEKQEKGRVHIIIQPPG 171


>gi|238756129|ref|ZP_04617450.1| hypothetical protein yruck0001_2840 [Yersinia ruckeri ATCC 29473]
 gi|238705668|gb|EEP98064.1| hypothetical protein yruck0001_2840 [Yersinia ruckeri ATCC 29473]
          Length = 165

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 51/153 (33%), Gaps = 6/153 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN- 86
            AA+          ++ I+I +D   +      A F  NV + Q    ++AD+M I    
Sbjct: 1   MAASVPALALTGDTDQPINITSDKQALDMTGNTATFTDNVIVKQGSIEIKADRMVISRPG 60

Query: 87  -NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            + ++ V            +      +         +  K  ++L GD      L++  +
Sbjct: 61  GDQSKTVIEGFGNPVTFYQMQDNGKPVKGHGQKLRYEVAKEFVILTGDAY----LEQLDS 116

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G K+   +          +  +V +++   
Sbjct: 117 NIKGDKITYLVKEQQMEAFSDKGKRVTTVLLPS 149


>gi|92115809|ref|YP_575538.1| OstA-like protein [Nitrobacter hamburgensis X14]
 gi|91798703|gb|ABE61078.1| OstA-like protein [Nitrobacter hamburgensis X14]
          Length = 228

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 82/196 (41%), Gaps = 30/196 (15%)

Query: 10  LYIHLLALVFVLLKADLS-----QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           L    L  + V+   + +     Q   + M  F    ++ I I+A  LE++D  ++A F 
Sbjct: 20  LLCGGLITIAVMAAGEAAGQSAVQGVPNAMQGFSQNRDQPIQIEAAALEMRDKKKEATFS 79

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTN--------------------RDVSNKINRMDVERN 104
           GNV + Q D ++ +  + + Y + N                       ++ I R++   N
Sbjct: 80  GNVKVVQGDTTMTSKTLVVYYESGNSANAKGKSPSKPAMASATPGPSGASSIKRLEARGN 139

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + +   +  V       D +  ++ + G    KV+L +  N   G +LIV++ T  + ++
Sbjct: 140 VVVTQKDQVVTGDTAQFDTRTNLVTMLG----KVVLTQGKNVLRGDRLIVDMTTGVSRVE 195

Query: 165 GCESDQVQSIIRYDGR 180
              S +VQ + +  G+
Sbjct: 196 S-NSGRVQGLFQSSGQ 210



 Score = 36.4 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 23/68 (33%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF 106
           +  D  +           G V +TQ    L+ D++ +D       V +   R+       
Sbjct: 149 VTGDTAQFDTRTNLVTMLGKVVLTQGKNVLRGDRLIVDMTTGVSRVESNSGRVQGLFQSS 208

Query: 107 IQSGEINV 114
            Q G ++ 
Sbjct: 209 GQGGPLSG 216


>gi|290476794|ref|YP_003469705.1| putative ABC transporter periplasmic binding protein [Xenorhabdus
           bovienii SS-2004]
 gi|289176138|emb|CBJ82943.1| putative transport protein (ABC superfamily, peri_bind)
           [Xenorhabdus bovienii SS-2004]
          Length = 177

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 57/176 (32%), Gaps = 15/176 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N++     + + +F +    L+          K    + I + +D   +      A F 
Sbjct: 1   MNNLIRNTVIASTLFAVSLPVLA---------LKEDTKQPITLNSDRQSLDLTGNVATFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASNGYVD 122
            NV + Q    + ADK+ +     +                 +      I   AS    +
Sbjct: 52  DNVSVKQGSIDIHADKVVVTRPEGDAKKTVIEAYGNPATFYQLQDDGKPIKGHASKMRYE 111

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             K ++ L G+      L++  +   G K+   + T        +  +V +++   
Sbjct: 112 MDKELMTLTGNAY----LEQLDSNIKGDKITYLVPTQQMEAFSDKGKRVTTVLLPS 163


>gi|284008687|emb|CBA75343.1| organic solvent tolerance protein [Arsenophonus nasoniae]
          Length = 204

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 61/175 (34%), Gaps = 15/175 (8%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
             I + + L + +F+L    ++          K    + I I +    +        F G
Sbjct: 25  KKIFINVALTSSIFILSLPAVA---------LKSDSQQPIQIDSVKQSLDLEKNITTFTG 75

Query: 66  NVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           NV + Q    ++ADK+ +   N +  + V            +      I   +     + 
Sbjct: 76  NVVIKQGSIDVRADKVVVTRPNGDAKKMVVEAYGTPATFYQLQDDGKPIKGHSDKIRYEM 135

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +K +++L G+      L++  +   G K+   + T        +  +V +I+   
Sbjct: 136 EKELVILTGNAY----LEQLDSNIKGDKITYLVPTQQMEAFSDKGKRVTTILLPS 186


>gi|170751837|ref|YP_001758097.1| OstA family protein [Methylobacterium radiotolerans JCM 2831]
 gi|170658359|gb|ACB27414.1| OstA family protein [Methylobacterium radiotolerans JCM 2831]
          Length = 223

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 63/174 (36%), Gaps = 29/174 (16%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--- 88
           S        G + I I AD L+V D   KA F GNV   Q D +++   MT+ Y      
Sbjct: 31  SPFGNIGGGGKDPIKIDADRLDVFDRENKAVFAGNVVAVQGDSTIRCSTMTVTYKRGRDA 90

Query: 89  ----------------------NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
                                      N I ++D    + +   +      +   D   +
Sbjct: 91  PGKGARGDAKTEARDEGADAAPRNPAENGIQKVDCAGPVTVVQKDQVATGDHAVFDQDAK 150

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +VL G+    V+L +  N   G +L+ +++T  A++      +V ++     +
Sbjct: 151 RIVLTGN----VVLSQCQNVTRGQRLVYDMNTGRANMDPVAGGRVSALFVPGEK 200


>gi|209694095|ref|YP_002262023.1| hypothetical protein VSAL_I0500 [Aliivibrio salmonicida LFI1238]
 gi|208008046|emb|CAQ78185.1| putative exported protein [Aliivibrio salmonicida LFI1238]
          Length = 166

 Score =  104 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 48/150 (32%), Gaps = 6/150 (4%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +S          + IHI +D         +  F G+V + Q    + ADK+ +       
Sbjct: 15  SSSSWALSTDTEQPIHINSDTQNFDMQSNRVTFNGDVTLKQGSIKIFADKLIVIRPQGQE 74

Query: 91  DVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                    +      +      +   A+    + +   L +  +      L +  +   
Sbjct: 75  GREILEAYGKPARFSQLTDDGKTLRGKANKLRYELENEFLTMTDNAE----LTQDDSVIQ 130

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G  +  N+ T      G + ++V +I++  
Sbjct: 131 GKVITYNMKTQKLIADGGKDERVTTILQPS 160


>gi|148251744|ref|YP_001236329.1| hypothetical protein BBta_0123 [Bradyrhizobium sp. BTAi1]
 gi|146403917|gb|ABQ32423.1| hypothetical protein BBta_0123 [Bradyrhizobium sp. BTAi1]
          Length = 225

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 82/196 (41%), Gaps = 26/196 (13%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAAS-----YMTRFKVLGNEKIHIKADMLEVKDA 57
            F+++      L+AL  V     +    A+      +  F    ++ I I+A  LE++D 
Sbjct: 5   RFISAAIRGAGLVALAMVACAGAVQAQTAATGVPNALQGFSQNRDQPIQIEAASLEMRDK 64

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN----------------RDVSNKINRMDV 101
            ++A F GNV + Q D ++ +  + + Y+                    D S+ I R++ 
Sbjct: 65  KKEATFSGNVKVVQGDTTMTSKSLVVFYDGGAQGGAKPAKTMQAAAPGPDGSSSIRRLEA 124

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + +   E  V       D +   + + G+    V+L +  N   G +L+V++ T  +
Sbjct: 125 RGGVTVTQKEQVVTGETAVFDTKTNQITMQGN----VVLTQCKNVLRGDRLMVDMTTGVS 180

Query: 162 SLQGCESDQVQSIIRY 177
            ++   S +VQ+++  
Sbjct: 181 RVESD-SGRVQALLPQ 195


>gi|146313270|ref|YP_001178344.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           sp. 638]
 gi|145320146|gb|ABP62293.1| OstA family protein [Enterobacter sp. 638]
          Length = 157

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 53/144 (36%), Gaps = 6/144 (4%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSN 94
                 + IHI++D   +        F GNV MTQ    + ADK+ +        +++ +
Sbjct: 1   MTGDTEQPIHIESDTQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIID 60

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      +   AS+ + +  K +++L G+      L++  +   G K+  
Sbjct: 61  GYGNPATFYQMQDNGKPVKGHASHMHYELAKDLVILTGNAY----LEQLDSNITGDKITY 116

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            +          +  +V +++   
Sbjct: 117 LVKEQKMQASSEKGKRVTTVLVPS 140



 Score = 34.9 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 25/77 (32%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D ++  DK+T          S++  +
Sbjct: 72  QDNGKPVKGHASHMHYELAKDLVILTGNAYLEQLDSNITGDKITYLVKEQKMQASSEKGK 131

Query: 99  MDVERNIFIQSGEINVI 115
                 +  Q  +    
Sbjct: 132 RVTTVLVPSQLQDKGKT 148


>gi|295097687|emb|CBK86777.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 184

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 53/144 (36%), Gaps = 6/144 (4%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSN 94
                 + IHI++D   +        F GNV MTQ    + ADK+ +        +++ +
Sbjct: 28  VTGDTEQPIHIESDTQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIID 87

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      +   AS+ + +  K +++L G+      L++  +   G K+  
Sbjct: 88  GYGNPATFYQMQDNGKPVKGHASHMHYELAKDLVILTGNAY----LEQLDSNIKGDKITY 143

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            +          +  +V +++   
Sbjct: 144 LVKEQKMQASSEKGKRVTTVLVPS 167



 Score = 34.9 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 27/76 (35%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T          S++  +
Sbjct: 99  QDNGKPVKGHASHMHYELAKDLVILTGNAYLEQLDSNIKGDKITYLVKEQKMQASSEKGK 158

Query: 99  MDVERNIFIQSGEINV 114
                 +  Q  + N 
Sbjct: 159 RVTTVLVPSQLQDKNN 174


>gi|121602088|ref|YP_989616.1| OstA family protein [Bartonella bacilliformis KC583]
 gi|120614265|gb|ABM44866.1| OstA family protein [Bartonella bacilliformis KC583]
          Length = 200

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 24/188 (12%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            L+  + +L    L  A  ++M      G + I + +D LE+ +    A F  NV + Q 
Sbjct: 14  FLILSIGLLKWGGLGHAEVAHMGIDLSNGEKPIELYSDSLEIHEKKGIAIFNDNVSIVQG 73

Query: 73  DFSLQADKMTIDYNNTNRDVS----------------NKINRMDVERNIFIQSGEINVIA 116
           +  LQ  K+ + Y+  ++ V                   + +M+   N++I+     +  
Sbjct: 74  ERLLQTSKLVVYYDQDHQTVGINEVRKKSRLFVGSGLTGVKKMEALGNVYIKIATQIITG 133

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC----ESDQVQ 172
             G  D +  ++ L G+    V+LK+  N   GCKL +N+ T  A L+GC    +  +V 
Sbjct: 134 DKGIFDGKSNVVTLTGN----VVLKDGRNVATGCKLTINMKTGKALLEGCEASEKKSRVS 189

Query: 173 SIIRYDGR 180
            I++ + +
Sbjct: 190 IILQSNQK 197


>gi|157372598|ref|YP_001480587.1| lipopolysaccharide transport periplasmic protein LptA [Serratia
           proteamaculans 568]
 gi|157324362|gb|ABV43459.1| Cell envelope biogenesis YhbN [Serratia proteamaculans 568]
          Length = 179

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 54/160 (33%), Gaps = 6/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL   L  AA++     K   ++ + I +    +      + F  NV + Q    ++ADK
Sbjct: 12  LLIGSLILAASAPAWALKSDSSQPVSIDSLKQSLDMQSNVSTFTDNVVIKQGTIDIKADK 71

Query: 81  MTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +     + N+              +      +   A     D   +++ L G+     
Sbjct: 72  VVVTRPGGDQNKTYIEAFGNPVTFYQMQDSGKPVKGHAQKVRYDVASQLVTLTGNAY--- 128

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G ++   +          +  +V +++   
Sbjct: 129 -LEQLDSNVKGDRITYLVQQQQMQAFSDKGKRVTTVLVPS 167



 Score = 34.5 bits (77), Expect = 6.6,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 25/77 (32%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +    A Q     GN ++ Q D +++ D++T           +   +
Sbjct: 99  QDSGKPVKGHAQKVRYDVASQLVTLTGNAYLEQLDSNVKGDRITYLVQQQQMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVI 115
                 +  Q  + N  
Sbjct: 159 RVTTVLVPSQLQDKNGQ 175


>gi|299133326|ref|ZP_07026521.1| OstA family protein [Afipia sp. 1NLS2]
 gi|298593463|gb|EFI53663.1| OstA family protein [Afipia sp. 1NLS2]
          Length = 250

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 66/179 (36%), Gaps = 17/179 (9%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L+   + +     +        + +  F     + I I A  LEV+D  + A F GNV +
Sbjct: 28  LFAFAVCVSAAQAQTSTVSGVPNAVQGFSKNRGQPIQIDALSLEVRDKDKIATFSGNVKV 87

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKIN-------------RMDVERNIFIQSGEINVIA 116
            Q D ++++  + + Y+         +              R++    + +   +  V  
Sbjct: 88  VQGDTTMRSKTLVVFYDQDKAGAKPGMKTAQPGPGGNSSVRRLEARGGVVVTQNDQTVTG 147

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
             G  D +   + + G     V+L +  N   G +L+V++ T  + ++      V  + 
Sbjct: 148 ETGIFDMKTNTVTMTG----GVVLTKDKNVLKGDRLVVDMTTGVSRVESSGGRGVSGLF 202


>gi|13472790|ref|NP_104357.1| hypothetical protein mll3198 [Mesorhizobium loti MAFF303099]
 gi|14023537|dbj|BAB50143.1| mll3198 [Mesorhizobium loti MAFF303099]
          Length = 199

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 18/171 (10%)

Query: 23  KADLSQA-AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
              L+Q+ A+S ++  K+ G++ I I++D LEV+ A   A F GNV + Q    L+A KM
Sbjct: 22  VPSLAQSGASSQVSGLKLSGDKPIQIESDKLEVRQAENLAVFTGNVTVVQGPTLLKAGKM 81

Query: 82  TIDYNNTN-------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
            + Y                    S  I+ ++V   ++I+S +      NG  D + ++L
Sbjct: 82  MVYYVKDPNAAAKGTEAAGAAMTGSANIDHLEVSSKVYIKSDDQVATGDNGTFDMKTQVL 141

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           VL+G    +V+L +  N   GCKL V + T  A++ GC   +V   +    
Sbjct: 142 VLSG---KEVVLSQGPNVLKGCKLTVQMKTGLANVDGC-GGRVIMSMTPPK 188


>gi|253991151|ref|YP_003042507.1| lipopolysaccharide transport periplasmic protein LptA [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782601|emb|CAQ85765.1| protein yhbn precursor probable transporter [Photorhabdus
           asymbiotica]
          Length = 177

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 57/176 (32%), Gaps = 15/176 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N+      + + +F +    L+          K    + I+I +D   +      A F 
Sbjct: 1   MNNRIRNAFIASAIFAISLPALA---------LKDDTQKPIYIDSDKQALDMTGNTATFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASNGYVD 122
            NV + Q    + ADK+ +   N +                 +      I    +    +
Sbjct: 52  ENVIVKQGSIDIHADKVIVTRPNGDSKKMIVEAFGNPVTFYQLQDNGKPIKGRGAKMRYE 111

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             K ++ L G+      L++  +   G ++   + T        +  +V +++   
Sbjct: 112 MDKELVTLTGNAY----LEQLDSNIKGDRITYLVPTQQMEAFSDKGKRVTTVLLPS 163


>gi|59710996|ref|YP_203772.1| ABC transporter periplasmic-binding protein [Vibrio fischeri ES114]
 gi|59479097|gb|AAW84884.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Vibrio fischeri ES114]
          Length = 165

 Score =  103 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 55/169 (32%), Gaps = 13/169 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  ++L+  LL +  S               + IHI ++         +  F GNV + Q
Sbjct: 3   LSHVSLLASLLFSASSW-------ALSSDTEQPIHINSNSQNFDMQSNQVTFTGNVTLKQ 55

Query: 72  EDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
               + ADK+ +                +      +      +   A+    + +   L 
Sbjct: 56  GSIEIFADKIVVIRPQGKEGREVLEAYGKPTRFSQLTDDGKTLKGKANKLRYELENEFLK 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +     D   L +  +   G  +  N+ T      G + D+V +I++  
Sbjct: 116 MT----DSAELTQDDSIIKGKVITYNMKTQKLIADGGKDDRVTTILQPS 160


>gi|261342645|ref|ZP_05970503.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cancerogenus ATCC 35316]
 gi|288315293|gb|EFC54231.1| lipopolysaccharide transport periplasmic protein LptA [Enterobacter
           cancerogenus ATCC 35316]
          Length = 184

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 53/144 (36%), Gaps = 6/144 (4%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSN 94
                 + IHI++D   +        F GNV MTQ    + ADK+ +        +++ +
Sbjct: 28  VTGDTEQPIHIESDAQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIID 87

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      +   AS+ + +  K +++L G+      L++  +   G K+  
Sbjct: 88  GYGNPATFYQMQDNGKPVKGRASHMHYELAKDLVILTGNAY----LEQLDSNITGDKITY 143

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            +          +  +V +++   
Sbjct: 144 LVKEQKMQATSEKGKRVTTVLVPS 167


>gi|89052717|ref|YP_508168.1| OstA-like protein [Jannaschia sp. CCS1]
 gi|88862266|gb|ABD53143.1| OstA-like protein [Jannaschia sp. CCS1]
          Length = 160

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 67/168 (39%), Gaps = 12/168 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +H  + LL ++  L     +Q             ++ + + +D L V     +A F GNV
Sbjct: 1   MHRILALLGVILCLTTPLSAQV-NIGFGGVAYDSSQPVEVTSDALTVDQTTGEAVFTGNV 59

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q D  + A  + + Y       +  I+ +     + I  G      ++   +    +
Sbjct: 60  IVVQGDLRMAASAVRVLYTTD---GNQDISEVIATGGVLITRGTEAAEGNSAVFNVASSL 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           L L G+    V++ +      G  ++V++ T   ++ G    +V++++
Sbjct: 117 LTLRGN----VLVTQGQTAIAGDNMVVDMTTGSGTVDG----RVRTVL 156


>gi|56695007|ref|YP_165354.1| hypothetical protein SPO0080 [Ruegeria pomeroyi DSS-3]
 gi|56676744|gb|AAV93410.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 163

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 71/167 (42%), Gaps = 12/167 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L  ++ +   A  ++         K      + + AD L+V      A F+GNV ++Q
Sbjct: 7   LILGLVLALGAVAAQAEGTKVAFGAVKADPTLPVEVTADSLDVSQEDGSAEFQGNVLVSQ 66

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            +  L A ++ + YN      ++ I R++   ++ + SG     A          ++V+ 
Sbjct: 67  GEMRLSAKRVLVIYNQE----ASGIERLEATGDVVLVSGSDAAQAQRADYTIGTGVIVMT 122

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           GD    V+L +  N     K+ VN+ +  A + G    +V++I+   
Sbjct: 123 GD----VLLTQGKNALSSGKMTVNLTSGTAQMVG----RVKTILNSG 161


>gi|152978601|ref|YP_001344230.1| cell envelope biogenesis YhbN [Actinobacillus succinogenes 130Z]
 gi|150840324|gb|ABR74295.1| Cell envelope biogenesis YhbN [Actinobacillus succinogenes 130Z]
          Length = 170

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 58/160 (36%), Gaps = 7/160 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A +    +  +   K   ++ I+I +   E+        F  NV +TQ    ++A+K
Sbjct: 7   ILLAAVLLMTSLSVAALKGDTDKPINIDSGNQELDMENSVVTFTDNVVITQGSILIKANK 66

Query: 81  MTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           + I     N+  ++  +          +       +  A+  + D     L L G+    
Sbjct: 67  VVITRPPENSGKKETVDAYGSPVTFHQMLDDGKPADGKANKVHYDLGTEFLTLTGNAE-- 124

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             LK+  +   G  +  ++        G    +V++++  
Sbjct: 125 --LKQLDSKINGDVITYDVKKQQLKATGSAKSRVRTVLIP 162


>gi|325578770|ref|ZP_08148817.1| YhbN like protein [Haemophilus parainfluenzae ATCC 33392]
 gi|301155934|emb|CBW15404.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Haemophilus parainfluenzae T3T1]
 gi|325159594|gb|EGC71726.1| YhbN like protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 172

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 62/176 (35%), Gaps = 16/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S +  I LL  + +   +  +          K   N+ I+I +D   +        F 
Sbjct: 1   MKSTNNKILLLTALMMTSLSAFA---------LKDDTNKPINIVSDNQSLDMENSVVTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV +TQ    ++A+K+ I     N+  ++                    ++  A+  + 
Sbjct: 52  DNVVITQGSILIKANKVVITRPPENSGKKETVEAFGSPVTFHQQLDDGKPVDGRANKVHY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D     L L G+      LK+  +   G ++  ++        G    +VQ+++  
Sbjct: 112 DLGTEFLTLTGNAE----LKQLDSKINGERITYDVKKQQLKANGNGKSRVQTVLIP 163


>gi|325266392|ref|ZP_08133070.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Kingella denitrificans
           ATCC 33394]
 gi|324982185|gb|EGC17819.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Kingella denitrificans
           ATCC 33394]
          Length = 171

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 56/168 (33%), Gaps = 11/168 (6%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
             L A L+  +           N+ I I+AD   +    Q   F GNV + Q    ++A 
Sbjct: 8   AFLAAVLTAGSLQPAHALDSDRNQPISIEADQGSLDQKNQVTVFSGNVQIKQGSLQMKAQ 67

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKV 138
            + +  + +              R       G      +    +  + ++ L G+     
Sbjct: 68  SVRVSQDRSGNQTMLATGSPVYFRQQLDGGKGLAEGWGNRAEYNSAQHLVKLIGNAK--- 124

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGC------ESDQVQSIIRYDGR 180
            ++   +   G  +  N+ T   ++ G          +V+ II+ + +
Sbjct: 125 -VQRGGDLAQGEAISYNMKTEVYTVLGGNAVGNKNGRRVKVIIQPNNK 171


>gi|150395245|ref|YP_001325712.1| OstA family protein [Sinorhizobium medicae WSM419]
 gi|150026760|gb|ABR58877.1| OstA family protein [Sinorhizobium medicae WSM419]
          Length = 186

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 85/164 (51%), Gaps = 7/164 (4%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           ++  A  +QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA 
Sbjct: 24  LIASAAFAQATSSRMQGLQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAG 83

Query: 80  KMTIDYNNT---NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            MT+ Y          +  I+R++V   +F+ SG       +G V+   + +VL G+   
Sbjct: 84  NMTVFYKAGGGSVTSGNADIDRIEVNNKVFLSSGTQQATGESGIVNLTNQTIVLKGE--- 140

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           KV+L E  N F+GC+L V ++T  A L  C   +VQ  +    R
Sbjct: 141 KVVLSEGKNVFVGCQLNVQMNTGEAQLDAC-GGRVQIQLDPQSR 183


>gi|39996987|ref|NP_952938.1| hypothetical protein GSU1889 [Geobacter sulfurreducens PCA]
 gi|39983875|gb|AAR35265.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506004|gb|ADI84727.1| cell envelope biogenesis ABC transporter, periplasmic protein
           [Geobacter sulfurreducens KN400]
          Length = 167

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 69/167 (41%), Gaps = 12/167 (7%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +++ +F+L    ++ A           G + I +K++ L      + A F G V   Q D
Sbjct: 5   IISALFLLTVTAMAVAGPLPA----SRGGQPITVKSNELSADSRNRTATFSGKVTARQGD 60

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
            ++ +D++ + Y +        + +++   N+ I  G     A  G     ++ +VL+GD
Sbjct: 61  LTIYSDRLIVHYRDD----GGDVEKVEAVGNVKIVQGNRLATAKEGVYYNTEQKIVLSGD 116

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
                 + +  N   G  +   ++   + + G    +V+++I    +
Sbjct: 117 PK----VYQGENMISGKVITYFVNEERSVVTGGGDSRVEAVIHPTDK 159


>gi|197335478|ref|YP_002155146.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           fischeri MJ11]
 gi|197316968|gb|ACH66415.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           fischeri MJ11]
          Length = 165

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 55/169 (32%), Gaps = 13/169 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  ++L+  LL +  S               + IHI ++         +  F G+V + Q
Sbjct: 3   LSHVSLLASLLFSASSW-------ALSSDTEQPIHINSNSQNFDMQSNQVTFTGDVTLKQ 55

Query: 72  EDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
               + ADK+ +                +      +      +   A+    + +   L 
Sbjct: 56  GSIEIFADKIVVIRPQGKEGREVLEAYGKPTRFSQLTDDGKTLKGKANKLRYELENEFLK 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +     D   L +  +   G  +  N+ T      G + D+V +I++  
Sbjct: 116 MT----DSAELTQDDSIIKGKVITYNMKTQKLIADGGKDDRVTTILQPS 160


>gi|251793140|ref|YP_003007868.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter aphrophilus NJ8700]
 gi|247534535|gb|ACS97781.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter aphrophilus NJ8700]
          Length = 173

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 66/177 (37%), Gaps = 16/177 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S+   I L++ V  +  + L+          K   N+ I+I +D   +  + +   F 
Sbjct: 1   MKSVSSKILLVSAVTFMSLSALA---------LKDDTNQPINIVSDNQSLDMSNRVVTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV +TQ    ++A+K+ I     N+  +D             +      ++  A+  + 
Sbjct: 52  DNVVITQGSIVVKANKVIITRPEENSKKKDTVEAFGNPVTFHQMMDDGKPVDGKANKVFY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           D     L L G+      LK+  +   G  +  ++        G    +V++++   
Sbjct: 112 DLGTEFLTLTGNAE----LKQLDSKINGNVITYDVKKQQLKANGSSGSRVKTVLIPS 164


>gi|126724657|ref|ZP_01740500.1| OstA-like protein [Rhodobacterales bacterium HTCC2150]
 gi|126705821|gb|EBA04911.1| OstA-like protein [Rhodobacterales bacterium HTCC2150]
          Length = 162

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 73/170 (42%), Gaps = 12/170 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
              +  +  L +  L+Q A       +   +  + I++D   V  +   A F GNV + Q
Sbjct: 5   FWAVIALVCLPQLLLAQGADVAFKDMEHDASAPVEIESDKFSVDQSTNLAVFLGNVLVVQ 64

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
               L AD++ ++Y +     SN I+ +    N+   +G     A           +V+ 
Sbjct: 65  GLLRLSADQVNVEYASD---ESNDISAVIAVGNVTFVNGAEAAEAQRAEYTLATNEIVMT 121

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           GD    V++ +  +   G K++VN++T    + G    +V++I+R  G P
Sbjct: 122 GD----VLVTQGRSALSGQKMVVNLETGKGEMIG----RVKTILRS-GNP 162


>gi|238793709|ref|ZP_04637331.1| hypothetical protein yinte0001_860 [Yersinia intermedia ATCC 29909]
 gi|238726950|gb|EEQ18482.1| hypothetical protein yinte0001_860 [Yersinia intermedia ATCC 29909]
          Length = 171

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 16/157 (10%), Positives = 48/157 (30%), Gaps = 6/157 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
           A     A+          ++ + + +    +        F  NV + Q    ++ADK+ +
Sbjct: 3   ASSLLTASLPALALTGDTDQPVTVDSVKQALDMEANTVTFTDNVVIKQGTIEIKADKVVV 62

Query: 84  DYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                + ++ V            +      +         +     +VL G+      L+
Sbjct: 63  TRPGGDQSKMVIEGYGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LE 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  +   G ++   +          + ++V +++   
Sbjct: 119 QLDSNIKGDRITYLVKKQQMEAFSDKGNRVTTVLLPS 155


>gi|308189072|ref|YP_003933203.1| Protein yhbN precursor [Pantoea vagans C9-1]
 gi|308059582|gb|ADO11754.1| Protein yhbN precursor [Pantoea vagans C9-1]
          Length = 183

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 61/181 (33%), Gaps = 16/181 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N   L I L +++       L+              ++ ++I +    +      
Sbjct: 1   MKFKMNKNSLKILLASMLLATSVPALA---------LTGDSDKPVNIDSQNQALDLQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASN 118
           A F GNV +TQ    + ADK+ +     +   +  +          +      +   A+ 
Sbjct: 52  ATFTGNVIVTQGSIKITADKVVVTRPGGDSKKTIVDAYGNPATFYQMQDSGKPVQGHAAK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
            + +     + L G+      ++++ +   G ++   +           ++ +V +++  
Sbjct: 112 LHYELANDFVELTGNAF----IEQQDSNIKGDRITYLVKEQKMQAYSQGQNKRVTTVLVP 167

Query: 178 D 178
            
Sbjct: 168 S 168



 Score = 35.3 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 29/84 (34%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  L  + A       GN F+ Q+D +++ D++T           ++   
Sbjct: 99  QDSGKPVQGHAAKLHYELANDFVELTGNAFIEQQDSNIKGDRITYLVKEQKMQAYSQGQN 158

Query: 99  MDVERNIFIQSGEINVIASNGYVD 122
             V   +     +    +++G   
Sbjct: 159 KRVTTVLVPSQLQDKGSSNSGKKS 182


>gi|86356059|ref|YP_467951.1| hypothetical protein RHE_CH00402 [Rhizobium etli CFN 42]
 gi|86280161|gb|ABC89224.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 174

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 78/169 (46%), Gaps = 22/169 (13%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD-- 91
           M+  K+  ++ I I++D LE+ D    A F GNV + Q   ++Q+ KMT+ Y +      
Sbjct: 1   MSGMKLSNDQPIQIESDKLEIHDQEHTALFTGNVKVVQGTTTMQSGKMTVYYKDKAAKSG 60

Query: 92  -------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
                               S  I+++ V   +++ SG     A +G  D   +  +L  
Sbjct: 61  AGAPAQPEAKPEKSASLASGSADIDKILVTDKVYLVSGTQTATADDGNFDMASQTFILTA 120

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           D+ +KVIL +  N F GCKL V++ T  A L+ C   +VQ  +    +P
Sbjct: 121 DQGNKVILSDGPNVFTGCKLTVHMQTGQAELESC-GGRVQIQLDPKSQP 168


>gi|239831005|ref|ZP_04679334.1| OstA family protein [Ochrobactrum intermedium LMG 3301]
 gi|239823272|gb|EEQ94840.1| OstA family protein [Ochrobactrum intermedium LMG 3301]
          Length = 216

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 85/189 (44%), Gaps = 22/189 (11%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  L   +     A L+Q  A+            + I AD LE++D    A F GNV ++
Sbjct: 21  FAVLALGMVAAPTASLAQEGAAVNGLKLSNSKAPVKIDADKLEMRDKEGVAVFTGNVAVS 80

Query: 71  QEDFSLQADKMTIDYNNTNRDV----------------SNKINRMDVERNIFIQSGEINV 114
           Q D  L+A +MT+ YN   +D                 S+ I+ +D+   ++++SG    
Sbjct: 81  QGDALLKAGQMTVYYNKAKKDGDAQAPEPASAGVGGLDSSSIDHIDISGKVYLKSGTQVA 140

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQV 171
               G  D + +++VL G    KV+L +  N   GCKL  ++DT  A+++ C+     +V
Sbjct: 141 TGDTGRYDAKNQVMVLQG---QKVVLTDGDNVVTGCKLTAHLDTGRANVESCKGQSKGRV 197

Query: 172 QSIIRYDGR 180
             I+    +
Sbjct: 198 SIIMAPKDQ 206


>gi|304413067|ref|ZP_07394540.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Candidatus Regiella insecticola LSR1]
 gi|304283910|gb|EFL92303.1| putative transporter subunit: periplasmic-binding component of ABC
           superfamily [Candidatus Regiella insecticola LSR1]
          Length = 189

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 54/174 (31%), Gaps = 12/174 (6%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           N IH  +     +   L  +                 + IHI +D   +      + F  
Sbjct: 5   NKIHGILLTGLFLAAFLTVNF------PALALSSDSEQPIHITSDTQSLDLPNNVSVFID 58

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNK--INRMDVERNIFIQSGEINVIASNGYVDF 123
           NV + Q    ++A+K+ +   +  +  +           + +      +           
Sbjct: 59  NVIIKQGSIEIKANKVVVTRPDGEQKKTVMEGFGTPVTFQQMQDNGKLVTGHGEKLRYQL 118

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             + LVL G+      LK+  +     ++   ++         ++ +V +++  
Sbjct: 119 ANQFLVLTGNAY----LKQLDSNIEADRITYQVEKQLMEAFSDKNKRVTTVLLP 168


>gi|153007513|ref|YP_001368728.1| OstA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559401|gb|ABS12899.1| OstA family protein [Ochrobactrum anthropi ATCC 49188]
          Length = 216

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 84/189 (44%), Gaps = 22/189 (11%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           +  L   +       L+Q  A+            + I AD LE++D    A F GNV ++
Sbjct: 21  FAVLALGIVAAPTVSLAQEGAAVNGLKLSNSKAPVKIDADKLEMRDKEGIAIFTGNVAVS 80

Query: 71  QEDFSLQADKMTIDYNNTNRDV----------------SNKINRMDVERNIFIQSGEINV 114
           Q D  L+A +MT+ YN   +D                 S+ I+ +D+   ++++SG    
Sbjct: 81  QGDALLKAGQMTVYYNKAKKDGEAPAPEPTSAGVGGLDSSSIDHIDISGKVYLKSGTQVA 140

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQV 171
               G  D + +++VL G    KV+L +  N   GCKL  ++DT  A+++ C+     +V
Sbjct: 141 TGDTGRYDAKNQVMVLQG---QKVVLTDGDNVVTGCKLTAHLDTGRANVESCKGQTKGRV 197

Query: 172 QSIIRYDGR 180
             I+    +
Sbjct: 198 SIIMAPKDQ 206


>gi|227820606|ref|YP_002824576.1| putative OstA-like protein [Sinorhizobium fredii NGR234]
 gi|227339605|gb|ACP23823.1| putative OstA-like protein [Sinorhizobium fredii NGR234]
          Length = 187

 Score =  101 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 56/167 (33%), Positives = 86/167 (51%), Gaps = 8/167 (4%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
             ++    L+QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQ
Sbjct: 22  ALIIASGALAQATSSRMKGMQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQ 81

Query: 78  ADKMTIDYNNTN----RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           A  MT+ Y  T        +  I+R++V   +F+ SG        G V+   + +VL GD
Sbjct: 82  AGNMTVFYKATEGATITSGNADIDRIEVNNKVFLSSGAQQATGDTGLVNLTNQTIVLKGD 141

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              KV+L E  N F+GC+L V +DT  A L+ C   +VQ  +    R
Sbjct: 142 ---KVVLSEGKNVFVGCQLNVQMDTGEAQLEAC-GGRVQIQLDPQSR 184


>gi|304396320|ref|ZP_07378201.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           aB]
 gi|304355829|gb|EFM20195.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           aB]
          Length = 183

 Score =  101 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 61/181 (33%), Gaps = 16/181 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N   L + + +++       L+              ++ ++I +    +      
Sbjct: 1   MKFKMNKNSLKLLMASMLLATSVPALA---------LTGDSDKPVNIDSQNQALDLQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASN 118
           A F GNV +TQ    + ADK+ +     +   +  +          +      +   AS 
Sbjct: 52  ATFTGNVIVTQGSIKITADKVVVTRPGGDSKKTIVDAYGNPATFYQMQDSGKPVQGHASK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
            + +     + L G+      ++++ +   G ++   +           ++ +V +++  
Sbjct: 112 LHYELANDFVELTGNAF----IEQQDSNIKGDRITYLVKEQKMQAYSQGQNKRVTTVLVP 167

Query: 178 D 178
            
Sbjct: 168 S 168



 Score = 35.7 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 29/84 (34%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  L  + A       GN F+ Q+D +++ D++T           ++   
Sbjct: 99  QDSGKPVQGHASKLHYELANDFVELTGNAFIEQQDSNIKGDRITYLVKEQKMQAYSQGQN 158

Query: 99  MDVERNIFIQSGEINVIASNGYVD 122
             V   +     +    +++G   
Sbjct: 159 KRVTTVLVPSQLQDKGSSNSGKKS 182


>gi|75674372|ref|YP_316793.1| OstA-like protein [Nitrobacter winogradskyi Nb-255]
 gi|74419242|gb|ABA03441.1| OstA-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 227

 Score =  101 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 81/214 (37%), Gaps = 39/214 (18%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLS---------------QAAASYMTRFKVLGNEKI 45
           +SA  N    ++    +  +L    ++               Q   + M  F    ++ I
Sbjct: 2   ISAVQNRRRFFLPAFRMAVLLRGGVVAVALMAAGEAAAQSTVQGVPNAMQGFSQNRDQPI 61

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI--------- 96
            I+A  LE++D  ++A F GNV + Q D ++ +  + + Y +++                
Sbjct: 62  QIEAATLEMRDKKKEATFSGNVKVVQGDTTMTSKTLVVYYQSSDTAKGGAPSKKKPAAVA 121

Query: 97  ----------NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                      R++   N+ +   +  V       D    ++ + G    KV+L +  N 
Sbjct: 122 APAPSGASSIKRLEARGNVVVTQKDQVVTGDTAVFDTTTNLITMQG----KVVLTQCKNV 177

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             G +L+V++ T  + ++   S +VQ +     +
Sbjct: 178 LRGDRLLVDMTTGVSRVES-NSGRVQGLFIQGDQ 210


>gi|270159888|ref|ZP_06188544.1| cell envelope biogenesis protein YhbN [Legionella longbeachae
           D-4968]
 gi|289165358|ref|YP_003455496.1| OstA family protein [Legionella longbeachae NSW150]
 gi|269988227|gb|EEZ94482.1| cell envelope biogenesis protein YhbN [Legionella longbeachae
           D-4968]
 gi|288858531|emb|CBJ12412.1| OstA family protein [Legionella longbeachae NSW150]
          Length = 180

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 65/181 (35%), Gaps = 15/181 (8%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           ++ H Y  L   ++  L    S               + +H+ AD  ++     K  + G
Sbjct: 9   SASHQYFKLWFCLWFFLTFACSS------YALSEDKEKVMHVMADSADLSQQQHKGIYTG 62

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-----VIASNGY 120
           NV + Q   +L+A K     N  N+ V    +    ++  +  + +         A    
Sbjct: 63  NVELIQGTTNLRATKAITLGNEKNQLVVAIASGAPGQQAHYWTTTDPKKPPLHAYADTIR 122

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
               + ++ L G+      +++  N+F   K+  + +      QG  S ++  I   + +
Sbjct: 123 YYPLRHLIELIGNAR----VEQGNNSFSATKISYDTEKQHVLSQGDGSKRIMIIYHPEKK 178

Query: 181 P 181
           P
Sbjct: 179 P 179


>gi|319781470|ref|YP_004140946.1| OstA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167358|gb|ADV10896.1| OstA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 193

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 16/167 (9%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           S A  +  +  K+ G++ I I++D LEV+ A   A F GNV + Q    ++A KMT+ Y 
Sbjct: 24  SWAQTTSQSGLKLSGDKPIQIESDKLEVRQADSVAIFTGNVSVVQGPTLMKAGKMTVYYV 83

Query: 87  NTN-------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
                              S  I+ +++   ++I+S         G  D + ++LVL+G 
Sbjct: 84  KDPNAAAKGTEAAGAAMTGSANIDHLEISDKVYIKSDAQIATGDQGSFDMKSQVLVLSG- 142

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              KV+L +  N  +GCKL V + +  A +  C   +VQ  I    +
Sbjct: 143 --KKVVLSQNDNVLVGCKLTVQMKSGLAQVDPCAGQRVQMSITPPPK 187


>gi|90580192|ref|ZP_01235999.1| hypothetical protein yhbN precursor [Vibrio angustum S14]
 gi|90438494|gb|EAS63678.1| hypothetical protein yhbN precursor [Vibrio angustum S14]
          Length = 168

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 60/176 (34%), Gaps = 17/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N +       AL+ +L  +  S          K    + I+I ++  E+      A F 
Sbjct: 1   MNRLKTS----ALLCLLCVSTSSW-------ALKSDTKQPINISSNSQELDVQNNIATFT 49

Query: 65  GNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           GNV + Q    + ADK+ +    +N                 I      I+  A     +
Sbjct: 50  GNVRLRQGTIDIHADKVVVTRPNSNAKEQTIVAYGEPATFHQIMDDGKPIDGEALKMRYE 109

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   L +     DK +L +      G  +   ID      +  +  +V ++I+ +
Sbjct: 110 TKTEFLKMT----DKAVLNQDGTEMKGNVITYKIDEQRLVAKSGDKQRVTTVIQPN 161


>gi|240849697|ref|YP_002971085.1| OstA family protein [Bartonella grahamii as4aup]
 gi|240266820|gb|ACS50408.1| OstA family protein [Bartonella grahamii as4aup]
          Length = 199

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 42/200 (21%), Positives = 85/200 (42%), Gaps = 24/200 (12%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M ++   I + +   ++  +   A L  A  ++         E + + AD LE++D    
Sbjct: 1   MKSYKRWIGVTL-AFSMGMLGGGAVLGYAEVAHFGISLSSDKEPVELHADSLEIRDKEGI 59

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR----------------DVSNKINRMDVERN 104
           A FKG+V + Q +  L+  K+ + Y+   +                  S+ I +M+    
Sbjct: 60  ALFKGDVSVVQGERLLRTAKLVVYYDKAYKEIDKNKEDTKASSVSLFGSSGIQKMEALGK 119

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           ++I+          G  D + +++ L G     V+L +  N   GCKL  N+++  A L+
Sbjct: 120 VYIKIATQIATGDKGVFDGKSKMMSLTG---SHVVLTDGDNVATGCKLTANMESGKAFLE 176

Query: 165 GC----ESDQVQSIIRYDGR 180
           GC    +  +V  I++ + +
Sbjct: 177 GCETPKKKGRVSIILKQNQK 196


>gi|255020585|ref|ZP_05292648.1| OstA-like protein [Acidithiobacillus caldus ATCC 51756]
 gi|254969970|gb|EET27469.1| OstA-like protein [Acidithiobacillus caldus ATCC 51756]
          Length = 178

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 8/166 (4%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK-AFFKGNVFMTQE 72
           L+  + +L    L+ A  +       LG   IHI AD L  ++  Q+ A + G V MTQ 
Sbjct: 8   LIPFLALLAGVFLASAQGAVAPTDAGLGKGPIHISADSLAAQNKPQQQAVYTGKVVMTQG 67

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           D  + A+K+TID      +V+  +          + S + +   +          +VL G
Sbjct: 68  DIVIHAEKLTIDARQGKVEVATAVGSPVTF---TMSSAQRHGYGNTLVYRPGSGEIVLTG 124

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +      L +  N   G ++I ++D    S+      +VQS+    
Sbjct: 125 NA----HLWQGPNEVSGQQVIYHLDDQRTSVSAAPGGRVQSVFYPG 166


>gi|49474847|ref|YP_032888.1| hypothetical protein BH00160 [Bartonella henselae str. Houston-1]
 gi|49237652|emb|CAF26832.1| hypothetical protein BH00160 [Bartonella henselae str. Houston-1]
          Length = 192

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 75/188 (39%), Gaps = 23/188 (12%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
             L+L  + L A    A  ++         E + + A+ LE++D    A F G+V + Q 
Sbjct: 5   LALSLGMLGLGAVSGYAEVAHFGIHLSDDKEPVELYANSLEIRDKEGIALFNGDVSVIQG 64

Query: 73  DFSLQADKMTIDYNNTNR----------------DVSNKINRMDVERNIFIQSGEINVIA 116
           +  L+  K+ + Y+ T +                  S  I +M+    ++I+        
Sbjct: 65  EHLLRTAKLVVYYDKTRKEADKNQGNTKTALSTWFGSTGIKKMEALGKVYIKIATQIATG 124

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC----ESDQVQ 172
             G  D + +++ L G     V+L    N   GCKL  ++ +  A L+GC    +  +V 
Sbjct: 125 DKGVYDGKSKMMSLTG---KNVVLTNGDNVATGCKLTADMKSGKAFLEGCKTSEKKGRVS 181

Query: 173 SIIRYDGR 180
            I +   +
Sbjct: 182 IIFKQSQK 189


>gi|118589457|ref|ZP_01546863.1| hypothetical protein SIAM614_07928 [Stappia aggregata IAM 12614]
 gi|118438157|gb|EAV44792.1| hypothetical protein SIAM614_07928 [Stappia aggregata IAM 12614]
          Length = 192

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 74/164 (45%), Gaps = 16/164 (9%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-- 85
           Q  +     F     E I I+A  L V+D    A F G+V +TQ + SL+  ++ + Y  
Sbjct: 23  QTFSDAFAGFGSNEGEPIEIEASELRVEDNNNTATFVGDVLVTQGETSLKTQRLKVYYVG 82

Query: 86  ----NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
                  +  V  +I++++ E  +FI S +          D  K ++V+ G    +V+L 
Sbjct: 83  SGAEKTEDSAVQQRISKLEAEGGVFITSKDQTAKGDEASFDMNKEVMVMTG---REVVLS 139

Query: 142 EKLNTFLGCKLIVNIDTSFAS-------LQGCESDQVQSIIRYD 178
           +  N  +G KL VN+ T  A+       + G  + +V+  I+ +
Sbjct: 140 QGPNVVVGNKLTVNLKTGKANLSAGGGKVSGQGNGRVKVRIQPN 183


>gi|89075264|ref|ZP_01161691.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
 gi|89048945|gb|EAR54513.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
          Length = 168

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 62/176 (35%), Gaps = 17/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N +       AL+ +L  +  S          K    + I+I ++  E+      A F 
Sbjct: 1   MNRLKTS----ALLCLLCVSTSSW-------ALKSDTKQPINISSNSQELDVQNNIATFT 49

Query: 65  GNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q    + ADK+ +    +N          +      I      I+  A     +
Sbjct: 50  GDVRLRQGTIDIHADKVVVTRPNSNAKEQTIIAYGKPATFHQIMDDGKPIDGEALKMRYE 109

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +   L +     DK +L +      G  +  +I+      Q  +  +V ++I+ +
Sbjct: 110 TKTEFLKMT----DKAVLNQDGTEMKGNVITYDINKQRLVAQSGDKQRVTTVIQPN 161


>gi|269467916|gb|EEZ79651.1| hypothetical protein Sup05_0950 [uncultured SUP05 cluster
           bacterium]
          Length = 178

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 52/169 (30%), Gaps = 12/169 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
            +  L  A       +         +E + I ++  E++D    A + G+V +TQ    +
Sbjct: 7   TLLTLTTAAFLSICTTNAVALSTDRDEPLQINSESAEMRDREGYAIYSGSVRLTQGSIEI 66

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN----VIASNGYVDFQKRILVLNG 132
            AD + + +       +                 +        A+       +  + L G
Sbjct: 67  DADHIEVFFPEQEITHAVIFGDDKRRAYFQQLPKDGVKLVRGTANRIIYQADRDEIRLLG 126

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           D     I  +  N   G +++ +              +VQSI     +P
Sbjct: 127 DA----IFCQDGNEQKGERIVYDTKKDIMIA----KARVQSIFLPGKKP 167


>gi|154250650|ref|YP_001411474.1| cell envelope biogenesis YhbN [Parvibaculum lavamentivorans DS-1]
 gi|154154600|gb|ABS61817.1| Cell envelope biogenesis YhbN [Parvibaculum lavamentivorans DS-1]
          Length = 197

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 72/185 (38%), Gaps = 16/185 (8%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTR---FKVLGNEKIHIKADMLEVKDAVQKAFF 63
           S  ++   LA    +     +Q A         F+   ++ I ++AD LEV+D    A F
Sbjct: 16  STLVFAAFLAGGLAVAVPADAQTAGEGGGALGGFRTDPDKPIEVEADSLEVEDTKSTATF 75

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            GNV + Q +  ++AD++ + Y   + + S                 E +          
Sbjct: 76  IGNVRVAQGEIRMKADRIVVFYAPRSSNGSGIERLRATGNVFVSSPDEQSASGEWANYLI 135

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS---------LQGCESDQVQSI 174
             R + + GD    V+L++  N   G KL V++++  A           +   + +V+ +
Sbjct: 136 ATREIEM-GDA---VVLRQGENVIRGAKLFVDLNSGRARVVGGGTGVSGETGGTGRVKGL 191

Query: 175 IRYDG 179
            +  G
Sbjct: 192 FQPGG 196


>gi|298290363|ref|YP_003692302.1| OstA family protein [Starkeya novella DSM 506]
 gi|296926874|gb|ADH87683.1| OstA family protein [Starkeya novella DSM 506]
          Length = 228

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/189 (22%), Positives = 80/189 (42%), Gaps = 26/189 (13%)

Query: 10  LYIHLLALVFVLLKADLSQA--AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           L +   A +  L +  L+QA    + +  F    +E I I A+ LEV+D  ++A F GNV
Sbjct: 15  LLVTGAACLGPLARPALAQARNVPNALQGFAANRDEPIRINANSLEVRDQQKQAVFTGNV 74

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDV------------------SNKINRMDVERNIFIQS 109
            + Q D +L+  ++ + Y+                        S+ I R+++  ++ + +
Sbjct: 75  VVIQGDTTLRCKELVVYYDGKESGGKAGAPASSEALASGSPINSSAIRRLEINGSVVVTT 134

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
            E       G  +     + LNG     V+L    N   G KL V++ +  +   G    
Sbjct: 135 KEQTATGDYGTFETASNTITLNGSP---VVLTSGPNVIRGKKLTVDLASGMSRFDG---G 188

Query: 170 QVQSIIRYD 178
           +++S+I  +
Sbjct: 189 RIESLIVPN 197


>gi|52425770|ref|YP_088907.1| hypothetical protein MS1715 [Mannheimia succiniciproducens MBEL55E]
 gi|52307822|gb|AAU38322.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 171

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 61/167 (36%), Gaps = 8/167 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA+  +LL + L   + S     K   N+ I+I +D   +        F  NV +TQ   
Sbjct: 3   LAINKILLTSALVMTSLSAF-ALKDDTNQPINIVSDNQSLDMEKSIVTFTDNVVITQGSI 61

Query: 75  SLQADKMTIDYNN---TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            ++A+K+ I         ++             +       +  A+  + D  K  L L 
Sbjct: 62  LIKANKVIITRPPEGSKQKETVEAFGNPVTFHQMLDDGKPADGKANRVHYDLGKEFLTLT 121

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G+      LK+  +T  G  +  +++            +V++++   
Sbjct: 122 GNAQ----LKQLDSTIDGDVITYDVNKQQLKASSTAKSRVKTVLIPS 164


>gi|304310279|ref|YP_003809877.1| OstA-like protein [gamma proteobacterium HdN1]
 gi|301796012|emb|CBL44216.1| OstA-like protein [gamma proteobacterium HdN1]
          Length = 205

 Score =  100 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 60/192 (31%), Gaps = 19/192 (9%)

Query: 4   FLNSIHLYIHL--LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           F   IH ++    L  +                   +    + I I AD  E+ +    A
Sbjct: 5   FSKQIHPFLLTRRLTALCAWCLCLGFTLYGDTALALESDRQQPIEIIADQAELDEGQGVA 64

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV--ERNIFIQSGEINVIASNG 119
            + G V +TQ    + AD + I  +N  +              +        +   A   
Sbjct: 65  HYTGKVVLTQGSLIINADDLYIRADNNKQVQQVTAKGSPAVFTQTPEPDQPPVTAKAKTI 124

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG--------CESDQV 171
                   L+L  D     I+ +  +TF G ++  +I T      G          + +V
Sbjct: 125 DYYVSDEKLILQLDA----IVVQNESTFQGTRIQYDIRTRRMQATGGDAKNAVKGGNQRV 180

Query: 172 QSII---RYDGR 180
           + ++   + D +
Sbjct: 181 KMVLPPSQPDDK 192


>gi|270263245|ref|ZP_06191515.1| lipopolysaccharide transport periplasmic protein LptA [Serratia
           odorifera 4Rx13]
 gi|270042933|gb|EFA16027.1| lipopolysaccharide transport periplasmic protein LptA [Serratia
           odorifera 4Rx13]
          Length = 161

 Score =  100 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/153 (12%), Positives = 51/153 (33%), Gaps = 6/153 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN- 86
            AA++     K   N+ + I +    +      + F  NV + Q    ++ADK+ +    
Sbjct: 1   MAASAPAWALKSDSNQPVSIDSLKQSLDMQSNVSTFTDNVVIKQGTIDIKADKVVVTRPG 60

Query: 87  -NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            + ++              +      +   A     D   +++ L G+      L++  +
Sbjct: 61  GDQSKTYIEAFGNPVTFYQMQDSGKPVKGHAQKVRYDVASQLVTLTGNAY----LEQLDS 116

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G ++   +          +  +V +++   
Sbjct: 117 NVKGDRITYLVQQQQMQAFSDKGKRVTTVLVPS 149



 Score = 34.1 bits (76), Expect = 7.3,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 25/77 (32%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +    A Q     GN ++ Q D +++ D++T           +   +
Sbjct: 81  QDSGKPVKGHAQKVRYDVASQLVTLTGNAYLEQLDSNVKGDRITYLVQQQQMQAFSDKGK 140

Query: 99  MDVERNIFIQSGEINVI 115
                 +  Q  + N  
Sbjct: 141 RVTTVLVPSQLQDKNGQ 157


>gi|261493296|ref|ZP_05989822.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496562|ref|ZP_05992942.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307765|gb|EEY09088.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310940|gb|EEY12117.1| Cell envelope biogenesis YhbN [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 168

 Score =  100 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 56/170 (32%), Gaps = 10/170 (5%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
              +    LV VLL +  S          K   ++ I+I +    +        F  NV 
Sbjct: 1   MKLMFKSILVSVLLGSSFSA------YALKGDTDQPINIDSGSQSLDMTNNIVTFSDNVV 54

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +TQ    + A  + I      ++  +        +        +N   ++ + D     L
Sbjct: 55  ITQGSIKVTAANVKITRQEGKKETIDATGSPVTFQQTLDNGKPVNGKGNSVHYDLNSEFL 114

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L G+      LK++ +     K+  ++             +V++++  +
Sbjct: 115 TLIGNAE----LKQQGSFIKANKITYDVKKQQLKATSGGKTRVKTVLIPN 160


>gi|300718611|ref|YP_003743414.1| ABC transporter substrate-binding protein [Erwinia billingiae
           Eb661]
 gi|299064447|emb|CAX61567.1| ABC transporter, solute-binding protein [Erwinia billingiae Eb661]
          Length = 182

 Score =  100 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/148 (12%), Positives = 50/148 (33%), Gaps = 6/148 (4%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                    ++ +++ ++   +      A F GNV +TQ    + ADK+ +   + +   
Sbjct: 23  PALALTGDSDKPVNVDSENQALDMQGNVATFTGNVIVTQGSIKITADKVVVTRPDGDSKK 82

Query: 93  S--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
           +  +          +      +   A   + +  K  + L G+      L++  +   G 
Sbjct: 83  TIVDAYGNPATFYQMQDNGKPVKGHAQKMHYELAKDFVELTGNAY----LEQLDSNVKGD 138

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           ++   +        G    +V +I+   
Sbjct: 139 RITYLVKDQKMQAYGSSGKRVTTILVPS 166


>gi|240949437|ref|ZP_04753778.1| hypothetical protein AM305_10851 [Actinobacillus minor NM305]
 gi|240296186|gb|EER46842.1| hypothetical protein AM305_10851 [Actinobacillus minor NM305]
          Length = 168

 Score =  100 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 56/170 (32%), Gaps = 10/170 (5%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
              I   A++  LL   LS          K   ++ I+I +    +        F   V 
Sbjct: 1   MKLIIKSAILTTLLGVSLSA------HALKSDTDQPINIDSGSQSLDMNTNTVTFSDGVV 54

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +TQ    + A K+TI      ++  +        +        +N   ++ + D     L
Sbjct: 55  ITQGSIKVNASKVTIVRQEGKKETIDATGAPVTFQQTLDDGKPVNGKGNSVHYDLNSEFL 114

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L G+      LK+  +     ++  ++             +V++++  +
Sbjct: 115 TLIGNAE----LKQLDSYIKAERITYDVKKQQLKATSGGKSRVKTVLIPN 160


>gi|292900796|ref|YP_003540165.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291200644|emb|CBJ47776.1| putative exported protein [Erwinia amylovora ATCC 49946]
          Length = 179

 Score =  100 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 51/152 (33%), Gaps = 6/152 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A++          N+ +++ ++   +      A F GNV +TQ    + ADK+ +     
Sbjct: 16  ASSVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVLVTQGSIKITADKVVVTRPGG 75

Query: 89  NRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +   +  +    +     +      +   A     +     + L G+      L++  + 
Sbjct: 76  DSKKTIVDAYGNLATFYQMQDNGKPVQGHAEKMRYELANDRVELTGNAY----LEQLDSN 131

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G ++   +        G    +V +++   
Sbjct: 132 VKGDRITYLVKEQKMQAYGNTGKRVTTVLVPS 163


>gi|238758314|ref|ZP_04619492.1| hypothetical protein yaldo0001_2010 [Yersinia aldovae ATCC 35236]
 gi|238703437|gb|EEP95976.1| hypothetical protein yaldo0001_2010 [Yersinia aldovae ATCC 35236]
          Length = 165

 Score = 99.6 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 16/153 (10%), Positives = 49/153 (32%), Gaps = 6/153 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN- 86
            A +          ++ +++ +    +  A     F  NV + Q    ++ADK+ +    
Sbjct: 1   MATSLPALALTGDTDQPVNVDSVKQALDMAANTVTFTDNVIIRQGTIEIKADKVVVTRPG 60

Query: 87  -NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            + ++ V            +      +         +     +VL G+      L++  +
Sbjct: 61  GDQSKMVIEGYGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDS 116

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G ++   +          + ++V +++   
Sbjct: 117 NIKGDRITYLVKKQQMEAFSDKGNRVTTVLLPS 149


>gi|257465175|ref|ZP_05629546.1| hypothetical protein AM202_01600 [Actinobacillus minor 202]
 gi|257450835|gb|EEV24878.1| hypothetical protein AM202_01600 [Actinobacillus minor 202]
          Length = 168

 Score = 99.6 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 56/170 (32%), Gaps = 10/170 (5%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
              I   A++  LL   LS          K   ++ I+I +    +        F   V 
Sbjct: 1   MKLIIKSAILTTLLGVSLSA------HALKSDTDQPINIDSGSQSLDMNTNTVIFSDGVV 54

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +TQ    + A K+TI      ++  +        +        +N   ++ + D     L
Sbjct: 55  ITQGSIKVNASKVTIVRQEGKKETIDATGAPVTFQQTLDDGKPVNGKGNSVHYDLNSEFL 114

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L G+      LK+  +     ++  ++             +V++++  +
Sbjct: 115 TLIGNAE----LKQLDSYIKAERITYDVKKQQLKATSGGKSRVKTVLIPN 160


>gi|146337288|ref|YP_001202336.1| putative OstA-like protein [Bradyrhizobium sp. ORS278]
 gi|146190094|emb|CAL74086.1| conserved hypothetical protein; putative OstA-like protein
           [Bradyrhizobium sp. ORS278]
          Length = 232

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/174 (17%), Positives = 70/174 (40%), Gaps = 21/174 (12%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L     +    + +  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ +  
Sbjct: 27  LQAQSATTGVPNALQGFSQNRDQPIQIEAASLEMRDKKKEATFTGNVKVVQGDTTMTSKS 86

Query: 81  MTIDYNNTNRD-----------------VSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           + + Y+   +                   S+ I R++   ++ +   +  V       D 
Sbjct: 87  LVVFYDGGAQQGGAKATKATPAATPGPDGSSAIRRLEARGDVKVTQKDQVVTGETAVYDT 146

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           +  ++ + G     V+L +  N   G +L V++ T  + ++      VQ ++  
Sbjct: 147 KTNMITMQG----GVVLTQCKNVMRGDRLTVDMTTGVSRVESDGGRGVQVLLPQ 196


>gi|292486806|ref|YP_003529676.1| LPS export porin complex, periplasmic chaperone [Erwinia amylovora
           CFBP1430]
 gi|291552223|emb|CBA19260.1| LPS export porin complex, periplasmic chaparone precursor [Erwinia
           amylovora CFBP1430]
          Length = 183

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 51/152 (33%), Gaps = 6/152 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A++          N+ +++ ++   +      A F GNV +TQ    + ADK+ +     
Sbjct: 20  ASSVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVLVTQGSIKITADKVVVTRPGG 79

Query: 89  NRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +   +  +    +     +      +   A     +     + L G+      L++  + 
Sbjct: 80  DSKKTIVDAYGNLATFYQMQDNGKPVQGHAEKMRYELANDRVELTGNAY----LEQLDSN 135

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G ++   +        G    +V +++   
Sbjct: 136 VKGDRITYLVKEQKMQAYGNTGKRVTTVLVPS 167


>gi|259417071|ref|ZP_05740990.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
 gi|259345977|gb|EEW57791.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
          Length = 165

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 70/175 (40%), Gaps = 12/175 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +   I       V   A ++Q         +   ++ + I +D + V      A   
Sbjct: 1   MRRLTFVILFGLTALVHTPALMAQGTGVSFGVLQTDTSQPVDITSDNMSVNQEDGSALLT 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           G+V + Q +  L AD + +          N I R++   N+ + SGE    A       +
Sbjct: 61  GSVLIIQGEMRLSADNVLVVRRAE----GNGIERLEARGNVLLVSGEDAAEAREADYTIE 116

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
              +V+ G+    V+L ++ NT    ++ VNI T  A+L G    +V++ +   G
Sbjct: 117 SGTVVMRGN----VLLTQQGNTLGAEQMTVNITTGNATLSG----RVRTTLPGSG 163


>gi|261868144|ref|YP_003256066.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391915|ref|ZP_06636249.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261413476|gb|ACX82847.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952449|gb|EFE02568.1| lipopolysaccharide transport periplasmic protein LptA
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 172

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 63/176 (35%), Gaps = 16/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S+   I   +++ ++  +  +          K   N+ I+I +D   +    +   F 
Sbjct: 1   MKSVSNNIFFASMLMLVSLSTFA---------LKDDTNQPINIVSDNQSLDMTSRVVIFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV +TQ    ++A+K+ I     N+  +D             +      ++  A+  + 
Sbjct: 52  DNVVITQGSIVVKANKVIITRPEENSKKKDTVEAFGNPVTFHQVMDDGKPVDGKANKVFY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D     L L G+      LK+  +   G  +  ++        G    +V +++  
Sbjct: 112 DLGTEFLTLTGNAE----LKQLDSKINGNVITYDVKKQQLKANGSSGSRVTTVLIP 163



 Score = 33.7 bits (75), Expect = 9.6,   Method: Composition-based stats.
 Identities = 10/76 (13%), Positives = 20/76 (26%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
              + +  KA+ +      +     GN  + Q D  +  + +T D        +      
Sbjct: 97  DDGKPVDGKANKVFYDLGTEFLTLTGNAELKQLDSKINGNVITYDVKKQQLKANGSSGSR 156

Query: 100 DVERNIFIQSGEINVI 115
                I  Q       
Sbjct: 157 VTTVLIPAQLNNAKGK 172


>gi|253997531|ref|YP_003049595.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera mobilis JLW8]
 gi|253984210|gb|ACT49068.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera mobilis JLW8]
          Length = 226

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 73/184 (39%), Gaps = 12/184 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N     I++  L  +LL   L    A          ++ I ++AD ++V DA Q + + 
Sbjct: 1   MNRQLFMININTLSSLLLCGGLLLGVAGRAWAEAADRDKPIDLEADTMKVDDAKQISTYS 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI-FIQSGEINVIASNGYVDF 123
           GNV +TQ    ++ADK+ +  +      S  +      +     +S  I   A     D 
Sbjct: 61  GNVILTQGTLEIRADKLIVREDKEGFQHSTSLGNPTTFKQKLEGKSEYIQGSAQRIEYDG 120

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE-------SDQVQSIIR 176
           +   + L      K  +K   +   G  ++ + +  +A + G         S +V+++I+
Sbjct: 121 RMDKVQL----YTKAWVKRGEDVVHGDYIMYDANAEYAEVIGGNSQSATSGSGRVRAVIQ 176

Query: 177 YDGR 180
              +
Sbjct: 177 PKNK 180


>gi|195952774|ref|YP_002121064.1| lipopolysaccharide transport periplasmic protein LptA
           [Hydrogenobaculum sp. Y04AAS1]
 gi|195932386|gb|ACG57086.1| lipopolysaccharide transport periplasmic protein LptA
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 170

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 66/180 (36%), Gaps = 14/180 (7%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N   +++     +  L  + + +   +   +     N+ I+I+A+ ++  +    
Sbjct: 1   MKNKVNKKVVFVISSLTLSFLAFSKVEKPTQNTPVKNTSNNNKPIYIEANKMDYNN--NV 58

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
             + GNV  T+ +  L   ++ I  +   +        +    N         +      
Sbjct: 59  ITYTGNVVATRGNGKLTCQELKIFLDKNKKIEK-----IIATGNPVYTEPNKLIKGDVIE 113

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            D  +  +++ G+      L+ K +   G ++I       A + G    +VQSI   +G+
Sbjct: 114 YDALQDEIIVTGNAY----LENKGDVVQGDRVIYYKKLDKAIVTG---KRVQSIFIPNGK 166


>gi|293394217|ref|ZP_06638517.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Serratia odorifera DSM
           4582]
 gi|291423195|gb|EFE96424.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Serratia odorifera DSM
           4582]
          Length = 168

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 54/158 (34%), Gaps = 6/158 (3%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
            A    A ++     K   ++ + I +    +      + F  NV + Q    ++ADK+ 
Sbjct: 2   IASTVLAVSAPALALKSDSDQPVSIDSLKQALDMQSNVSTFTDNVVIKQGTIEIKADKVV 61

Query: 83  IDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           +     + N+       +      +      +   A     D   +++ L G+      L
Sbjct: 62  VTRPGGDQNKTYIEAFGKPVTFYQMQDNGKPVKGHAQKVRYDVAPQLVTLTGNAY----L 117

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           ++  +   G ++   +          + ++V++++   
Sbjct: 118 EQLDSNVKGDRITYLVQQQQMQAYSDKGNRVKTVLVPS 155



 Score = 34.1 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 24/77 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +    A Q     GN ++ Q D +++ D++T           +    
Sbjct: 87  QDNGKPVKGHAQKVRYDVAPQLVTLTGNAYLEQLDSNVKGDRITYLVQQQQMQAYSDKGN 146

Query: 99  MDVERNIFIQSGEINVI 115
                 +  Q  + N  
Sbjct: 147 RVKTVLVPSQLQDKNGQ 163


>gi|188532474|ref|YP_001906271.1| lipopolysaccharide transport periplasmic protein LptA [Erwinia
           tasmaniensis Et1/99]
 gi|188027516|emb|CAO95363.1| Putative ABC superfamily (Bind_prot) transport protein [Erwinia
           tasmaniensis Et1/99]
          Length = 182

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 55/160 (34%), Gaps = 6/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL A L  A +  +       ++ +++ ++   +      A F G V +TQ    + ADK
Sbjct: 11  LLTASLLLAISVPVLALTDDSSKPVNVDSENQALDMQGNVATFTGKVVVTQGSIKITADK 70

Query: 81  MTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +     +   +  +          +      +   A   + +  K ++ L G      
Sbjct: 71  VVVTRPGGDSKKTIVDAYGNPATFYQMQDNGKPVQGHAQKMHYELAKDLVELTGGAY--- 127

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G ++   +        G    +V +++   
Sbjct: 128 -LEQLDSNVKGDRITYLVKEQKMQAFGNTGKRVTTVLVPS 166


>gi|154244024|ref|YP_001414982.1| OstA family protein [Xanthobacter autotrophicus Py2]
 gi|154158109|gb|ABS65325.1| OstA family protein [Xanthobacter autotrophicus Py2]
          Length = 230

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 78/183 (42%), Gaps = 25/183 (13%)

Query: 15  LALVFVLLKADLSQAA--ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
             +      + ++Q +   + +  F    ++ + I AD LEV+D  + A F GNV +TQ 
Sbjct: 34  ALVGVATSSSAVAQTSNVPNALQGFAKNRDQPVRINADSLEVRDKDKVAVFSGNVLVTQG 93

Query: 73  DFSLQADKMTIDY-----------------NNTNRDVSNKINRMDVERNIFIQSGEINVI 115
           D +L++  + + Y                 N  +     +I +++    + +++ E    
Sbjct: 94  DTTLRSKDLMVYYEGSVAQQAGGQPAGEQANGVDPSQKGQIRKLEAVGGVVVKTKEQTAT 153

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
             +G  + +   + L G     V+L +  N   G KL+V++ +  +  +G    +V+S+I
Sbjct: 154 GDSGVFEMKTNTVTLVGKP---VVLTQGPNVIRGQKLVVDLVSGVSKFEG---GRVESLI 207

Query: 176 RYD 178
              
Sbjct: 208 VPG 210


>gi|312170874|emb|CBX79133.1| LPS export porin complex, periplasmic chaparone precursor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 183

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 51/152 (33%), Gaps = 6/152 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A++          N+ +++ ++   +      A F GNV +TQ    + ADK+ +     
Sbjct: 20  ASSVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVLVTQGSIKITADKVVVTRPGG 79

Query: 89  NRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +   +  +    +     +      +   A     +     + L G+      L++  + 
Sbjct: 80  DSKKTIVDAYGNLATFYQMQDNGKPVQGHAEKMRYELANDRVELTGNAY----LEQLDSN 135

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G ++   +        G    +V +++   
Sbjct: 136 VKGDRITYLVKEQKMQAYGNTGKRVTTVLVPS 167


>gi|114706452|ref|ZP_01439354.1| hypothetical protein FP2506_01670 [Fulvimarina pelagi HTCC2506]
 gi|114538313|gb|EAU41435.1| hypothetical protein FP2506_01670 [Fulvimarina pelagi HTCC2506]
          Length = 202

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/203 (21%), Positives = 83/203 (40%), Gaps = 28/203 (13%)

Query: 1   MSAFLNSIHLYIHLLA-LVFVLLKADLSQAAASY--MTRFKVLGNEKIHIKADMLEVKDA 57
           M+  L +  L   L+A    +L     +Q           ++ G++ I I++  L+V D 
Sbjct: 1   MNMRLPTAALSASLIAGTAVMLSFPVYAQQGGLGNNFNGLQLDGDQPISIESSTLDVDDK 60

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN-------------RDVSNKINRMDVERN 104
              A F GNV + Q    L+  K+ + YNN+                 S+ I R++    
Sbjct: 61  AAIATFTGNVSVAQGPTQLRTGKLVVHYNNSGSGQSGASSGSSALPGGSSSIERLEASEK 120

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           ++++S +    A     D    ++V+ GD    V+L +  N   GC+L + +DT  A L+
Sbjct: 121 VYVKSEDQVATAERASFDMASNVVVMTGD----VVLSQGENVAEGCRLTIQMDTGQARLE 176

Query: 165 GCE--------SDQVQSIIRYDG 179
                        +V+ ++  + 
Sbjct: 177 STNCDGSGSGGGGRVRMMLTPED 199


>gi|323136909|ref|ZP_08071989.1| OstA family protein [Methylocystis sp. ATCC 49242]
 gi|322397670|gb|EFY00192.1| OstA family protein [Methylocystis sp. ATCC 49242]
          Length = 179

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/183 (20%), Positives = 71/183 (38%), Gaps = 13/183 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           +      +   F+L     +QAA             + ++I A  L+  D  QK  + G+
Sbjct: 1   MRHTAFAVLAAFLLAGVAPAQAAGRSGGILPGATAKDPLNIDAGKLDFFDKEQKLVYSGS 60

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKI-----NRMDVERNIFIQSGEINVIASNGYV 121
           V +T    +L+A K+TI   N     +          +D +  + + S +          
Sbjct: 61  VIVTNGPSTLKASKITIFLENKGAAAAGATSNDRVKHIDADGPVTLVSKDQIGTGDRASY 120

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDG 179
           D  +  + L G+    V L +  N   G +L+ ++ T+ A++QG      +V+S      
Sbjct: 121 DKAENKVYLTGN----VTLTQGENVVKGERLVYDVTTAIATVQGGGAQGGRVRSTFTPGS 176

Query: 180 -RP 181
            +P
Sbjct: 177 AKP 179


>gi|259907013|ref|YP_002647369.1| lipopolysaccharide transport periplasmic protein LptA [Erwinia
           pyrifoliae Ep1/96]
 gi|224962635|emb|CAX54090.1| ABC superfamily (Bind_prot) transport protein [Erwinia pyrifoliae
           Ep1/96]
          Length = 179

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/150 (12%), Positives = 51/150 (34%), Gaps = 6/150 (4%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +          N+ ++I ++   +      A F GNV +TQ    + ADK+ +     + 
Sbjct: 18  SVPAFALTGDSNKPVNIDSENQALDMQGNVATFTGNVVVTQGSIKITADKVVVTRPGGDS 77

Query: 91  DVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
             +  +    +     +      +   A   + +    ++ L G+      L++  +   
Sbjct: 78  KKTIVDAYGNLATFYQMQDNGKPVQGHAQKMHYELASDLVELTGNAY----LEQLDSNVK 133

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G ++   +        G    +V +++   
Sbjct: 134 GDRITYLVKEQKMQAFGNTGRRVTTVLVPS 163


>gi|209883611|ref|YP_002287468.1| hypothetical protein OCAR_4457 [Oligotropha carboxidovorans OM5]
 gi|209871807|gb|ACI91603.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 246

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 70/190 (36%), Gaps = 28/190 (14%)

Query: 13  HLLALVFVLLKADLSQAA-----ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
             L++   ++    +Q +      + +  F     + I I A  LEV+D  + A F GNV
Sbjct: 18  LALSVPCHVVPPARAQTSTVSGVPNAVQGFSKNRGQPIQIDALSLEVRDKDKVATFSGNV 77

Query: 68  FMTQEDFSLQADKMTIDYNNT-------------------NRDVSNKINRMDVERNIFIQ 108
            + Q D ++++  + + Y                          S+ + R++    + + 
Sbjct: 78  KVVQGDTTMRSKTLVVFYEQQGKSGANKSGSKAGMTTAQPGPGGSSSVKRLEARGGVVVT 137

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
             +  V    G  D +   + L G     V+L +  N   G +L+V++ T  + ++    
Sbjct: 138 QNDQTVTGETGIFDMKTNTVTLTG----GVVLTKDKNVLKGDRLVVDMTTGVSRVESSGG 193

Query: 169 DQVQSIIRYD 178
             V  +    
Sbjct: 194 RGVSGLFNSS 203


>gi|320538915|ref|ZP_08038591.1| periplasmic LPS-binding protein [Serratia symbiotica str. Tucson]
 gi|320031075|gb|EFW13078.1| periplasmic LPS-binding protein [Serratia symbiotica str. Tucson]
          Length = 179

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/180 (11%), Positives = 57/180 (31%), Gaps = 15/180 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +      + + +++ V     L+          K   N+ + I +    +      
Sbjct: 1   MKFRIQKPLRNLLIASVILVTSAPALA---------LKSDANQPVAIDSLKQSLDMQNNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
           + F  NV + Q    ++ADK+ + +   + N+              +      +   A  
Sbjct: 52  STFTDNVVIKQGTIDIRADKVVVTHPGGDQNKTYIEAFGDPVTFHQMQDSGKPVKGHAQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              D   +++ L G+      L++  +     ++   +          +  +V +++   
Sbjct: 112 VRYDVATQLVTLTGNAY----LEQLDSNVKSDRITYLVQQQQMQAFSDKGKRVTTVLVPS 167



 Score = 34.1 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 26/77 (33%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +    A Q     GN ++ Q D ++++D++T           +   +
Sbjct: 99  QDSGKPVKGHAQKVRYDVATQLVTLTGNAYLEQLDSNVKSDRITYLVQQQQMQAFSDKGK 158

Query: 99  MDVERNIFIQSGEINVI 115
                 +  Q  + N  
Sbjct: 159 RVTTVLVPSQLQDKNGQ 175


>gi|260431733|ref|ZP_05785704.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415561|gb|EEX08820.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 137

 Score = 99.2 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 64/147 (43%), Gaps = 12/147 (8%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                K      + + ++ L+V      A F GNV + Q D  L A+K+ + YN      
Sbjct: 2   AFGSIKTDPALPVEVTSETLKVNQEDGSAEFLGNVIVVQGDMRLSAEKVVVIYNQDR--- 58

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
            + I RM+   N+ + +      A          ++V+ G+    V+L +  +T  G ++
Sbjct: 59  -SGIERMEASENVVLVAPPDAAQADRAEYSIATGVIVMTGN----VLLNQGPSTISGDRM 113

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYDG 179
           + N+    A++ G    +V++I++  G
Sbjct: 114 VANLTDGTATMTG----RVKTILQQGG 136


>gi|319403504|emb|CBI77083.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 199

 Score = 98.8 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 23/189 (12%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL L   +L +    AA ++     + G E + + AD LE++D    A F G+V + Q
Sbjct: 11  VSLLTLSLAILGSINGYAAVTHFGIDGLNGQEPMELYADSLEIRDKEGIAVFNGDVSVMQ 70

Query: 72  EDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQSGEINVI 115
            +  L+  K+ I YN  +                +  S  I +++    ++I+  +    
Sbjct: 71  GERLLRTSKLVIYYNKAHITGGINQLRKQSIFPEKIGSTDIQKVEALGEVYIKMAKQTAT 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG----CESDQV 171
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+G     + ++V
Sbjct: 131 GDKAIFDGQSNMIILTGN---NVVLTDGDNVAQGCILTANMKTGKASLEGCKTPGKKNRV 187

Query: 172 QSIIRYDGR 180
             I++   +
Sbjct: 188 SIILKSSSK 196


>gi|50084656|ref|YP_046166.1| hypothetical protein ACIAD1485 [Acinetobacter sp. ADP1]
 gi|49530632|emb|CAG68344.1| putative lipopolysaccharide transport protein A (ABC superfamily,
           peri_bind) (LptA) [Acinetobacter sp. ADP1]
          Length = 158

 Score = 98.8 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 52/149 (34%), Gaps = 6/149 (4%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S         N+ I + AD     D      + GNV + Q    LQAD +    N+  + 
Sbjct: 4   SAAFAVPSDRNQPISLVADHATYNDKTGVTTYTGNVVIEQGTMKLQADSIVGQLNSQRQL 63

Query: 92  VSNKINRMDVERNIFIQSGEINVIA--SNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
            +        +    I + +            + +  I+ L+G+      L +   +  G
Sbjct: 64  QTINATGRPAKFQQQINAQKGIARGEAQKIVYNAETGIITLSGNAY----LNQDGASVRG 119

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             L  +++      QG  S++VQ +I   
Sbjct: 120 NTLRYSMNKGDIEAQGSGSNRVQLVIPPS 148


>gi|84387809|ref|ZP_00990824.1| hypothetical protein V12B01_07448 [Vibrio splendidus 12B01]
 gi|84377324|gb|EAP94192.1| hypothetical protein V12B01_07448 [Vibrio splendidus 12B01]
          Length = 164

 Score = 98.8 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 62/175 (35%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +HL +  L L            AA  +        + ++I +D  ++     +  F 
Sbjct: 1   MKLLHLSLFALTL------------AAPNVYALSSDSEQPVYIDSDSQQLDMKSNQVTFL 48

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +      +      +      +   A + +  
Sbjct: 49  GDVNLKQGSININADKVIVTRNAVNGEIEEIQGFGKPATFSQLTDDGKTLYGEADDLHYQ 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                L++  +     +L +  +   G K+   I +        E+ +V ++++ 
Sbjct: 109 LVADKLIMTKNA----MLSQDGSIIRGSKITYQIGSQKLVADSGENKRVSTVLQP 159


>gi|238785094|ref|ZP_04629089.1| hypothetical protein yberc0001_150 [Yersinia bercovieri ATCC 43970]
 gi|238713986|gb|EEQ06003.1| hypothetical protein yberc0001_150 [Yersinia bercovieri ATCC 43970]
          Length = 165

 Score = 98.8 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 16/153 (10%), Positives = 49/153 (32%), Gaps = 6/153 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN- 86
            AA+          ++ +++ +    +        F  NV + Q    ++ADK+ +    
Sbjct: 1   MAASLPALALTGDTDQPVNVVSGKQALDMQANTVTFTDNVIIKQGTIEIKADKVVVTRPG 60

Query: 87  -NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            + ++ V            +      +         +     +VL G+      L++  +
Sbjct: 61  GDQSKMVIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDS 116

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G ++   +          + ++V +++   
Sbjct: 117 NIKGDRITYLVKKQHMEAFSDKGNRVTTVLLPS 149


>gi|148977772|ref|ZP_01814328.1| hypothetical protein VSWAT3_21295 [Vibrionales bacterium SWAT-3]
 gi|145962986|gb|EDK28256.1| hypothetical protein VSWAT3_21295 [Vibrionales bacterium SWAT-3]
          Length = 164

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 62/175 (35%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +HL +  L L            AA  +        + ++I +D  ++     +  F 
Sbjct: 1   MKLLHLSLFALTL------------AAPNVYALSSDSEQPVYIDSDSQQLDMKSNQVTFI 48

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +      +      +      +   A + +  
Sbjct: 49  GDVNLKQGSININADKVIVTRNAVNGEIEEIQGFGKPATFSQLTDDGKTLYGEADDLHYQ 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                L++  +     +L +  +   G K+   I +        E+ +V ++++ 
Sbjct: 109 LVADKLIMTKNA----MLSQDGSIIRGSKITYQIGSQKLVADSGENKRVSTVLQP 159


>gi|283476808|emb|CAY72646.1| LPS export porin complex, periplasmic chaparone precursor [Erwinia
           pyrifoliae DSM 12163]
          Length = 183

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/150 (12%), Positives = 51/150 (34%), Gaps = 6/150 (4%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +          N+ ++I ++   +      A F GNV +TQ    + ADK+ +     + 
Sbjct: 22  SVPAFALTGDSNKPVNIDSENQALDMQGNVATFTGNVVVTQGSIKITADKVVVTRPGGDS 81

Query: 91  DVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
             +  +    +     +      +   A   + +    ++ L G+      L++  +   
Sbjct: 82  KKTIVDAYGNLATFYQMQDNGKPVQGHAQKMHYELASDLVELTGNAY----LEQLDSNVK 137

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G ++   +        G    +V +++   
Sbjct: 138 GDRITYLVKEQKMQAFGNTGRRVTTVLVPS 167


>gi|84500655|ref|ZP_00998904.1| hypothetical protein OB2597_11871 [Oceanicola batsensis HTCC2597]
 gi|84391608|gb|EAQ03940.1| hypothetical protein OB2597_11871 [Oceanicola batsensis HTCC2597]
          Length = 162

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%), Gaps = 12/156 (7%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
                A  +     ++  +  + +++D L V  +   A F GNV + Q +  L A ++ +
Sbjct: 18  PVAGMAQQTAFGSAQLDPDTPVEVESDELRVNQSDGTAEFLGNVVIVQAEMRLAAPRVLV 77

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            Y+        +I  ++    + + SGE    A     D     +V+ GD    V+L + 
Sbjct: 78  TYDEE----GERIRLLEATGGVTLVSGEDAAEAQRADYDIDAGTIVMEGD----VLLVQG 129

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            +T     + V++++  A + G    +V++++   G
Sbjct: 130 ESTLASQAMTVDLESGTAQMSG----RVRTLLNPGG 161


>gi|46143808|ref|ZP_00133923.2| COG1934: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207821|ref|YP_001053046.1| hypothetical protein APL_0337 [Actinobacillus pleuropneumoniae L20]
 gi|165975795|ref|YP_001651388.1| hypothetical protein APJL_0353 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149611|ref|YP_001968136.1| hypothetical protein APP7_0342 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249490|ref|ZP_07335697.1| hypothetical protein APP6_0891 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307245161|ref|ZP_07527253.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249555|ref|ZP_07531542.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307251884|ref|ZP_07533785.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254109|ref|ZP_07535955.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256379|ref|ZP_07538162.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258572|ref|ZP_07540308.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260807|ref|ZP_07542494.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307262935|ref|ZP_07544557.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126096613|gb|ABN73441.1| hypothetical protein APL_0337 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875896|gb|ABY68944.1| hypothetical protein APJL_0353 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914742|gb|ACE60994.1| hypothetical protein APP7_0342 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302651564|gb|EFL81713.1| hypothetical protein APP6_0891 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853941|gb|EFM86154.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306858410|gb|EFM90479.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860576|gb|EFM92588.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862933|gb|EFM94881.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865205|gb|EFM97105.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867366|gb|EFM99218.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869533|gb|EFN01323.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871561|gb|EFN03283.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 167

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 52/150 (34%), Gaps = 4/150 (2%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           + +      K   ++ I+I +    +        F  NV +TQ    + ADK+TI     
Sbjct: 15  STSLSSYALKGDTDQPINIDSGSQSLDMNSNVVTFSDNVVITQGSIKVTADKVTIIRQEG 74

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            ++           +        +N   ++ + D     L L G+      LK++ +   
Sbjct: 75  KKETLEASGSPVTFQQTLDNGKPVNGKGNSVHYDLNSEFLTLVGNAE----LKQQGSFIK 130

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             K+  ++             +V++I+  +
Sbjct: 131 ASKITYDVKKQQLKANSGNKSRVKTILIPN 160


>gi|319406418|emb|CBI80058.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 199

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 23/189 (12%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL L   +L +    AA ++     + G E + + AD LE++D    A F G+V + Q
Sbjct: 11  VSLLTLSLAILGSINGYAAVTHFGIDGLNGQEPMELYADSLEIRDKEGIAVFNGDVSVMQ 70

Query: 72  EDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQSGEINVI 115
            +  L+  K+ I YN  +                +  S  I +++    ++I+  +    
Sbjct: 71  GERLLRTSKLVIYYNKAHITGGINQLRRQSIFPEKIGSTDIQKVEALGEVYIKMAKQTAT 130

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC----ESDQV 171
                 D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+GC    + ++V
Sbjct: 131 GDKAIFDGQSNMIILTGN---NVVLTDGDNVAQGCILTANMKTGKASLEGCKTPRKKNRV 187

Query: 172 QSIIRYDGR 180
             I+    +
Sbjct: 188 SIILESSSK 196


>gi|146281419|ref|YP_001171572.1| OstA family protein [Pseudomonas stutzeri A1501]
 gi|145569624|gb|ABP78730.1| OstA family protein [Pseudomonas stutzeri A1501]
          Length = 181

 Score = 98.5 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 52/169 (30%), Gaps = 13/169 (7%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL    +               + I ++AD  E+ D    A ++G+V +TQ    +  D 
Sbjct: 9   LLLGLSAFWLGVSAWALPEDREQPIRVQADSAELDDRQGVAVYRGDVVITQGTMKITGDT 68

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFI--QSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           +TI  ++                          +               +VL     D+ 
Sbjct: 69  VTITQDSNGDVEVFTSIGKPAYYEQKPAVDKEIVKAYGLTIQYFAANERIVL----LDQA 124

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASL-------QGCESDQVQSIIRYDGR 180
            + ++ NTF G K++ +      +              +V  +I+   R
Sbjct: 125 KVVQEGNTFEGEKIVYDTRRQIVNAGRATNTDVSTPRPRVDMVIQPRKR 173


>gi|319404928|emb|CBI78528.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 199

 Score = 98.5 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 24/200 (12%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M A   S    + +LAL   +L +    AA ++     + G E + + AD LE++D    
Sbjct: 1   MKA-KKSCKERVSILALSLAILGSINGYAAVTHFGFDGLNGKEPMELYADSLEIRDKEGI 59

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERN 104
           A   GNV + Q +  LQ  K+ I YN  +                +  S  I +++    
Sbjct: 60  AILNGNVSVMQGERLLQTSKLAIYYNKAHITGGINQLRTQSIFPEKIGSTDIKKVEALGE 119

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           ++I+             D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+
Sbjct: 120 VYIKVATQTAKGDKAIFDGQSNMIILTGN---NVVLTDGDNVAEGCILTANMKTGKASLE 176

Query: 165 G----CESDQVQSIIRYDGR 180
           G     + ++V  I+    +
Sbjct: 177 GCKEPGKKNRVSIILEASSK 196


>gi|322514083|ref|ZP_08067154.1| YhbN like protein [Actinobacillus ureae ATCC 25976]
 gi|322120100|gb|EFX92071.1| YhbN like protein [Actinobacillus ureae ATCC 25976]
          Length = 166

 Score = 98.5 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 21/148 (14%), Positives = 52/148 (35%), Gaps = 4/148 (2%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +  +   K   ++ I+I +    +        F  NV +TQ    + A K+TI      +
Sbjct: 17  SISVHALKGDTDQPINIDSGSQSLDMNSNVVVFTDNVVITQGSIKVTAHKVTITRQEGKK 76

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
           +  +        +        +N   ++ + +     L L G+      LK++ +     
Sbjct: 77  ETLDATGSPVTFQQTLDNGKSVNGKGNSVHYNLNSEFLTLIGNAE----LKQQGSFIKAS 132

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           K+  +I             +V++++  +
Sbjct: 133 KITYDIKKQQLKANSGNKSRVRTVLIPN 160


>gi|322834667|ref|YP_004214694.1| lipopolysaccharide transport periplasmic protein LptA [Rahnella sp.
           Y9602]
 gi|321169868|gb|ADW75567.1| lipopolysaccharide transport periplasmic protein LptA [Rahnella sp.
           Y9602]
          Length = 185

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 49/160 (30%), Gaps = 6/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL      A +      K    + I I +    +      A F GNV + Q    ++ADK
Sbjct: 12  LLIVSSLLAVSVPAFALKDDTTKPITIDSANQALDVNTNTATFTGNVVVNQGTIQVKADK 71

Query: 81  MTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +                       +      I   A     + +  ++ L G+     
Sbjct: 72  VVVIRPQGVSGKEVVEGYGNPVTFYQMQDNGKPIKGHAQKVRYEVENDLVTLTGNAY--- 128

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L++  +   G ++   +          + ++V +++   
Sbjct: 129 -LEQLDSNVKGDRITYLVQKQQMEAFSDKGNRVTTVLVPS 167


>gi|302343389|ref|YP_003807918.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfarculus baarsii DSM 2075]
 gi|301640002|gb|ADK85324.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfarculus baarsii DSM 2075]
          Length = 183

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 73/190 (38%), Gaps = 26/190 (13%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
              + + A +FV        AA + +    V  ++ I++ AD LEV +    A F G V 
Sbjct: 1   MKRLTIAATLFVFCL----FAAGAALAAELVASDKPINVDADSLEVDNKNNVAHFIGKVT 56

Query: 69  MTQEDFSLQADKMTIDYNNTNRD------------------VSNKINRMDVERNIFIQSG 110
             Q D ++  D++ + Y+NT++                      ++ ++    ++ +   
Sbjct: 57  AKQGDVNIVCDQLDVYYDNTDKPRQEAPAQASGESALGLGGGDGRVTKVVALGHVRVTQK 116

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
           +   +   G      R L++ G+      + +  N   G K+ V +D   A + G    +
Sbjct: 117 DRVAVGRKGTYWAGARKLLMEGNA----TVWQGKNQVAGEKITVFLDQDRALVHGQPGKR 172

Query: 171 VQSIIRYDGR 180
           V   I  D +
Sbjct: 173 VSVTIVPDKK 182


>gi|27375832|ref|NP_767361.1| hypothetical protein blr0721 [Bradyrhizobium japonicum USDA 110]
 gi|27348970|dbj|BAC45986.1| blr0721 [Bradyrhizobium japonicum USDA 110]
          Length = 239

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 72/185 (38%), Gaps = 26/185 (14%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
             +     Q   + M  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ + 
Sbjct: 35  AAIAQSTMQGVPNAMQGFSQNRDQPIQIEAASLEMRDKKKEATFAGNVKVIQGDTTMTSK 94

Query: 80  KMTIDYNNTNRD------------------------VSNKINRMDVERNIFIQSGEINVI 115
            + + Y +                             S+ I R++   N+ +   +  V 
Sbjct: 95  TLVVFYESGGDKPATPQPAAKGAKAAPMQSATPGPGGSSSIKRLEARGNVVVTQKDQVVT 154

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
                 D +  ++ + G    +V+L +  N   G +L+V++ T  + ++      V+ + 
Sbjct: 155 GDTAVFDTKTNLITMLG-GTGQVVLTQCKNVLQGDRLVVDMTTGVSRVESDSGK-VRGLF 212

Query: 176 RYDGR 180
             + +
Sbjct: 213 DQNSK 217


>gi|113461318|ref|YP_719387.1| hypothetical protein HS_1175 [Haemophilus somnus 129PT]
 gi|112823361|gb|ABI25450.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 172

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 60/176 (34%), Gaps = 16/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S      L+  + +   + L+          K   N+ I I +D   +        F 
Sbjct: 1   MKSTTNKYLLITALMMTSISALA---------LKDDTNQPIDIVSDHQSLDMENSVVTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV + Q    ++A+K+ I      +  ++         +   +      +   A+  + 
Sbjct: 52  NNVVIKQGSILIKANKVVITRPTEKSNKKETVEAFGNPVLFNQLLDNGKPVQGKANKIHY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D     L L G+      LK+  +   G K+  ++        G  + +V++++  
Sbjct: 112 DLSAEFLTLTGNAE----LKQLDSKINGEKITYDVKKQQLKANGAGTSRVKTVLIP 163


>gi|320352645|ref|YP_004193984.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfobulbus propionicus DSM 2032]
 gi|320121147|gb|ADW16693.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfobulbus propionicus DSM 2032]
          Length = 185

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 62/156 (39%), Gaps = 19/156 (12%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI--- 96
             ++ I I+A+ +  ++      F G V   Q +  +++++MT+ Y+    +   +    
Sbjct: 31  DADQPISIEANRMVSQENQNTVVFLGKVDARQGNLIIRSEEMTVFYSEKPANKDGQPSTP 90

Query: 97  ----------NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                      ++  ++N+ I  G+            ++R +VL G+        +  N 
Sbjct: 91  GPGNQNTSQLEKLICKQNVKISEGDWLGTGDRMDYFAKERKVVLTGNAKA----WQGPNM 146

Query: 147 FLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDGR 180
             G  +   ++   + ++  E    +V+++I  + +
Sbjct: 147 VAGKTITYYLNEKRSVVEQDEKSKGRVKAVIHPESK 182


>gi|149912956|ref|ZP_01901490.1| hypothetical protein RAZWK3B_03170 [Roseobacter sp. AzwK-3b]
 gi|149813362|gb|EDM73188.1| hypothetical protein RAZWK3B_03170 [Roseobacter sp. AzwK-3b]
          Length = 167

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 69/169 (40%), Gaps = 13/169 (7%)

Query: 8   IHLYIHLLALVFV-LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
           I L   + +++   +     +Q+A       +      + + +++L V +    A F GN
Sbjct: 2   IRLSCLVFSVLLAGMPTVGHAQSAQVAFGDSQQDSTLPVEVVSEVLNVNENDGTAIFTGN 61

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           V + Q +  L A ++ + Y        + I  +     + + SGE    A     +    
Sbjct: 62  VIVGQGEMRLWAPRVEVIYKQDQ----SGIESLHATGGVTLVSGEDAAEAREADYNIDTG 117

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           ++ ++G    +V+L +   T    K++V+     A + G    +V++++
Sbjct: 118 MIEMDG----EVLLVQGPQTLTSDKMVVDTRAGTAQMTG----RVKTVL 158


>gi|262373036|ref|ZP_06066315.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter junii SH205]
 gi|262313061|gb|EEY94146.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter junii SH205]
          Length = 193

 Score = 98.1 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 59/166 (35%), Gaps = 7/166 (4%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           LA +  +    ++ ++ S         N+++ + AD     D      + GNV + Q   
Sbjct: 23  LAFLKHVACIAVAFSSVSAF-ALPSDRNQQLSLVADRATYNDKTGITTYTGNVVIEQGTM 81

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFI--QSGEINVIASNGYVDFQKRILVLNG 132
            LQAD +    N+     +        +    +    G     A     +    I+ L+G
Sbjct: 82  KLQADSIVATLNSKKEIQTITAKGQPAKFQQQMDVNKGLARGEAQTIIYNADTGIITLSG 141

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                  L +  ++  G  L  +++      QG  +++VQ II   
Sbjct: 142 KAY----LYQDGSSIRGNTLKYSMNKGDVEAQGSSTNRVQIIIPPS 183


>gi|310766225|gb|ADP11175.1| lipopolysaccharide transport periplasmic protein LptA [Erwinia sp.
           Ejp617]
          Length = 179

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 18/150 (12%), Positives = 51/150 (34%), Gaps = 6/150 (4%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +          N+ +++ ++   +      A F GNV +TQ    + ADK+ +     + 
Sbjct: 18  SVPAFALTGDSNKPVNVDSENQALDMQGNVATFTGNVVVTQGSIKITADKVVVTRPGGDS 77

Query: 91  DVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
             +  +    +     +      +   A   + +    ++ L G+      L++  +   
Sbjct: 78  KKTIVDAYGNLATFYQMQDNGKPVQGHAQKMHYELASDLVELTGNAY----LEQLDSNVK 133

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G ++   +        G    +V +++   
Sbjct: 134 GDRITYLVKEQKMQAFGNTGRRVTTVLVPS 163


>gi|262170533|ref|ZP_06038211.1| LptA protein [Vibrio mimicus MB-451]
 gi|261891609|gb|EEY37595.1| LptA protein [Vibrio mimicus MB-451]
          Length = 165

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 60/175 (34%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   HL +    L            A++          + ++I +D  ++     +  F 
Sbjct: 1   MKRSHLSLIACLL------------ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFL 48

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +       +     +  +   +   A   Y  
Sbjct: 49  GDVKLKQGSININADKLIVIRNADNGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYK 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   LV+     +K +L +  +   G K+   I +           +V ++++ 
Sbjct: 109 VRDDELVMI----NKAMLSQDDSEIRGSKIRYKISSQKLIADSDGKGRVSTVLQP 159


>gi|163733023|ref|ZP_02140467.1| hypothetical protein RLO149_10195 [Roseobacter litoralis Och 149]
 gi|161393558|gb|EDQ17883.1| hypothetical protein RLO149_10195 [Roseobacter litoralis Och 149]
          Length = 163

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 70/176 (39%), Gaps = 13/176 (7%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +     ++  L+LVF       +Q         +      + + AD L V      A F 
Sbjct: 1   MTFFKTFVFSLSLVFA-ATGLFAQGTQVAFGTVQENSGLPVEVTADSLAVDQNAGTALFT 59

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
            NV + Q +  L AD + + Y+ T    +  I+R++   N+ + SG+    +     +  
Sbjct: 60  DNVIVIQGEMRLSADNVLVIYDTT----AQAIDRIEATGNVVLISGQDAAESERADYNVD 115

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              +V++G     V++ +  +      + V I    A + G    +V+++++   +
Sbjct: 116 DGTIVMSG----SVLVAQGPSAISADTMTVQISDGTAQMSG----RVKTVLQTGDQ 163


>gi|54310341|ref|YP_131361.1| hypotetical protein yhbN precursor [Photobacterium profundum SS9]
 gi|46914782|emb|CAG21559.1| hypothetical protein yhbN precursor [Photobacterium profundum SS9]
          Length = 165

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 59/172 (34%), Gaps = 15/172 (8%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + LY     L   L     +               + I+I +D  E+        F GNV
Sbjct: 1   MKLYKISTLLFLCLSTPSWA---------LSNDTEQPIYIDSDNQELDIQKNIVTFTGNV 51

Query: 68  FMTQEDFSLQADKMTIDYNN--TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            + Q    ++ADK+ I   N    ++  +   +      I      I+  +     +   
Sbjct: 52  ILRQGSIDIRADKVVITRPNGQDGQETIDAYGKPATFHQIMDDGKPIDGASLKMRYETAI 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             L +     D+ IL ++ +   G  +   ID      +  ++ +V +I++ 
Sbjct: 112 DFLKMT----DEAILIQEGSEIQGNVITYKIDEQRLVAESGKTKRVTTILQP 159


>gi|312881876|ref|ZP_07741643.1| hypothetical protein VIBC2010_12664 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370455|gb|EFP97940.1| hypothetical protein VIBC2010_12664 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 165

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 64/169 (37%), Gaps = 14/169 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  L+L+FVL    L+               + +++ AD  ++     KA F GNV + Q
Sbjct: 3   LSHLSLLFVLFTPALAL-------ALDSDTEQPVYVDADSQQLDMQSNKATFIGNVKLKQ 55

Query: 72  EDFSLQADKMTIDYNNTNR--DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
              ++ ADK+ ++ +  +           +     +      +   A   Y       L 
Sbjct: 56  GSININADKVVVERDPKDSTIRRIEGYGNLATFSQLSEDGKTLYGEAKELYYVMVDDQLT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC-ESDQVQSIIRY 177
           +     D+ +L +  +   G K+  NI +      G  + D+V ++++ 
Sbjct: 116 MI----DQAMLSQDDSVIRGSKITYNISSQKLIADGKQQGDRVSTVLQP 160


>gi|163867321|ref|YP_001608515.1| hypothetical protein Btr_0016 [Bartonella tribocorum CIP 105476]
 gi|161016962|emb|CAK00520.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 215

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/188 (20%), Positives = 80/188 (42%), Gaps = 23/188 (12%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
              ++  +     L  A  +++        E + + AD LE++D    A FKG+V + Q 
Sbjct: 28  LAFSMGMLGGGTVLGYAEGTHLGISLSNDKEPVELHADSLEIRDKEGIALFKGDVSVMQG 87

Query: 73  DFSLQADKMTIDYNNTNRD----------------VSNKINRMDVERNIFIQSGEINVIA 116
           +  L+  K+ + Y+  +++                 S+ I +M+    ++I+        
Sbjct: 88  ERLLRTAKLVVYYDKAHKETDKNKEDTKASSVALLGSSGIKKMEAVGKVYIKIATQIATG 147

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG----CESDQVQ 172
             G  D + +++ L G     V+LK+  N   GCKL  N+++  A L+G     +  +V 
Sbjct: 148 DKGVFDGKSKMMSLTG---KHVVLKDGDNVATGCKLTANMESGKAFLEGCETTNKKGRVS 204

Query: 173 SIIRYDGR 180
            I + + +
Sbjct: 205 IIFKQNQK 212


>gi|297537427|ref|YP_003673196.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera sp. 301]
 gi|297256774|gb|ADI28619.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylotenera sp. 301]
          Length = 221

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 67/174 (38%), Gaps = 14/174 (8%)

Query: 17  LVFVLLKADLSQAAASYMT-RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           L+   +   L+    S          ++ I ++AD ++V DA Q + + GNV +TQ    
Sbjct: 12  LLMSYVFLSLAMLGYSSFALAEAADRDKPIDLEADSVKVDDAKQISTYSGNVILTQGTLI 71

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDR 134
           ++ADK+ +  ++     S  +      +     ++  +   A     D +   + L    
Sbjct: 72  IRADKLIVREDSAGFQHSTSLGNPTTFKQKREGKNEYMEGSAQRIEYDGRMDKVQL---- 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--------DQVQSIIRYDGR 180
             K  +K   +   G  +  + ++ +A + G            +V +II+   +
Sbjct: 128 YTKAWVKRGEDIVHGDYISYDANSEYAEVIGGTKSVDGVTTNGRVHAIIQPKNK 181


>gi|294787870|ref|ZP_06753114.1| lipopolysaccharide transport periplasmic protein LptA [Simonsiella
           muelleri ATCC 29453]
 gi|294484163|gb|EFG31846.1| lipopolysaccharide transport periplasmic protein LptA [Simonsiella
           muelleri ATCC 29453]
          Length = 177

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 62/183 (33%), Gaps = 22/183 (12%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +    +   ++A++F       +          +   N+ I I+AD   +    Q   F 
Sbjct: 1   MLKQRIKWIIVAILFSGSLNAYA---------LESDRNQPISIEADQGSLDQKNQVTVFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV + Q   + + + + +  ++    +                 G +    +    D  
Sbjct: 52  GNVVIKQGSLNFRGNAVRVAQDSKGNQLIQGEGNPVHFGQQLENKGYVEGSGNQVEYDSA 111

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL---------QGCESDQVQSII 175
             ++ L G+     ++K   +   G  +  N+ T   ++          G ++ +V  II
Sbjct: 112 TGLVKLFGNA----MVKRGGDVARGAAITYNMRTEVYTVMGSKMTGISSGTKNGRVSVII 167

Query: 176 RYD 178
           + +
Sbjct: 168 QPN 170


>gi|49473702|ref|YP_031744.1| hypothetical protein BQ00150 [Bartonella quintana str. Toulouse]
 gi|49239205|emb|CAF25522.1| hypothetical protein BQ00150 [Bartonella quintana str. Toulouse]
          Length = 192

 Score = 98.1 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/190 (21%), Positives = 77/190 (40%), Gaps = 23/190 (12%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            I  L +  +    D+  A  +      +   E + + AD LE++D    A F G+V + 
Sbjct: 3   MIFALNVGILGFGEDVGYAEVARFGVHLLNDKEPVELYADSLEIRDKEGIALFNGDVSVV 62

Query: 71  QEDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQSGEINV 114
           Q +  L+  K+ + Y+ T                 R  S  I +M+    ++I+      
Sbjct: 63  QGECLLRTAKLVVYYDKTQKVADRDRVDTKAESHARFGSTGIKKMEALGKVYIKIATQIA 122

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC----ESDQ 170
               G  D + +++ L G     V+L +  N   GCKL  ++++  A L+GC    +  +
Sbjct: 123 TGDKGVFDGESKMMSLTG---RNVVLTDGDNVATGCKLTADMESGKAFLEGCETFEKKGR 179

Query: 171 VQSIIRYDGR 180
           V  I +   +
Sbjct: 180 VSIIFKQSQK 189


>gi|238789759|ref|ZP_04633541.1| hypothetical protein yfred0001_29090 [Yersinia frederiksenii ATCC
           33641]
 gi|238722118|gb|EEQ13776.1| hypothetical protein yfred0001_29090 [Yersinia frederiksenii ATCC
           33641]
          Length = 165

 Score = 97.7 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 16/153 (10%), Positives = 49/153 (32%), Gaps = 6/153 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN- 86
            AA+          ++ + + +    +        F  NV + Q    ++ADK+ +    
Sbjct: 1   MAASLPALALTGDSDQPVLVDSVKQALDMTANTVTFTDNVVIKQGTIEIKADKVVVTRPG 60

Query: 87  -NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            + N+ V            +      +         +    +++L G+      L++  +
Sbjct: 61  GDQNKMVIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEVANDLVILTGNAY----LEQLDS 116

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              G ++   +          + ++V +++   
Sbjct: 117 NIKGDRITYLVKKQQMEAFSNKGNRVTTVLLPS 149


>gi|146305907|ref|YP_001186372.1| OstA family protein [Pseudomonas mendocina ymp]
 gi|145574108|gb|ABP83640.1| OstA family protein [Pseudomonas mendocina ymp]
          Length = 181

 Score = 97.7 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 59/182 (32%), Gaps = 17/182 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +++ L L+  L  A  S +A           N+ I I+AD  E+ D    A ++G+V 
Sbjct: 1   MRFVNTLPLILALGAALGSASAW----ALPSDRNQPIRIQADSAELDDKQGVAVYRGDVI 56

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI--QSGEINVIASNGYVDFQKR 126
           +TQ    +  D +TI    +                         +              
Sbjct: 57  ITQGTLKITGDTVTITQTASGDIDVFTSVGNLAYYEQKPAVDKEIVKAYGRTIQYFASNE 116

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS-------IIRYDG 179
            +VL         + ++ NTF G K++ +      +        V +       +I+   
Sbjct: 117 RIVLIDQAK----VIQEGNTFEGEKIVYDTRRQIVNAGRATGGNVSTPRPRIDMVIQPKN 172

Query: 180 RP 181
           +P
Sbjct: 173 KP 174


>gi|303252579|ref|ZP_07338742.1| hypothetical protein APP2_1557 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247331|ref|ZP_07529379.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648547|gb|EFL78740.1| hypothetical protein APP2_1557 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306856175|gb|EFM88330.1| Cell envelope bioproteinsis YhbN [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 167

 Score = 97.7 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 53/150 (35%), Gaps = 4/150 (2%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           + +      K   ++ I+I +    +        F  NV +TQ    + ADK+TI     
Sbjct: 15  STSLSSYALKGDTDQPINIDSGSQSLDMNSNVVTFSDNVVITQGSIKVTADKVTIIRQEG 74

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            ++           +        +N  +++ + D     L L G+      LK++ +   
Sbjct: 75  KKETLEASGSPVTFQQTLDNGKPVNGKSNSVHYDLNSEFLTLVGNAE----LKQQGSFIK 130

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             K+  ++             +V++I+  +
Sbjct: 131 ASKITYDVKKQQLKANSGNKSRVKTILIPN 160


>gi|300724970|ref|YP_003714295.1| putative ABC transporter periplasmic-binding protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631512|emb|CBJ92219.1| putative transport protein (ABC superfamily, peri_bind)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 182

 Score = 97.7 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 56/175 (32%), Gaps = 15/175 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N++     + + +F +    L+          K    + I I +    +      A F 
Sbjct: 1   MNNLIRNTVIASTLFAVSLPVLA---------LKDDTKKPITIDSARQSLDLTGNVATFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASNGYVD 122
            NV + Q    + ADK+ +   + +                 +      +   A+    +
Sbjct: 52  DNVTVKQGSIDIHADKVVVTRPDGDAKKTVIEAYGNPATFYQLQDDGKPLKGHAAKMRYE 111

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             K ++ L G+      L++  +   G K+   + T        +   V +++  
Sbjct: 112 MDKELVTLIGNAY----LEQLDSNIKGDKITYLVPTQQMEAFSDKGKHVTTVLLP 162


>gi|260549528|ref|ZP_05823746.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter sp. RUH2624]
 gi|260407321|gb|EEX00796.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter sp. RUH2624]
          Length = 182

 Score = 97.3 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 60/179 (33%), Gaps = 12/179 (6%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           S  L     ++   A++  +  +  S              N++I + AD     D     
Sbjct: 4   SLNLKRSSAFLKQAAVITFVALSSAS------TFALPSDRNQQISLVADRATYNDKTGLT 57

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINV--IASNG 119
            + GNV + Q    LQAD +  + N+              +    I + +          
Sbjct: 58  TYTGNVVIEQGTMKLQADSIVANLNSKREIQVITAKGRPAKFQQQINANKGVARGEGQTI 117

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +    I+ L+G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 118 VYNADTGIITLSGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|332978296|gb|EGK15024.1| OstA family protein [Psychrobacter sp. 1501(2011)]
          Length = 200

 Score = 97.3 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 53/163 (32%), Gaps = 6/163 (3%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           V +   A ++   + Y         + I + AD     +      + GNV +TQ    L 
Sbjct: 33  VALCATAVIASMTSFYANALPSDAQQPIRLLADKATYSERTGVTSYSGNVTITQGTLKLA 92

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNI--FIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           AD +T++ +      S                + G     A+    + Q  I+ L G+  
Sbjct: 93  ADNITVNLSEGRSINSAVATGRPATMQQVVTKEKGLARGQANKIDYNAQNGIVTLTGNAK 152

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
               L +   +F G  +  ++           S +V+ I    
Sbjct: 153 ----LTQNGASFAGNVIRYSLKVGDVEATSGGSQRVELIFPPS 191


>gi|261211087|ref|ZP_05925376.1| LptA protein [Vibrio sp. RC341]
 gi|260839588|gb|EEX66199.1| LptA protein [Vibrio sp. RC341]
          Length = 165

 Score = 97.3 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 61/175 (34%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   HL +    L            A++          + ++I +D  ++     +  F 
Sbjct: 1   MKRSHLSLIACLL------------ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFI 48

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +       +     +  +   +   A+  Y  
Sbjct: 49  GDVKLKQGSININADKLIVIRNATNGKIEEIEGYGDVATFSQLTDEGKTLYGEANELYYK 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   LV+     +K +L +  +   G K+   I +           +V ++++ 
Sbjct: 109 VRDDELVMI----NKAMLSQDDSEIRGRKIRYKISSQKLIADSEGKGRVSTVLQP 159


>gi|304392224|ref|ZP_07374166.1| OstA family protein [Ahrensia sp. R2A130]
 gi|303296453|gb|EFL90811.1| OstA family protein [Ahrensia sp. R2A130]
          Length = 174

 Score = 97.3 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 5/154 (3%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q + +    F+  G + I I+AD LEV D   KA F GNV + Q   ++   K+ + Y  
Sbjct: 22  QVSGAAFDGFRSNGKDPIQIEADSLEVLDEQNKAVFNGNVVVVQGKSTMTTSKLIVTYGA 81

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK-LNT 146
             +     + ++++   +   S E  V A  G        + L G    KV++ +   N 
Sbjct: 82  GGQGTQRDVQKLEMFEGLVATSEENTVTADKGIYITATEQITLTG----KVVVSQGADNV 137

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             GCKL+ N++ + A +  C   +         +
Sbjct: 138 ATGCKLVANLNNNQARMTACPKGRTTVTFTPGTQ 171


>gi|238796185|ref|ZP_04639695.1| OstA family protein [Yersinia mollaretii ATCC 43969]
 gi|238719878|gb|EEQ11684.1| OstA family protein [Yersinia mollaretii ATCC 43969]
          Length = 171

 Score = 97.3 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 14/148 (9%), Positives = 44/148 (29%), Gaps = 6/148 (4%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNR 90
                     + + + +    +        F  NV + Q    ++ADK+ +     + ++
Sbjct: 12  PAFALTGDTEQPVKVDSAKQALDMEANTITFTDNVIIKQGTIEIKADKVVVTRPGGDQSK 71

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
            V            +      +         +     +VL G+      L++  +   G 
Sbjct: 72  MVIEGYGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDSNIKGD 127

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           ++   +          + ++V +++   
Sbjct: 128 RITYLVKKQQMEAFSDKGNRVTTVLLPS 155


>gi|37527891|ref|NP_931236.1| hypothetical protein plu4039 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787327|emb|CAE16411.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 177

 Score = 97.3 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 58/177 (32%), Gaps = 16/177 (9%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
             N I     + + +FV+    ++          K    + I I +    +      A F
Sbjct: 1   MKNRIRN-AFIASAIFVVSLPAMA---------LKDDTQKPISIDSAKQALDMTGNTATF 50

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
             +V + Q    ++ADK+ +   + +  + V            +      I    +    
Sbjct: 51  TEDVIVKQGSIDIRADKVVVTRPDGDSKKMVIEAFGNPVTFYQLQDNGKPIKGRGAKMRY 110

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  K ++ L G+      L++  +   G ++   + T        +  +V +++   
Sbjct: 111 EMDKELVTLTGNAY----LEQLDSNIKGDRITYLVPTQQMEAFSDKGKRVTTVLLPS 163


>gi|222147329|ref|YP_002548286.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4]
 gi|221734319|gb|ACM35282.1| cell envelope biogenesis protein YhbN [Agrobacterium vitis S4]
          Length = 187

 Score = 97.3 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 7/156 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q+A S M   K+ G++ I I++D LEV     KA F GNV + Q   ++++  M + Y  
Sbjct: 33  QSATSNMNSLKLSGDKPIQIESDALEVHQQENKANFNGNVKVVQGTTTMRSGTMVVKYKG 92

Query: 88  T---NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                     KI+ +DV  N+ + +      A  G+ D   +I  L+GD   KV+L E  
Sbjct: 93  QGAAVTSGDAKIDTIDVADNVILNTETQQATADKGHFDMNTQIFTLDGD---KVVLSEGG 149

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           N F+GCKL V++ T  A L  C   +VQ  +    +
Sbjct: 150 NVFVGCKLTVHMTTGEAKLDSC-GKRVQIQLDPKSK 184


>gi|254436871|ref|ZP_05050365.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           307]
 gi|198252317|gb|EDY76631.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           307]
          Length = 161

 Score = 97.3 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 60/171 (35%), Gaps = 12/171 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + ++   L    ++            +       N  + I AD L +  A   A F GNV
Sbjct: 1   MTIFKTALFCAALICATTAFAQTDINLGAISADPNAPVEITADSLSIDQATGTAIFIGNV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
              Q D  L A ++ + Y++     S  I+R+     +   +      A     +     
Sbjct: 61  VFGQGDLRLNAARVQVIYSD----ASGDISRLSASGGVTFVTATEAAEALTADYNLDTGT 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L L GD    V+L +  +      + VN+    A + G    +V++I    
Sbjct: 117 LELAGD----VLLTQGASAISSDTMRVNLSDGSAQMYG----RVRTIFNQG 159


>gi|82701221|ref|YP_410787.1| OstA-like protein [Nitrosospira multiformis ATCC 25196]
 gi|82409286|gb|ABB73395.1| OstA-like protein [Nitrosospira multiformis ATCC 25196]
          Length = 190

 Score = 96.9 bits (239), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 65/185 (35%), Gaps = 13/185 (7%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +     +     +  + +        ++ +   +    + +H++AD   V+DA + A F 
Sbjct: 1   MTRNARFSFTAPMKPLSVAFLAVMLFSAPVRAERADSEKPVHLEADRATVQDANKLATFI 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDF 123
           GNV +TQ    ++ADKMT+  +      +     +   R       E     +     D 
Sbjct: 61  GNVVLTQGTLIIRADKMTVKEDANGFQYATAFGNLASFRQKRDGKDEYVEGWSERMEYDG 120

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--------DQVQSII 175
           +   + L      K  L+   +   G  +  +    F  + G            +V+++I
Sbjct: 121 KADKVQLF----KKARLRRGKDEVHGDYISYDAVNEFFQVNGEGGTSTQTHSEGRVRAVI 176

Query: 176 RYDGR 180
           +   +
Sbjct: 177 QPKKK 181


>gi|332289510|ref|YP_004420362.1| lipopolysaccharide transport periplasmic protein LptA
           [Gallibacterium anatis UMN179]
 gi|330432406|gb|AEC17465.1| lipopolysaccharide transport periplasmic protein LptA
           [Gallibacterium anatis UMN179]
          Length = 172

 Score = 96.9 bits (239), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 56/164 (34%), Gaps = 10/164 (6%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
              A L+   +           + I+I++D   +        F  NV +TQ    + ADK
Sbjct: 8   FAFALLALFVSYSANALTGDSEQPINIESDNQSLDLTNNVVTFNTNVVITQGSVKINADK 67

Query: 81  MTIDYNNTNRDVSNKINRMDV------ERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + I   N      NK   +D        +        +   A   + D  K  L L  + 
Sbjct: 68  VVITRPNEKEKADNKKETVDAYGKPVKFQQKLDNGKMVYGNADKVHYDLGKEFLTLIDNA 127

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK++ +   G  +  ++        G  + +V++I+  +
Sbjct: 128 Q----LKQEDSRINGDIITYDVKKQQLKANGNGNSRVKTILIPN 167


>gi|291326550|ref|ZP_06124966.2| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rettgeri DSM 1131]
 gi|291313518|gb|EFE53971.1| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rettgeri DSM 1131]
          Length = 195

 Score = 96.9 bits (239), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 22/158 (13%), Positives = 54/158 (34%), Gaps = 6/158 (3%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A    A +      K    + + I +    +        F  +V + Q    ++A+K+
Sbjct: 22  AVASAILALSLPAMALKSDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRANKV 81

Query: 82  TIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
            +    +++++ V            +      I   AS    +  K+++ L G+      
Sbjct: 82  VVTRPSSDSDKIVIEAFGTPVTFYQLQDDGKPIKGHASKARYEVDKQLVTLTGNAY---- 137

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           L++  +   G K+   + T        +  +V ++I  
Sbjct: 138 LEQLDSNIQGDKITYLVPTQQMEAFSDKGKRVTTVILP 175



 Score = 34.1 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 30/92 (32%), Gaps = 1/92 (1%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +        + +  G + I   A     +   Q     GN ++ Q D ++Q DK+T    
Sbjct: 97  AFGTPVTFYQLQDDG-KPIKGHASKARYEVDKQLVTLTGNAYLEQLDSNIQGDKITYLVP 155

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
               +  +   +      +  Q  E    A+ 
Sbjct: 156 TQQMEAFSDKGKRVTTVILPAQLQEKGPAANK 187


>gi|146278805|ref|YP_001168964.1| OstA family protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557046|gb|ABP71659.1| OstA family protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 168

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 62/153 (40%), Gaps = 12/153 (7%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A  ++        +  + I++D L+V  A   A F GNV + Q    L A  + ++Y   
Sbjct: 28  ANVAFGGGLTQDTSLPVEIESDELQVNQADGTAIFLGNVRVVQGPMRLAAQSVRVEYAPE 87

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                  I R+     + + +      A       +   +V+ GD    V+L +  NT  
Sbjct: 88  ----GGGIRRLHASGGVTLANEREAAEAQEAIYTIESGEVVMTGD----VLLTQGPNTLA 139

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           G +L++++      ++G    +VQ++ R    P
Sbjct: 140 GQRLVIDLTAGTGRMEG----RVQTVFRPGTSP 168


>gi|261855366|ref|YP_003262649.1| lipopolysaccharide transport periplasmic protein LptA
           [Halothiobacillus neapolitanus c2]
 gi|261835835|gb|ACX95602.1| lipopolysaccharide transport periplasmic protein LptA
           [Halothiobacillus neapolitanus c2]
          Length = 194

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 57/165 (34%), Gaps = 5/165 (3%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
              +L+   ++      +   K   N+ I + A+          + + GNV + Q     
Sbjct: 15  TSALLILGIIAGLMTPTVFAAKADRNQPIDVTANEKVTDYKQGTSIYTGNVVINQGSLHA 74

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
             DK T+         +    +    + +  +   +   A++     Q++ ++L G+   
Sbjct: 75  TGDKATLYVEKGELVRAVLEGKPATFQELDDKGQLVKGSANDANYLAQQQKIILTGNAK- 133

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-QVQSIIRYDGR 180
              L  + +T    ++  +++       G     +V  +I+   +
Sbjct: 134 ---LDRQGDTLSSQQITYDMNAEVVKAGGKTGGERVHVVIQPRSK 175


>gi|15602037|ref|NP_245109.1| hypothetical protein PM0172 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720391|gb|AAK02256.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 170

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 60/176 (34%), Gaps = 17/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + SI+  I +   +F       +          K    + I++ +D   +        F 
Sbjct: 1   MKSINN-IVIFTTLFATALPAFA---------LKSDTKQPINVVSDNQSLDMDNSVVTFT 50

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV +TQ    ++A K+ I     N+  +D      +             +   A+  + 
Sbjct: 51  DNVVITQGSILIKASKVIITRPPENSGKKDTIEAFGKPVTFYQKLDDGKPVEGHANQVHY 110

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D  +  L L G+      LK+  +      +  +++    +    +  +V++++  
Sbjct: 111 DLTQEFLTLTGNAE----LKQLDSKINSDVITYDVNKQQLNANSTQGSRVRTVLIP 162


>gi|226329335|ref|ZP_03804853.1| hypothetical protein PROPEN_03240 [Proteus penneri ATCC 35198]
 gi|225202521|gb|EEG84875.1| hypothetical protein PROPEN_03240 [Proteus penneri ATCC 35198]
          Length = 177

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 51/176 (28%), Gaps = 15/176 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N       ++  +  +    ++          K    + I + ++   +        F 
Sbjct: 1   MNQKIRNTLIIGTLLAISVPAMA---------LKDDTQQPIVVNSEKQSLDLEKNVTTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASNGYVD 122
            NV + Q    ++ADK+ +     +                 +      I         +
Sbjct: 52  QNVVIKQGSIDIRADKVVVTRPGGDSKKIVIEAFGNPVTFYQLQDDGKPIKGRGDKMTYE 111

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             K ++ L G       L++  +   G K+   + T        +  QV +++   
Sbjct: 112 MDKELMTLTGKAY----LEQLDSNITGDKITYLVPTQQMEAFSGKGKQVTTVLLPS 163


>gi|197287453|ref|YP_002153325.1| lipopolysaccharide transport periplasmic protein LptA [Proteus
           mirabilis HI4320]
 gi|227358285|ref|ZP_03842626.1| cell envelope biogenesis YhbN [Proteus mirabilis ATCC 29906]
 gi|194684940|emb|CAR47125.1| putative organic solvent tolerance protein [Proteus mirabilis
           HI4320]
 gi|227161621|gb|EEI46658.1| cell envelope biogenesis YhbN [Proteus mirabilis ATCC 29906]
          Length = 177

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 53/176 (30%), Gaps = 15/176 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N       +++ +F +    ++          K    + I + ++   +        F 
Sbjct: 1   MNRKIRNTLIISTLFSISVPVMA---------LKDDTQQPIVVNSEKQSLNLEKNITTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDV--SNKINRMDVERNIFIQSGEINVIASNGYVD 122
            NV + Q    ++ADK+ +     +                 +      I         +
Sbjct: 52  QNVVVKQGSIDIRADKVVVTRPGGDSKKIVIEAFGNPVTFYQLQDDGKPIKGRGDKMTYE 111

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             K ++ L G       L++  +   G K+   + T        +  QV +++   
Sbjct: 112 MDKELVTLTGKAY----LEQLDSNITGDKITYLVPTQQMEAFSGKGKQVTTVLLPS 163


>gi|152986998|ref|YP_001350369.1| hypothetical protein PSPA7_5033 [Pseudomonas aeruginosa PA7]
 gi|150962156|gb|ABR84181.1| cell envelope biogenesis protein YhbN [Pseudomonas aeruginosa PA7]
          Length = 175

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 58/181 (32%), Gaps = 17/181 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +++ L LVF L     +   +S          + I ++AD  E+ D    A ++G+V 
Sbjct: 1   MRFVNTLPLVFGLT----AVLGSSLAWALPSDREQPIRVQADSAELDDKQGVAVYRGDVV 56

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI--NVIASNGYVDFQKR 126
           +TQ    L  + +T+  +                        +               + 
Sbjct: 57  VTQGSTRLTGNTVTLKRDKNGDVEVVTSVGRPAYYEQKPAPDKDVTKAYGLTIQYFVTQN 116

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDG 179
            +VL         + ++ NTF G K++ +      +       QV         +I+   
Sbjct: 117 RVVLIDQAK----VIQEGNTFEGEKIVYDTQRQIVNAGRATGSQVTSPRPRIDMVIQPKK 172

Query: 180 R 180
           +
Sbjct: 173 K 173


>gi|90413001|ref|ZP_01220999.1| hypothetical protein yhbN precursor [Photobacterium profundum 3TCK]
 gi|90326016|gb|EAS42455.1| hypothetical protein yhbN precursor [Photobacterium profundum 3TCK]
          Length = 167

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 57/172 (33%), Gaps = 15/172 (8%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + LY     L   L     +               + I+I +D  E+        F GNV
Sbjct: 1   MKLYKISTLLFLCLSTPSWA---------LSNDTEQPIYIDSDNQELDIQKNIVTFTGNV 51

Query: 68  FMTQEDFSLQADKMTIDYNN--TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            + Q    ++ADK+ I   N    ++  +   +      I      I+  +     +   
Sbjct: 52  ILRQGSIDIRADKVVITRPNGQDGQETIDAYGKPATFHQIMDDGKPIDGASLKMRYETAI 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             L +     D+ IL ++ +   G  +   ID      +     +V +I++ 
Sbjct: 112 DFLKMT----DEAILIQEGSEIQGKVITYKIDEQRLVAESGNKKRVTTILQP 159


>gi|260770980|ref|ZP_05879909.1| LptA protein [Vibrio furnissii CIP 102972]
 gi|260614217|gb|EEX39407.1| LptA protein [Vibrio furnissii CIP 102972]
 gi|315179026|gb|ADT85940.1| hypothetical protein/organic solvent tolerance protein [Vibrio
           furnissii NCTC 11218]
          Length = 163

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/168 (13%), Positives = 57/168 (33%), Gaps = 13/168 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +  L+L+  LL +  +               + ++I +D  ++     +  F G+V + Q
Sbjct: 3   LSHLSLIACLLTSGSAL-------ALSSDTQQPVYIDSDSQQLDMKSSRVTFVGDVKLKQ 55

Query: 72  EDFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
              ++ ADK+ +  +      +       +     +      +   A   +       L 
Sbjct: 56  GSININADKLVVIRDAKTGKIETIEGYGNLTTFSQLTDDGKTLYGEAKELHYKMADDELT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           + G      +L +  +   G K+   I +         S +V ++++ 
Sbjct: 116 MIGQA----MLSQDDSEIRGSKIRYKISSQKLIADSNGSGRVSTVLQP 159


>gi|229527540|ref|ZP_04416932.1| LptA protein [Vibrio cholerae 12129(1)]
 gi|229335172|gb|EEO00657.1| LptA protein [Vibrio cholerae 12129(1)]
          Length = 179

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 59/175 (33%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   HL +    L            A++          + ++I +D  ++     +  F 
Sbjct: 16  MKRSHLSLIACLL------------ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFL 63

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +       +     +  +   +   A   Y  
Sbjct: 64  GDVKLKQGSININADKLIVIRNAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYK 123

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   LV+     +K +L +  +   G K+   I             +V ++++ 
Sbjct: 124 VRDDELVMI----NKAVLSQDDSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 174


>gi|167855015|ref|ZP_02477789.1| hypothetical protein HPS_10230 [Haemophilus parasuis 29755]
 gi|219870361|ref|YP_002474736.1| hypothetical protein HAPS_0084 [Haemophilus parasuis SH0165]
 gi|167853863|gb|EDS25103.1| hypothetical protein HPS_10230 [Haemophilus parasuis 29755]
 gi|219690565|gb|ACL31788.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 167

 Score = 96.9 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 63/174 (36%), Gaps = 14/174 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N     + ++AL  V             +   +   N  I I +    +        F 
Sbjct: 1   MNFRTKLVLIIALCLV----------NLSVKALETDRNMPIKIDSGSQSLDIERNIVTFS 50

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
            NV +TQ    L A+K+TI   +T +++        V +        +N  A++ + D  
Sbjct: 51  DNVVITQGSIKLNAEKVTIIRRDTQKELIEAFGTPVVFQQTLDNGKIVNGTANSVHYDLD 110

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              L+L G+      LK+  +     K+  ++          +  +V++++  +
Sbjct: 111 SEFLILRGNAE----LKQLDSAIKAEKITYDVKKQNLKATSNDRQRVKTVLIPN 160


>gi|114321377|ref|YP_743060.1| OstA family protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227771|gb|ABI57570.1| OstA family protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 175

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 54/149 (36%), Gaps = 10/149 (6%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                  +  I ++AD  E+ +    + + G V +TQ    +  D+M +   +       
Sbjct: 24  QARTPDRDRPIDLEADRAEIDNVRGISTYTGAVVLTQGSLVITGDRMVVHTRDVEGRRVL 83

Query: 95  KINRM---DVERNIFIQSGEINVIASNGYVDFQ---KRILVLNGDRADKVILKEKLNTFL 148
               +                 V A    +++     + L L+G       L ++ N   
Sbjct: 84  DRVEVAGGPATYEQLPPGQTDTVHAEAPRMEYHSRGPQRLHLSGGAE----LWQRENRMS 139

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           G ++ VN++T  A ++G E  + ++I   
Sbjct: 140 GDEIRVNLETQEAVVEGREDRRTRTIFYP 168


>gi|22124072|ref|NP_667495.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis KIM 10]
 gi|45443566|ref|NP_995105.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis biovar Microtus str. 91001]
 gi|165928124|ref|ZP_02223956.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|167420466|ref|ZP_02312219.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|21956820|gb|AAM83746.1|AE013615_7 hypothetical protein y0152 [Yersinia pestis KIM 10]
 gi|45438435|gb|AAS63982.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|165919898|gb|EDR37199.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|166961272|gb|EDR57293.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. MG05-1020]
          Length = 188

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 44/143 (30%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNK 95
                +   +K+D   +        F  NV + Q    ++ADK+ +     + ++ +   
Sbjct: 34  TGDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEG 93

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                    +      +         +     +VL GD      L++  +   G ++   
Sbjct: 94  FGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----LEQLDSNIKGDRITYL 149

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V +++   
Sbjct: 150 VKKQQMEAFSDKGKRVTTVLLPS 172


>gi|254480128|ref|ZP_05093376.1| lipopolysaccharide transport periplasmic protein LptA [marine gamma
           proteobacterium HTCC2148]
 gi|214039690|gb|EEB80349.1| lipopolysaccharide transport periplasmic protein LptA [marine gamma
           proteobacterium HTCC2148]
          Length = 175

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 65/166 (39%), Gaps = 17/166 (10%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L+ LVF+L  A ++              ++ I I+AD     +      ++G+V M Q  
Sbjct: 13  LIVLVFLLPGAAIA---------LPDDRDQPIRIEADEALRDEKQGFTRYEGHVRMDQGS 63

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDV-ERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
             ++AD++TI +++   D           ++   ++ G I   A+       +  + L  
Sbjct: 64  LHIEADQITIYHDDKEADRILATGSPARLQQQPELEKGPIKASANTIEYFKTEDRIQLRE 123

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE---SDQVQSII 175
           +      ++++ +   G  +   ++         +   S +V+ +I
Sbjct: 124 NAN----IEQEGSIVTGDSIDYLMNEQLVKAGSDKNSESSRVKVVI 165


>gi|254787687|ref|YP_003075116.1| lipopolysaccharide transport periplasmic protein LptA
           [Teredinibacter turnerae T7901]
 gi|237686059|gb|ACR13323.1| lipopolysaccharide transport periplasmic protein LptA
           [Teredinibacter turnerae T7901]
          Length = 194

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 57/180 (31%), Gaps = 13/180 (7%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +  +  +L     LL A +    A           + + I AD  E+ D      + 
Sbjct: 1   MKPLSTFCAVLP-GRSLLCAAMLACTAMPADALPDDRLQDLSISADSAELDDLNGTTTYA 59

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV-ERNIFIQSGEINVIASNGYVDF 123
           G+V + Q    ++A+K+ I                    +        +   A+      
Sbjct: 60  GSVIVEQGSMKIRAEKVVIYGRKDTYSRVVATGTPARLSQVPKPGQEPVTARANRMEYQI 119

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT------SFASLQGCESDQVQSIIRY 177
               L+L  + A +    ++  +  G ++  ++          A  +G    +V+ +I  
Sbjct: 120 TSETLILLDNAAFR----QEGTSLSGNRIEYDVKKAVVRAGGKADAEGD-DRRVRMVIPP 174


>gi|293608599|ref|ZP_06690902.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829172|gb|EFF87534.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325121587|gb|ADY81110.1| conserved hypothetical protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 182

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 59/179 (32%), Gaps = 12/179 (6%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           S  L     ++   A++  +  +  S              N++I + AD     +     
Sbjct: 4   SLNLKRSSAFLKQAAVITFVALSSAS------TFALPSDRNQQISLVADRATYNEKTGLT 57

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINV--IASNG 119
            + GNV + Q    LQAD +    N+     +        +    I + +          
Sbjct: 58  TYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGRPSKFQQQISADKGVARGEGQTI 117

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +    I+ L G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 118 VYNADTGIITLTGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|254851070|ref|ZP_05240420.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255744497|ref|ZP_05418449.1| LptA protein [Vibrio cholera CIRS 101]
 gi|262154679|ref|ZP_06028805.1| LptA protein [Vibrio cholerae INDRE 91/1]
 gi|262167555|ref|ZP_06035260.1| LptA protein [Vibrio cholerae RC27]
 gi|297581372|ref|ZP_06943295.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298500645|ref|ZP_07010449.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           cholerae MAK 757]
 gi|254846775|gb|EET25189.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255738022|gb|EET93415.1| LptA protein [Vibrio cholera CIRS 101]
 gi|262024008|gb|EEY42704.1| LptA protein [Vibrio cholerae RC27]
 gi|262030519|gb|EEY49157.1| LptA protein [Vibrio cholerae INDRE 91/1]
 gi|297534210|gb|EFH73048.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297540814|gb|EFH76871.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           cholerae MAK 757]
 gi|327485012|gb|AEA79419.1| LptA, protein essential for LPS transport across the periplasm
           [Vibrio cholerae LMA3894-4]
          Length = 164

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 59/175 (33%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   HL +    L            A++          + ++I +D  ++     +  F 
Sbjct: 1   MKRSHLSLIACLL------------ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFL 48

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +       +     +  +   +   A   Y  
Sbjct: 49  GDVKLKQGSININADKLIVIRNAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYK 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   LV+     +K +L +  +   G K+   I             +V ++++ 
Sbjct: 109 VRDDELVMI----NKAMLSQDDSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 159


>gi|83855389|ref|ZP_00948919.1| hypothetical protein NAS141_11676 [Sulfitobacter sp. NAS-14.1]
 gi|83843232|gb|EAP82399.1| hypothetical protein NAS141_11676 [Sulfitobacter sp. NAS-14.1]
          Length = 164

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 58/155 (37%), Gaps = 12/155 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q         +      + + AD L V      A F GNV + Q +  L A ++
Sbjct: 17  AMPIAAQGTNVAFGSIRQDTGLPVEVTADNLSVDQGDGSAVFTGNVLIGQGEMRLSAARV 76

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y          I R++    + + SG+    +     D     +V++G+    V+L 
Sbjct: 77  LVVYRADAE----GIARLEATGGVTLVSGKDAAESERADYDIDTGTIVMSGN----VLLT 128

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +  N      + V +    A + G    +V++I++
Sbjct: 129 QGRNALSSDTMSVKLSDGTAQMSG----RVKTILQ 159


>gi|170717854|ref|YP_001784912.1| cell envelope biogenesis YhbN [Haemophilus somnus 2336]
 gi|168825983|gb|ACA31354.1| Cell envelope biogenesis YhbN [Haemophilus somnus 2336]
          Length = 172

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 60/176 (34%), Gaps = 16/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S      L+  + +   + L+          K   N+ I I +D   +        F 
Sbjct: 1   MKSTTNKYLLITALMMTSISALA---------LKDDTNQPIDIVSDHQSLDMENSVVTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV + Q    ++A+K+ I      +  ++         +   +      +   A+  + 
Sbjct: 52  NNVVIKQGSILIKANKVVITRPTEKSNKKETVEAFGNPVLFNQLLDNGKPVQGKANKIHY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D     L L G+      LK+  +   G K+  ++        G  + +V++++  
Sbjct: 112 DLSAEFLTLMGNAE----LKQLDSKINGEKITYDVKKQQLKANGAGTSRVKTVLIP 163


>gi|126734478|ref|ZP_01750225.1| hypothetical protein RCCS2_09964 [Roseobacter sp. CCS2]
 gi|126717344|gb|EBA14208.1| hypothetical protein RCCS2_09964 [Roseobacter sp. CCS2]
          Length = 161

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +   I + A +FV             +    V  +  I + AD L V  A  KA F GNV
Sbjct: 1   MLRLIAICASLFVATAGAAYAQTNVNLGGITVDTSAAIEVTADSLSVDQASGKAIFDGNV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q D  L A ++ + Y       +++I R+   + +   + E    A     D    +
Sbjct: 61  IIGQGDLRLTAGRVEVIYGAD----TSQIARLIATKGVTFVTAEEAAEAQEADYDITTGL 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           L+L G     V+L +  +     ++ +N+    A++ G    +V+++++  G
Sbjct: 117 LILAG----GVLLTQGPSAISADQMTINVTDGTAAMDG----RVRTVLQQGG 160


>gi|83941913|ref|ZP_00954375.1| hypothetical protein EE36_06753 [Sulfitobacter sp. EE-36]
 gi|83847733|gb|EAP85608.1| hypothetical protein EE36_06753 [Sulfitobacter sp. EE-36]
          Length = 164

 Score = 96.5 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 58/155 (37%), Gaps = 12/155 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +Q         +      + + AD L V      A F GNV + Q +  L A ++
Sbjct: 17  AMPIAAQGTNVAFGSIRQDTGLPVEVTADNLSVDQGDGSAVFTGNVLIGQGEMRLSAARV 76

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + Y          I R++    + + SG+    +     D     +V++G+    V+L 
Sbjct: 77  LVVYRAEAE----GIARLEATGGVTLVSGKDAAESERADYDIDTGTIVMSGN----VLLT 128

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +  N      + V +    A + G    +V++I++
Sbjct: 129 QGRNALSSDTMSVKLSDGTAQMSG----RVKTILQ 159


>gi|325982708|ref|YP_004295110.1| lipopolysaccharide transport periplasmic protein LptA [Nitrosomonas
           sp. AL212]
 gi|325532227|gb|ADZ26948.1| lipopolysaccharide transport periplasmic protein LptA [Nitrosomonas
           sp. AL212]
          Length = 176

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/181 (17%), Positives = 65/181 (35%), Gaps = 23/181 (12%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQ-----KAFFKGNVFM 69
           L +VF      +S A        +    + IH++AD   ++D  +      + F GNV +
Sbjct: 4   LIIVFFWSVCSVSAA-----WAERADREKPIHLEADRATIEDVNRKEGTRISIFTGNVIL 58

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDFQKRIL 128
           TQ    + ADK+ +  ++     +     +   R    +  E     +     D +   +
Sbjct: 59  TQGTLRINADKVIMKEDSQGFRHATATGNLVSFRQKRDRMNEYVEGWSERAEYDSKTEKI 118

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRYDGR 180
            L      +  L    +  LG  +  N++  F  + G +          +V+  I+   +
Sbjct: 119 ELF----RQARLIRGEDEVLGDYISYNMNNEFFQVIGSKERGVETGPDKRVRITIQPKNK 174

Query: 181 P 181
           P
Sbjct: 175 P 175


>gi|110677769|ref|YP_680776.1| hypothetical protein RD1_0370 [Roseobacter denitrificans OCh 114]
 gi|109453885|gb|ABG30090.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 163

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 70/180 (38%), Gaps = 17/180 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M+ F N     + L   +       L+Q         +      + + AD L V      
Sbjct: 1   MTVFRN-----LILSLPLVFAATGLLAQGTQVAFGTIQDNSGLPVEVTADSLAVDQNAGT 55

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           A F  NV + Q +  L AD + + Y+ T    +  I+R++   N+ + SG+    +    
Sbjct: 56  ALFTDNVIVIQGEMRLSADNVLVVYDTT----AQAIDRIEATGNVVLISGQDAAESERAD 111

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +     +V++G     V++ +  +      + V I    A + G    +V+++++   +
Sbjct: 112 YNVDDGTIVMSG----SVLVAQGPSAISADTMTVQISDGTAQMSG----RVKTVLQTGDQ 163


>gi|226951452|ref|ZP_03821916.1| OstA-like protein [Acinetobacter sp. ATCC 27244]
 gi|294650975|ref|ZP_06728315.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate-binding protein [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226837800|gb|EEH70183.1| OstA-like protein [Acinetobacter sp. ATCC 27244]
 gi|292823076|gb|EFF81939.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate-binding protein [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 163

 Score = 96.5 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 53/157 (33%), Gaps = 6/157 (3%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
             +   +++         N+++ + AD     D      + GNV + Q    LQAD +  
Sbjct: 1   MAVIALSSATSFALPSDRNQQLTLVADRATYNDKTGVTTYTGNVVIEQGTMKLQADSIVA 60

Query: 84  DYNNTNRDVSNKINRMDVERNIFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
             N+     +        +    I    G     A     +    IL L G       L 
Sbjct: 61  TLNSKREIQTITAKGQLAKFQQQIDANRGLARGEAQQIVYNADTGILTLTGRAY----LY 116

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 117 QDGSSIRGESLKYSMNKGDVEAQGSSSNRVQIIIPPS 153


>gi|183597958|ref|ZP_02959451.1| hypothetical protein PROSTU_01307 [Providencia stuartii ATCC 25827]
 gi|188022730|gb|EDU60770.1| hypothetical protein PROSTU_01307 [Providencia stuartii ATCC 25827]
          Length = 182

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/159 (13%), Positives = 53/159 (33%), Gaps = 6/159 (3%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A    A +   +  K    + + I +    +        F  +V + Q    ++A+K+
Sbjct: 13  AVASAIFALSVPASALKTDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRANKV 72

Query: 82  TIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
            +    +N+++              +      I   AS    +  K +L L G+      
Sbjct: 73  VVTRPSSNSDKITIEAFGNPVTFYQLQDDGKPIKGRASKARYEVDKELLTLTGNAY---- 128

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L++  +   G K+   + T        +  +V +++   
Sbjct: 129 LEQLDSNIKGDKITYIVPTQQMEAFSDKGKRVTTVLLPS 167


>gi|329298199|ref|ZP_08255535.1| lipopolysaccharide transport periplasmic protein LptA [Plautia
           stali symbiont]
          Length = 172

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/161 (12%), Positives = 53/161 (32%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L      A +          N+ ++I +    +      A F GNV +TQ    + ADK
Sbjct: 1   MLLVSALLATSLPALALTGDSNKPVNIDSVKQALDLQGNVATFTGNVIVTQGTIKITADK 60

Query: 81  MTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           + +     +      +          +      +   A+  + +     + L G+     
Sbjct: 61  VVVTRPGGDSHKIIVDAYGNPATFYQMQDNGKPVQGHAAKLHYELANDFVELTGNAF--- 117

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRYD 178
            ++++ +   G ++   +           +S +V +++   
Sbjct: 118 -IEQQDSNIKGDRITYLVKEQKMQAYSQGQSKRVTTVLVPS 157


>gi|319898207|ref|YP_004158300.1| hypothetical protein BARCL_0016 [Bartonella clarridgeiae 73]
 gi|319402171|emb|CBI75697.1| conserved exported protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 215

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 81/195 (41%), Gaps = 23/195 (11%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
            S   ++ +L L   +L +    A  ++     + G E + I AD LE++D    A   G
Sbjct: 21  KSRKEWVSILVLSMAILGSVNGYARVTHFGIDGLNGKEPMEIHADSLEIRDKEGIAILNG 80

Query: 66  NVFMTQEDFSLQADKMTIDYNNTN----------------RDVSNKINRMDVERNIFIQS 109
           NV + Q +  L+  K+ I YN  +                +  S  I +++    ++I+ 
Sbjct: 81  NVSVMQSERLLRTSKLVIYYNKAHVTNDINQLITKSVFSGKIGSTDIKKVEASGEVYIKM 140

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG---- 165
               V       D Q  +++L G+    V+L +  N   GC L  N+ T  ASL+G    
Sbjct: 141 ATQTVTGDKAIFDGQSNMIILTGN---NVVLTDGDNVATGCTLTANMKTGKASLEGCKTS 197

Query: 166 CESDQVQSIIRYDGR 180
            + ++V  I+    +
Sbjct: 198 GKKNRVSIILESSSK 212


>gi|240139045|ref|YP_002963520.1| hypothetical protein MexAM1_META1p2464 [Methylobacterium extorquens
           AM1]
 gi|240009017|gb|ACS40243.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 242

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 59/158 (37%), Gaps = 27/158 (17%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD------------ 91
            I I AD L+V D   KA F GNV   Q + +++   MT+ Y                  
Sbjct: 46  PIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPSKDAAKSEAE 105

Query: 92  -----------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
                        N I +++    + +   +      N   D + + +VL G+    V+L
Sbjct: 106 AAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTGN----VVL 161

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +  N   G +L+ ++ +  A++      +V ++    
Sbjct: 162 SQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPG 199


>gi|84514853|ref|ZP_01002216.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
 gi|84511012|gb|EAQ07466.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
          Length = 153

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 67/162 (41%), Gaps = 12/162 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           ++  L  +  S      +    V  +  I + +D L V      A F+G+V + Q D  L
Sbjct: 1   MLLALAFSTASAQTQINLGALVVDPSAAIEVTSDALSVDQDTGIAVFEGDVLVIQGDLRL 60

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            A ++ + Y N     + +I R+       + + +    A     D    +L L GD   
Sbjct: 61  SAQRVEVVYGND----TAEIARLIASGGALLANTQDAAEADTADYDITTGLLTLTGD--- 113

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            V++ +  N      +IVN+    A++QG    +V+++++  
Sbjct: 114 -VLVTQGGNVISAQSMIVNVTDGTATMQG----RVRTMLQQS 150


>gi|315633785|ref|ZP_07889075.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Aggregatibacter segnis
           ATCC 33393]
 gi|315477827|gb|EFU68569.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, binding protein [Aggregatibacter segnis
           ATCC 33393]
          Length = 172

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 60/176 (34%), Gaps = 16/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  I   I L + +  +  + L+          K   N+ I+I +D   +    +   F 
Sbjct: 1   MKLISSKIVLASTLVFMSFSALA---------LKEDTNQPINIVSDNQSLDMNNRVVTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV +TQ    ++A K+ I     N+  +D             +      ++  A+    
Sbjct: 52  DNVVITQGSIIVKASKVVITRPEENSKQKDKVEAFGNPVTFHQVMDDGKPVDGKANKVVY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D     L L GD      LK+  +   G  +  ++             +V++++  
Sbjct: 112 DLGTEFLTLTGDAE----LKQLDSKINGSVITYDVAKQQLKANANSGARVKTVLIP 163


>gi|163757835|ref|ZP_02164924.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43]
 gi|162285337|gb|EDQ35619.1| hypothetical protein HPDFL43_20532 [Hoeflea phototrophica DFL-43]
          Length = 183

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 87/182 (47%), Gaps = 9/182 (4%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
              L  + L   L   V    +   +Q + S MT   + G+E I I++D+L++ +   +A
Sbjct: 3   KTSLPIVGLAALLGVAVLAGPQPVQAQTSESRMTGLALSGDEPIQIESDLLQINEETSQA 62

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNT---NRDVSNKINRMDVERNIFIQSGEINVIASN 118
            F GNV + Q D  LQA +M + Y          +  I  +D+ + + I+SG     A  
Sbjct: 63  TFTGNVRVLQGDTVLQAGEMIVHYAKNGGSVASGAADIREIDLFKKVLIRSGTQTATADT 122

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G  +    +LVL+G+   KV+L +  N F+GCKL V +    A L  C   +V  +I+ D
Sbjct: 123 GNFNMANEVLVLSGE---KVVLTDAENVFIGCKLTVQMQNGQAKLDSC-GRRV--MIQLD 176

Query: 179 GR 180
            +
Sbjct: 177 PK 178


>gi|51597816|ref|YP_072007.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809714|ref|YP_653630.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Antiqua]
 gi|108813622|ref|YP_649389.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Nepal516]
 gi|145597633|ref|YP_001161709.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Pestoides F]
 gi|153950762|ref|YP_001399436.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis IP 31758]
 gi|153997355|ref|ZP_02022455.1| hypothetical protein YPE_3802 [Yersinia pestis CA88-4125]
 gi|162419439|ref|YP_001605696.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis Angola]
 gi|165937461|ref|ZP_02226024.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011343|ref|ZP_02232241.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211892|ref|ZP_02237927.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167400620|ref|ZP_02306129.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167426750|ref|ZP_02318503.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470874|ref|ZP_02335578.1| hypothetical protein YpesF_24092 [Yersinia pestis FV-1]
 gi|186897008|ref|YP_001874120.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930592|ref|YP_002348467.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis CO92]
 gi|229836864|ref|ZP_04457029.1| Protein yhbN precursor [Yersinia pestis Pestoides A]
 gi|229839236|ref|ZP_04459395.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229899801|ref|ZP_04514942.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229904116|ref|ZP_04519227.1| Protein yhbN precursor [Yersinia pestis Nepal516]
 gi|270488551|ref|ZP_06205625.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis KIM D27]
 gi|294505298|ref|YP_003569360.1| hypothetical protein YPZ3_3189 [Yersinia pestis Z176003]
 gi|51591098|emb|CAH22762.1| Conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777270|gb|ABG19789.1| hypothetical protein YPN_3462 [Yersinia pestis Nepal516]
 gi|108781627|gb|ABG15685.1| hypothetical protein YPA_3723 [Yersinia pestis Antiqua]
 gi|115349203|emb|CAL22168.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209329|gb|ABP38736.1| hypothetical protein YPDSF_0317 [Yersinia pestis Pestoides F]
 gi|149288992|gb|EDM39072.1| hypothetical protein YPE_3802 [Yersinia pestis CA88-4125]
 gi|152962257|gb|ABS49718.1| cell envelope biogenesis protein YhbN [Yersinia pseudotuberculosis
           IP 31758]
 gi|162352254|gb|ABX86202.1| cell envelope biogenesis protein YhbN [Yersinia pestis Angola]
 gi|165914566|gb|EDR33180.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165989727|gb|EDR42028.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206638|gb|EDR51118.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167049988|gb|EDR61396.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054277|gb|EDR64098.1| cell envelope biogenesis protein YhbN [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186700034|gb|ACC90663.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678234|gb|EEO74339.1| Protein yhbN precursor [Yersinia pestis Nepal516]
 gi|229687293|gb|EEO79368.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229695602|gb|EEO85649.1| Protein yhbN precursor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229705807|gb|EEO91816.1| Protein yhbN precursor [Yersinia pestis Pestoides A]
 gi|262363361|gb|ACY60082.1| hypothetical protein YPD4_3178 [Yersinia pestis D106004]
 gi|262367261|gb|ACY63818.1| hypothetical protein YPD8_3148 [Yersinia pestis D182038]
 gi|270337055|gb|EFA47832.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pestis KIM D27]
 gi|294355757|gb|ADE66098.1| hypothetical protein YPZ3_3189 [Yersinia pestis Z176003]
 gi|320017122|gb|ADW00694.1| Protein yhbN precursor [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 181

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 44/143 (30%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNK 95
                +   +K+D   +        F  NV + Q    ++ADK+ +     + ++ +   
Sbjct: 27  TGDTEQPAEVKSDKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEG 86

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                    +      +         +     +VL GD      L++  +   G ++   
Sbjct: 87  FGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----LEQLDSNIKGDRITYL 142

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V +++   
Sbjct: 143 VKKQQMEAFSDKGKRVTTVLLPS 165


>gi|15642522|ref|NP_232155.1| hypothetical protein VC2527 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121727448|ref|ZP_01680576.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147675161|ref|YP_001218023.1| hypothetical protein VC0395_A2107 [Vibrio cholerae O395]
 gi|153217460|ref|ZP_01951190.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153801092|ref|ZP_01955678.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153817998|ref|ZP_01970665.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153822433|ref|ZP_01975100.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153825783|ref|ZP_01978450.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153829789|ref|ZP_01982456.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227082645|ref|YP_002811196.1| hypothetical protein VCM66_2448 [Vibrio cholerae M66-2]
 gi|229507417|ref|ZP_04396922.1| LptA protein [Vibrio cholerae BX 330286]
 gi|229509658|ref|ZP_04399139.1| LptA protein [Vibrio cholerae B33]
 gi|229513451|ref|ZP_04402915.1| LptA protein [Vibrio cholerae TMA 21]
 gi|229516783|ref|ZP_04406229.1| LptA protein [Vibrio cholerae RC9]
 gi|229521592|ref|ZP_04411010.1| LptA protein [Vibrio cholerae TM 11079-80]
 gi|229524509|ref|ZP_04413914.1| LptA protein [Vibrio cholerae bv. albensis VL426]
 gi|229606924|ref|YP_002877572.1| LptA protein [Vibrio cholerae MJ-1236]
 gi|254225920|ref|ZP_04919522.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254291443|ref|ZP_04962235.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|9657110|gb|AAF95668.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121630220|gb|EAX62620.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124113549|gb|EAY32369.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124123325|gb|EAY42068.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|125621546|gb|EAZ49878.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126511433|gb|EAZ74027.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126520076|gb|EAZ77299.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146317044|gb|ABQ21583.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148874707|gb|EDL72842.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149740506|gb|EDM54621.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150422633|gb|EDN14588.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227010533|gb|ACP06745.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014416|gb|ACP10626.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229338090|gb|EEO03107.1| LptA protein [Vibrio cholerae bv. albensis VL426]
 gi|229341186|gb|EEO06190.1| LptA protein [Vibrio cholerae TM 11079-80]
 gi|229345846|gb|EEO10818.1| LptA protein [Vibrio cholerae RC9]
 gi|229349328|gb|EEO14284.1| LptA protein [Vibrio cholerae TMA 21]
 gi|229353132|gb|EEO18071.1| LptA protein [Vibrio cholerae B33]
 gi|229354922|gb|EEO19843.1| LptA protein [Vibrio cholerae BX 330286]
 gi|229369579|gb|ACQ60002.1| LptA protein [Vibrio cholerae MJ-1236]
          Length = 179

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 59/175 (33%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   HL +    L            A++          + ++I +D  ++     +  F 
Sbjct: 16  MKRSHLSLIACLL------------ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFL 63

Query: 65  GNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  N  N   +       +     +  +   +   A   Y  
Sbjct: 64  GDVKLKQGSININADKLIVIRNAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYK 123

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +   LV+     +K +L +  +   G K+   I             +V ++++ 
Sbjct: 124 VRDDELVMI----NKAMLSQDDSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 174


>gi|74316553|ref|YP_314293.1| OstA-like family protein [Thiobacillus denitrificans ATCC 25259]
 gi|74056048|gb|AAZ96488.1| OstA-like family protein [Thiobacillus denitrificans ATCC 25259]
          Length = 177

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 62/149 (41%), Gaps = 10/149 (6%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I+++AD + + D  + + ++GNV +TQ   +L+AD+M +  N    D  +   
Sbjct: 25  TADRDKPINLEADTVTLDDIKKVSVYQGNVILTQGTLTLRADRMQLTQNAAGLDKVSATG 84

Query: 98  RMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
           R    R       E     A+    D     L L GD      L+   +   G ++  N 
Sbjct: 85  RPVAFRQKVDGRDEFIEGFAARIEFDNTTSELDLIGDAR----LRRGEDELRGARISYNS 140

Query: 157 DTSFASL-----QGCESDQVQSIIRYDGR 180
           D+ F  +      G    +V+++IR   R
Sbjct: 141 DSGFYKVVGQNGAGSPGGRVRAVIRPKPR 169


>gi|90421941|ref|YP_530311.1| OstA-like protein [Rhodopseudomonas palustris BisB18]
 gi|90103955|gb|ABD85992.1| OstA-like protein [Rhodopseudomonas palustris BisB18]
          Length = 225

 Score = 96.1 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 70/175 (40%), Gaps = 31/175 (17%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            + M  F    ++ I I+A  LEV+D  ++A F G+V + Q D ++ +  + + Y+    
Sbjct: 39  PNAMQGFSQNRDKPIQIEAATLEVRDKKKEATFTGDVKVVQGDTTMTSRILVVFYDQEQP 98

Query: 91  D--------------------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
                                        + I R++ + N+ +   +  V       D +
Sbjct: 99  ASAEPTPGRSAKAAAKPQMTAAAPGPGGGSSIRRLEAKGNVVVTQKDQVVTGDTAVFDTK 158

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             ++ + G     V+L +  N   G +L+V++ T  + ++   S +VQ + +   
Sbjct: 159 TNLVTMLG----GVVLTQGKNVVRGDRLLVDMTTGVSRVESG-SGRVQGLFQSSP 208


>gi|188581679|ref|YP_001925124.1| OstA family protein [Methylobacterium populi BJ001]
 gi|179345177|gb|ACB80589.1| OstA family protein [Methylobacterium populi BJ001]
          Length = 250

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 61/174 (35%), Gaps = 31/174 (17%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR- 90
           S        G   I I AD L+V D   KA F GNV   Q + +++   MT+ Y      
Sbjct: 42  SAPLGTVGGGKGPIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDK 101

Query: 91  --------------------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
                                        + I +++    + +   +      N   D +
Sbjct: 102 DPGKDAAKGDPKTDAQAAEDAKAKAAMGGSGIRKVECAGPVTVAQKDQIATGDNAVFDQE 161

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + +VL G+    V+L +  N   G +L+ ++ T  A++      +V ++    
Sbjct: 162 AKRIVLTGN----VVLSQCQNVTRGSRLVYDMATGRANMDPVAGGRVSAMFVPG 211


>gi|148826239|ref|YP_001290992.1| hypothetical protein CGSHiEE_06300 [Haemophilus influenzae PittEE]
 gi|148716399|gb|ABQ98609.1| hypothetical protein CGSHiEE_06300 [Haemophilus influenzae PittEE]
          Length = 172

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKADVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    ++  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGNVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|311695331|gb|ADP98204.1| OstA family protein [marine bacterium HP15]
          Length = 188

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 58/163 (35%), Gaps = 10/163 (6%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL A L+ A A  +  F +  +  I + AD   + D    A + G+V + Q +  L A++
Sbjct: 11  LLAALLTVAMAGPVAAFDLDSDIPIKVTADNARLDDGQGIATYTGDVELEQGNTRLNAER 70

Query: 81  MTIDYNNTNRDVSNKINRMDVERNI-FIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
           + +                   R       GE +  A N         L        + +
Sbjct: 71  VVLYRTEDGLSRIEASGTPARYRQPAREGEGETDARALNITWSATDSQLTFE----REAV 126

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQ-----GCESDQVQSIIRY 177
           +++  N F G  +  +      + +     G  + +V+ +I+ 
Sbjct: 127 IEQNGNLFRGDVIHYDTAGRVVTAEGGAETGDGTGRVEMVIQP 169


>gi|332974674|gb|EGK11591.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Kingella kingae ATCC
           23330]
          Length = 171

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/170 (15%), Positives = 55/170 (32%), Gaps = 11/170 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +   + A +   ++ ++        + I I+AD   +    Q   F GNV +TQ    ++
Sbjct: 5   LKTAVLAAILATSSLHVHALDSDRKQPIAIEADQGSLDQKNQVTVFSGNVLVTQGSLHMK 64

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNI-FIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
           A    +  +                R       G      S    D  + ++ L G+   
Sbjct: 65  AQNARVSQDKNGNQTMVATGNPVYFRQQLEGNKGIAEGWGSRAEYDSARNLVKLIGNAK- 123

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGC------ESDQVQSIIRYDGR 180
              ++   +   G  +  N  T   ++ G       +  +V  II+   +
Sbjct: 124 ---VQRGGDMAQGEAISYNTQTEIYTVLGGNAVGNKKGRRVTVIIQPSQK 170


>gi|170022758|ref|YP_001719263.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis YPIII]
 gi|169749292|gb|ACA66810.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           pseudotuberculosis YPIII]
          Length = 181

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 44/143 (30%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNK 95
                +   +K+D   +        F  NV + Q    ++ADK+ +     + ++ +   
Sbjct: 27  TGDTEQPAEVKSDKQTLDMETNTITFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEG 86

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                    +      +         +     +VL GD      L++  +   G ++   
Sbjct: 87  FGNPVTFYQMQDSGKPVKGHGQKLRYEIANDFVVLTGDAY----LEQLDSNIKGDRITYL 142

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V +++   
Sbjct: 143 VKKQQMEAFSDKGKRVTTVLLPS 165


>gi|78222495|ref|YP_384242.1| OstA-like protein [Geobacter metallireducens GS-15]
 gi|78193750|gb|ABB31517.1| OstA-like protein [Geobacter metallireducens GS-15]
          Length = 169

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 61/152 (40%), Gaps = 8/152 (5%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
            A S          + I IK++ L        A F G V   Q D ++ ADK+ + Y   
Sbjct: 18  TAHSAQLPKGGRQGQPITIKSNELSTDSRHNTATFTGKVIARQGDLTIYADKLVVHYKAD 77

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                  ++R++   N+ I  G+    A +G     ++ +VL GD      + +  NT  
Sbjct: 78  ----GGDLDRVEASGNVRIVQGDRLATARDGVYQSAEQKIVLTGDPK----VFQGENTVS 129

Query: 149 GCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           G  +   +D   + + G    +V+++I    +
Sbjct: 130 GKVITYFVDEEKSIVTGGPDTRVEAVITPKEK 161


>gi|114332261|ref|YP_748483.1| OstA family protein [Nitrosomonas eutropha C91]
 gi|114309275|gb|ABI60518.1| OstA family protein [Nitrosomonas eutropha C91]
          Length = 183

 Score = 95.8 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 66/183 (36%), Gaps = 27/183 (14%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-----AVQKAFFKGN 66
           + L   +       L++         +   ++ IH++AD   V+D       + + F GN
Sbjct: 6   LFLSLSLMFFSATALAE---------RADRDKPIHLEADRATVEDYKQKGEFRTSIFTGN 56

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDFQK 125
           V +TQ    L+ADK+ +  ++T    +     +   R       E     +     D + 
Sbjct: 57  VILTQGTLILRADKVVMKEDSTGYRHATAYGNLVSYRQKRDGVDEYVEAWSRRAEYDNKT 116

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG--------CESDQVQSIIRY 177
             + L G       LK   +   G  +  +I + F  + G            +V+++I+ 
Sbjct: 117 DKIELFGSAR----LKRGTDEVEGDYISYDIASDFFQVFGQPQAENDKNSDHRVRAVIQP 172

Query: 178 DGR 180
             +
Sbjct: 173 KAK 175


>gi|30248095|ref|NP_840165.1| putative signal peptide protein [Nitrosomonas europaea ATCC 19718]
 gi|30179980|emb|CAD83975.1| putative signal peptide protein [Nitrosomonas europaea ATCC 19718]
          Length = 205

 Score = 95.8 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 64/189 (33%), Gaps = 27/189 (14%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-----AVQK 60
           N       L   +       L++         +   ++ IH++AD   V+D       + 
Sbjct: 22  NRAIFSSFLSLFLIFFSSIVLAE---------RADRDKPIHLEADHATVEDYKRKGEFRT 72

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNG 119
           + F GNV +TQ    L+ADK+ +  +      +     +   R       E     +   
Sbjct: 73  SIFTGNVVLTQGTLVLRADKVIMKEDAAGYRYATAYGDLVSYRQKRDGVNEYVEAWSKRA 132

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG--------CESDQV 171
             D +   + L G       LK   +   G  +  +I + F  + G            +V
Sbjct: 133 EYDDKTDKIELFGSAR----LKRGADEVEGDYISYDIASDFFQVSGRQQSENDKNSDHRV 188

Query: 172 QSIIRYDGR 180
           +++I+   +
Sbjct: 189 RAVIQPKAK 197


>gi|291615980|ref|YP_003518722.1| YhbN [Pantoea ananatis LMG 20103]
 gi|291151010|gb|ADD75594.1| YhbN [Pantoea ananatis LMG 20103]
 gi|327396232|dbj|BAK13654.1| protein YhbN precursor [Pantoea ananatis AJ13355]
          Length = 184

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/187 (13%), Positives = 63/187 (33%), Gaps = 19/187 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N   +   L         A +  AA+          ++ ++I ++   +      
Sbjct: 1   MKFKMNKNRIKFLL---------ASMLLAASLPALALTGDSDKPVNIDSENQSLDLQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASN 118
           A F GNV +TQ    + ADK+ +     +   +  +          +      +   AS 
Sbjct: 52  ATFTGNVIVTQGSIKITADKVVVTRPGGDSKKTIVDAYGNPATFYQMQDNGKPVQGHASK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSII-- 175
            + +     + L G+      +++  +   G ++   +           +S +V +++  
Sbjct: 112 LHYELANDFVELTGNAY----IEQLDSNIKGDRITYLVKEQKMQAYSQGQSKRVTTVLVP 167

Query: 176 -RYDGRP 181
            +   +P
Sbjct: 168 SQLQDKP 174


>gi|163851922|ref|YP_001639965.1| OstA family protein [Methylobacterium extorquens PA1]
 gi|163663527|gb|ABY30894.1| OstA family protein [Methylobacterium extorquens PA1]
          Length = 242

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 59/158 (37%), Gaps = 27/158 (17%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD------------ 91
            I I AD L+V D   KA F GNV   Q + +++   MT+ Y                  
Sbjct: 46  PIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPAKDAAKSEAE 105

Query: 92  -----------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
                        N I +++    + +   +      N   D + + +VL G+    V+L
Sbjct: 106 AAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTGN----VVL 161

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +  N   G +L+ ++ +  A++      +V ++    
Sbjct: 162 SQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPG 199


>gi|170728563|ref|YP_001762589.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           woodyi ATCC 51908]
 gi|169813910|gb|ACA88494.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           woodyi ATCC 51908]
          Length = 196

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/167 (16%), Positives = 62/167 (37%), Gaps = 14/167 (8%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            + AL+ ++  + +++              +++ I A   E      +  F G V + Q 
Sbjct: 7   IITALLCLISFSSVAKV---------DDLKQEVKISAASQEADIKNNQIIFNGPVEVVQG 57

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLN 131
              + ADK+       +              +  ++ G   N  A     +  KR L+L 
Sbjct: 58  SVKINADKLRAFTKEGSNGRILVATGNPATYSQIMEDGRPANASAKEIRYELSKRTLILK 117

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           G+      L++  +   G ++  NI+      +   S++V +II+ +
Sbjct: 118 GNA----TLEQDGSQVTGNQIQYNIEKQQLIAESTGSERVITIIQPE 160


>gi|269137857|ref|YP_003294557.1| putative lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Edwardsiella tarda
           EIB202]
 gi|267983517|gb|ACY83346.1| putative lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Edwardsiella tarda
           EIB202]
 gi|304557910|gb|ADM40574.1| LptA [Edwardsiella tarda FL6-60]
          Length = 185

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/144 (13%), Positives = 46/144 (31%), Gaps = 6/144 (4%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--SN 94
                ++ IHI +    +      A F G+V +TQ    + ADK+ +   N  +      
Sbjct: 29  VTGDTDQPIHINSMQQSLDMQGNVATFTGDVIVTQGTIKITADKVVVTRPNGQQGSEIVE 88

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      +   +     +  K  ++L G       LK+  +   G ++  
Sbjct: 89  AYGNPVTFYQMQDNGKPVEGHSQQLRYELAKDYVILTGKAF----LKQLDSNIEGDRITY 144

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            +          +  +V +++   
Sbjct: 145 LVKQQQMEAFSDKGKRVTTVLLPS 168


>gi|169633848|ref|YP_001707584.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii SDF]
 gi|169796519|ref|YP_001714312.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AYE]
 gi|260557955|ref|ZP_05830167.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii ATCC 19606]
 gi|169149446|emb|CAM87332.1| putative lipopolysaccharide transport protein A (ABC superfamily,
           peri_bind) (LptA) [Acinetobacter baumannii AYE]
 gi|169152640|emb|CAP01635.2| putative lipopolysaccharide transport protein A (ABC superfamily,
           peri_bind) (LptA) [Acinetobacter baumannii]
 gi|260408465|gb|EEX01771.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii ATCC 19606]
          Length = 194

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 60/179 (33%), Gaps = 12/179 (6%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           S  L     ++   A++  +  +  S              N++I + AD     +     
Sbjct: 16  SLNLKRSSAFLKQAAVITFVALSSAS------TFALPSDRNQQISLVADRATYNEKTGLT 69

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINV--IASNG 119
            + GNV + Q    LQAD +    N+     +        +    I + +          
Sbjct: 70  TYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGRPSKFQQQISADKGIARGEGQTI 129

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +    I+ L+G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 130 VYNADTGIITLSGGAY----LYQDGSSIRGNTLKYSMNKGDVEAQGSSSNRVQIIIPPS 184


>gi|145639331|ref|ZP_01794937.1| hypothetical protein CGSHiII_01234 [Haemophilus influenzae PittII]
 gi|145271634|gb|EDK11545.1| hypothetical protein CGSHiII_01234 [Haemophilus influenzae PittII]
 gi|309751205|gb|ADO81189.1| Lipooligosaccharide transporter, periplasmic binding protein LptA
           [Haemophilus influenzae R2866]
          Length = 172

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 53/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    +   A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGKPVEGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|184157548|ref|YP_001845887.1| hypothetical protein ACICU_01228 [Acinetobacter baumannii ACICU]
 gi|213156368|ref|YP_002318788.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB0057]
 gi|215483982|ref|YP_002326207.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB307-0294]
 gi|239503718|ref|ZP_04663028.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB900]
 gi|301346196|ref|ZP_07226937.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB056]
 gi|301510175|ref|ZP_07235412.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB058]
 gi|301594401|ref|ZP_07239409.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii AB059]
 gi|332853949|ref|ZP_08435069.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013150]
 gi|332870205|ref|ZP_08439100.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013113]
 gi|332874282|ref|ZP_08442201.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6014059]
 gi|183209142|gb|ACC56540.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|193076934|gb|ABO11667.2| putative transport protein [Acinetobacter baumannii ATCC 17978]
 gi|213055528|gb|ACJ40430.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB0057]
 gi|213988138|gb|ACJ58437.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii AB307-0294]
 gi|322507862|gb|ADX03316.1| Putative lipopolysaccharide transport protein A [Acinetobacter
           baumannii 1656-2]
 gi|323517459|gb|ADX91840.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter baumannii TCDC-AB0715]
 gi|332728305|gb|EGJ59686.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013150]
 gi|332732372|gb|EGJ63629.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6013113]
 gi|332737507|gb|EGJ68415.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter baumannii 6014059]
          Length = 182

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 60/179 (33%), Gaps = 12/179 (6%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           S  L     ++   A++  +  +  S              N++I + AD     +     
Sbjct: 4   SLNLKRSSAFLKQAAVITFVALSSAS------TFALPSDRNQQISLVADRATYNEKTGLT 57

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINV--IASNG 119
            + GNV + Q    LQAD +    N+     +        +    I + +          
Sbjct: 58  TYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGRPSKFQQQISADKGIARGEGQTI 117

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +    I+ L+G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 118 VYNADTGIITLSGGAY----LYQDGSSIRGNTLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|225075757|ref|ZP_03718956.1| hypothetical protein NEIFLAOT_00773 [Neisseria flavescens
           NRL30031/H210]
 gi|224952923|gb|EEG34132.1| hypothetical protein NEIFLAOT_00773 [Neisseria flavescens
           NRL30031/H210]
          Length = 176

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 60/168 (35%), Gaps = 14/168 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A ++  AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +
Sbjct: 8   TLALVAVFAASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSV 67

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           T+  N+ +  +                  G +N  A+         ++ L G+      +
Sbjct: 68  TVSRNDKSEQLMKATGSPVKFSQELDGGKGVVNGQANTVTYSSAAGLVTLTGNAK----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGC---------ESDQVQSIIRYDG 179
           +   +   G  +  N  T   ++ G          +S +V  +I+  G
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTINGSAKSGVKSATKSGRVSVVIQPSG 171


>gi|78485318|ref|YP_391243.1| OstA-like protein [Thiomicrospira crunogena XCL-2]
 gi|78363604|gb|ABB41569.1| OstA-like protein; ABC transporter solute binding subunit homolog
           [Thiomicrospira crunogena XCL-2]
          Length = 180

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 68/169 (40%), Gaps = 8/169 (4%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +L+  F LL   +S    S  T      +  I IKAD L  +D   ++ + G V +TQ  
Sbjct: 5   ILSTSFFLLLTAISVQTNSAETN--ANESLPIEIKADSLVSQDQKGQSVYSGRVIITQGT 62

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNG 132
             +  DK+TI + N     +  I +    +    +        A       ++R ++L G
Sbjct: 63  TVIHGDKVTIFHPNRKVIKAIVIGQPATFKRFLPEEKNWIDGRADTITYHAERRTVLLEG 122

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDG 179
                 + +E  N+  G +++ N++    S +G +    ++  I   + 
Sbjct: 123 HAF---VNQEGKNSISGPEILYNLNDKTLSAKGNKTEKKRITVIFEPEK 168


>gi|261344901|ref|ZP_05972545.1| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rustigianii DSM 4541]
 gi|282567041|gb|EFB72576.1| lipopolysaccharide transport periplasmic protein LptA [Providencia
           rustigianii DSM 4541]
          Length = 185

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/158 (13%), Positives = 54/158 (34%), Gaps = 6/158 (3%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A    A +      K    + + I +    +        F  +V + Q    ++A+K+
Sbjct: 13  AIASAMLALSLPAMALKTDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRANKV 72

Query: 82  TIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
            +    +++++ V            +      I   AS    +  ++++ L GD      
Sbjct: 73  VVTRPSSDSDKIVIEAFGTPVTFFQLQDDGKPIKGHASKARYEVDQQLVTLTGDAY---- 128

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           L++  +   G K+   + T        +  +V +++  
Sbjct: 129 LEQLDSNIKGDKITYVVPTQKMEAFSDKGKRVTTVLLP 166


>gi|71065485|ref|YP_264212.1| OstA-like protein [Psychrobacter arcticus 273-4]
 gi|71038470|gb|AAZ18778.1| possible OstA-like protein [Psychrobacter arcticus 273-4]
          Length = 189

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 51/160 (31%), Gaps = 6/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
            L   +  A   Y        N+ I + AD     +      + G V +TQ  F + AD 
Sbjct: 25  ALPVVMLLALPLYSHALPSDANQPIKLLADKATYSERTGVTSYSGTVVITQGTFKMTADN 84

Query: 81  MTIDYNNTNRDVSNKINRMDVERNI--FIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           +T++ +      S                + G     A+    +    I+ L G+     
Sbjct: 85  ITVNLSQGRSITSAVATGRPATMQQVVTQEKGLAKGQANKIDYNAVTGIVTLTGNAK--- 141

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L +   +F G  +  ++           + +V+ +   +
Sbjct: 142 -LVQNGASFAGNVIRYSLKAGDVEATAGGNQRVELVFPPN 180


>gi|49081664|gb|AAT50232.1| PA4460 [synthetic construct]
          Length = 176

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 58/181 (32%), Gaps = 17/181 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +++ L L+F L     +   +S          + I ++AD  E+ D    A ++G+V 
Sbjct: 1   MRFVNTLPLIFGLT----AALGSSMALALPSDREQPIRVQADSAELDDKQGVAVYRGDVV 56

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI--NVIASNGYVDFQKR 126
           +TQ    L  + +T+  +                        +               + 
Sbjct: 57  VTQGSTKLTGNTVTLKQDKNGDIEVVTSVGKPAYYEQKPAPDKDVTKAYGLTIQYFVTQN 116

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDG 179
            +VL         + ++ NTF G K++ +      +       QV         +I+   
Sbjct: 117 RVVLIDQAK----VIQEGNTFEGEKIVYDTQRQIVNAGRATGSQVTSPRPRIDMVIQPKK 172

Query: 180 R 180
           +
Sbjct: 173 K 173


>gi|315497168|ref|YP_004085972.1| lipopolysaccharide transport periplasmic protein lpta
           [Asticcacaulis excentricus CB 48]
 gi|315415180|gb|ADU11821.1| lipopolysaccharide transport periplasmic protein LptA
           [Asticcacaulis excentricus CB 48]
          Length = 176

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 64/171 (37%), Gaps = 14/171 (8%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           ++   L   A     +F       I   AD  E  +    A F G+V   QE   L+ADK
Sbjct: 9   VMGVALCLTAPVAWAQFVPTKESPIGYAADTFEADEGNHTATFTGSVEFLQETSRLRADK 68

Query: 81  MTIDYNNTNRDVSNKI-NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
           +T+ Y          + +  +   N++    +  +  S          LV+ G+    V+
Sbjct: 69  VTVTYGQNQATGKWDVLSTAEATGNVYYVVDDQVMTGSRAVYTKSTDTLVMTGN----VV 124

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQG----CESDQVQSIIRYD-----GRP 181
           LK+  N   G +L+ N+    +S+ G        +V+ +   D      +P
Sbjct: 125 LKQGQNVMEGSRLVYNVGAKKSSMDGVPTSGSKSRVRGVFYPDQGSTQKKP 175


>gi|149190589|ref|ZP_01868858.1| hypothetical protein VSAK1_01949 [Vibrio shilonii AK1]
 gi|148835587|gb|EDL52555.1| hypothetical protein VSAK1_01949 [Vibrio shilonii AK1]
          Length = 165

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/172 (12%), Positives = 58/172 (33%), Gaps = 15/172 (8%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L    L +  +L  + ++               + ++I +D  ++     +  F+G+V
Sbjct: 1   MKLSHLSLGICLLLPISAMA---------LSTDSEQPVYIDSDSQQLDMKSNQVTFEGDV 51

Query: 68  FMTQEDFSLQADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            + Q   ++ ADK+ +          V      +     +      +   A   +   + 
Sbjct: 52  KLKQGSININADKVIVTREAETGTIQVIEGFGDLATFSQLTDDGKTLYGEAKQLHYSLKN 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             L +     +K +L +  +   G  +   I +      G    +V ++++ 
Sbjct: 112 DQLTMT----NKAMLSQDDSIIRGSVIKYRISSQKLIADGDSKGRVSTVLQP 159


>gi|238918525|ref|YP_002932039.1| lipopolysaccharide transport periplasmic protein LptA,
           [Edwardsiella ictaluri 93-146]
 gi|238868093|gb|ACR67804.1| lipopolysaccharide transport periplasmic protein LptA, putative
           [Edwardsiella ictaluri 93-146]
          Length = 185

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 46/144 (31%), Gaps = 6/144 (4%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV--SN 94
                ++ IHI +    +      A F G+V +TQ    + ADK+ I   N  +      
Sbjct: 29  VTGDTDQPIHINSMQQSLDMQGNVATFTGDVIVTQGTIKITADKVVITRPNGQQGSEIVE 88

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                     +      +   +     +  K  ++L G       LK+  +   G ++  
Sbjct: 89  AYGNPVTFYQMQDNGKPVEGHSQQLRYELAKDYVILTGKAF----LKQLDSNIEGDRITY 144

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            +          +  +V +++   
Sbjct: 145 LVKQQQMEAFSDKGKRVTTVLLPS 168


>gi|238751360|ref|ZP_04612853.1| hypothetical protein yrohd0001_15460 [Yersinia rohdei ATCC 43380]
 gi|238710418|gb|EEQ02643.1| hypothetical protein yrohd0001_15460 [Yersinia rohdei ATCC 43380]
          Length = 161

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 16/148 (10%), Positives = 47/148 (31%), Gaps = 6/148 (4%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNR 90
                    ++ + + +    +  A     F  NV + Q    ++ADK+ +     + N+
Sbjct: 2   PALALTGDSDQPVLVDSVKQALDMAANTVTFTDNVVIKQGTIEIKADKVVVTRPGGDQNK 61

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
            V            +      +         +    +++L GD      L++  +   G 
Sbjct: 62  MVIEGFGNPVTFYQMQDSGKPVKGHGQKLRYEVANDLVILTGDAY----LEQLDSNIKGD 117

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
           ++   +          + ++V +++   
Sbjct: 118 RITYLVKKQQMEAFSNKGNRVTTVLLPS 145


>gi|21328701|gb|AAM48707.1| protein-glutamate methylesterase family protein [uncultured marine
           proteobacterium]
          Length = 162

 Score = 95.4 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 14/173 (8%)

Query: 9   HLYIHLLALVFVLLKA-DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           H+ + +  L+  +  A  LS      +  F+      + + AD L V      A F+GNV
Sbjct: 3   HILLLITVLLSSVCGALALSAQTTVSLDGFQSDPEASVEMLADRLTVSQTDGAARFEGNV 62

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            + Q D  L AD + + Y       +  I R+    ++ + S      A +   DF  R 
Sbjct: 63  VIAQGDMRLSADLVDVTY-----LEAGGIGRLSASGSVLLVSPSDTAQADSAVYDFSARE 117

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           L + G+    V+L +   +     L ++++T  A ++G    +V++++    +
Sbjct: 118 LRMRGN----VLLNQGAISLSADLLTIDLETGGAVMEG----RVRTVLPSGSK 162


>gi|309378633|emb|CBX22704.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 171

 Score = 95.0 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 55/159 (34%), Gaps = 10/159 (6%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           + +AAS     +    + I I+AD   +    Q   F GNV + Q   ++ A ++ +   
Sbjct: 13  ALSAASPAFALQSDSRQPIQIEADRGSLDQTKQSTTFSGNVVIRQGTLNISASRVNVTRG 72

Query: 87  NTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
               +                   G +   A+N         +VL G+      ++   +
Sbjct: 73  GKGGESVRAEGSPVRFSQTLDGGKGTVRGQANNIAYSSAGSTVVLTGNAK----VQRGGD 128

Query: 146 TFLGCKLIVNIDTSFASLQGC-----ESDQVQSIIRYDG 179
              G  +  N  T   ++ G      +S +V  +IR  G
Sbjct: 129 VVEGAVITYNTQTEVYTVSGGAKSAAKSGRVSVVIRPAG 167


>gi|37678634|ref|NP_933243.1| hypothetical protein VV0450 [Vibrio vulnificus YJ016]
 gi|37197374|dbj|BAC93214.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 169

 Score = 95.0 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 57/176 (32%), Gaps = 18/176 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +HL +  L L            A S     K    + ++I +D  ++     +  F 
Sbjct: 6   MKPLHLSLFALML------------ATSNAYALKSDTQQPVYIDSDSQQLDMRSNQVIFD 53

Query: 65  GNVFMTQEDFSLQADKMTIDYNN--TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  +             +      +      ++  A      
Sbjct: 54  GDVSLKQGSININADKIVVTRDPESNTIKKIEAFGQPATFSQLMDDGKTLSGSAKQLDYS 113

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L + G       L +  N   G  ++  I          ++++V ++++  
Sbjct: 114 IDNDQLTMKGQAE----LAQDNNVIKGSSIVYQIALQKLMADSSKNERVTTVLQPS 165


>gi|15599656|ref|NP_253150.1| hypothetical protein PA4460 [Pseudomonas aeruginosa PAO1]
 gi|116052492|ref|YP_792805.1| hypothetical protein PA14_57920 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893551|ref|YP_002442420.1| hypothetical protein PLES_48391 [Pseudomonas aeruginosa LESB58]
 gi|254238878|ref|ZP_04932201.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254244726|ref|ZP_04938048.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9950696|gb|AAG07848.1|AE004860_4 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587713|gb|ABJ13728.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170809|gb|EAZ56320.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198104|gb|EAZ62167.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218773779|emb|CAW29593.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 175

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 58/181 (32%), Gaps = 17/181 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +++ L L+F L     +   +S          + I ++AD  E+ D    A ++G+V 
Sbjct: 1   MRFVNTLPLIFGLT----AALGSSMALALPSDREQPIRVQADSAELDDKQGVAVYRGDVV 56

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI--NVIASNGYVDFQKR 126
           +TQ    L  + +T+  +                        +               + 
Sbjct: 57  VTQGSTKLTGNTVTLKQDKNGDIEVVTSVGKPAYYEQKPAPDKDVTKAYGLTIQYFVTQN 116

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDG 179
            +VL         + ++ NTF G K++ +      +       QV         +I+   
Sbjct: 117 RVVLIDQAK----VIQEGNTFEGEKIVYDTQRQIVNAGRATGSQVTSPRPRIDMVIQPKK 172

Query: 180 R 180
           +
Sbjct: 173 K 173


>gi|299770837|ref|YP_003732863.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter sp. DR1]
 gi|298700925|gb|ADI91490.1| lipopolysaccharide ABC transporter periplasmic substrate-binding
           protein LptA [Acinetobacter sp. DR1]
          Length = 182

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 60/179 (33%), Gaps = 12/179 (6%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           S  L     ++   A++  +  +  S              N++I + AD     +     
Sbjct: 4   SLNLKRSSAFLKQAAVITFVALSSAS------TFALPSDRNQQISLVADRATYNEKTGLT 57

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINV--IASNG 119
            + GNV + Q    LQAD +    N+     +        +    I + +          
Sbjct: 58  TYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGRPSKFQQQISADKGVARGEGQTI 117

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +    I+ LNG       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 118 VYNADTGIITLNGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 172


>gi|15964136|ref|NP_384489.1| hypothetical protein SMc01137 [Sinorhizobium meliloti 1021]
 gi|307301281|ref|ZP_07581043.1| OstA family protein [Sinorhizobium meliloti BL225C]
 gi|307317952|ref|ZP_07597389.1| OstA family protein [Sinorhizobium meliloti AK83]
 gi|7404503|sp|P25893|Y383_RHIME RecName: Full=Uncharacterized protein R00383; Flags: Precursor
 gi|15073312|emb|CAC41820.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896354|gb|EFN27103.1| OstA family protein [Sinorhizobium meliloti AK83]
 gi|306903737|gb|EFN34324.1| OstA family protein [Sinorhizobium meliloti BL225C]
          Length = 186

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 53/156 (33%), Positives = 80/156 (51%), Gaps = 7/156 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           QA +S M   ++  ++ I I++D LE+KD   KA F GNV + Q   +LQA  MT+ Y  
Sbjct: 32  QATSSRMQGLQLSNDQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGNMTVFYKA 91

Query: 88  T---NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                   +  I+R++V   +F+ SG       +G V+   + +VL G    KV+L E  
Sbjct: 92  GGGSVTSGNADIDRIEVSNKVFLSSGAQQATGESGIVNLTNQTIVLKG---KKVVLSEGK 148

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           N F+GC+L V +DT  A L  C   +VQ  +    R
Sbjct: 149 NVFVGCQLNVQMDTGEAQLDAC-GGRVQIQLDPQSR 183


>gi|260914442|ref|ZP_05920911.1| YhbN like protein [Pasteurella dagmatis ATCC 43325]
 gi|260631543|gb|EEX49725.1| YhbN like protein [Pasteurella dagmatis ATCC 43325]
          Length = 168

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 62/176 (35%), Gaps = 16/176 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S    I LLA + +   + L+          K    + I+I +D   +        F 
Sbjct: 1   MKSKSNQIILLATLVMASLSALA---------LKNDTQQPINIVSDNQSLDMDNHIVTFT 51

Query: 65  GNVFMTQEDFSLQADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            NV +TQ    ++A+K+ I      +  +D           +        +N  A+  + 
Sbjct: 52  DNVVITQGSILIKANKVVITRPPEKSGKKDTVEAFGNPVTFQQTLDNGKPVNGKANKVHY 111

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           D     L L G+      LK+  +      +  ++       +G  + +V++++  
Sbjct: 112 DLTTEFLTLTGNAE----LKQLDSKINSSMISYDVKKQQLKAKGSGNSRVKTVLIP 163


>gi|320157532|ref|YP_004189911.1| lptA, protein essential for LPS transport across the periplasm
           [Vibrio vulnificus MO6-24/O]
 gi|326423751|ref|NP_759675.2| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           vulnificus CMCP6]
 gi|319932844|gb|ADV87708.1| lptA, protein essential for LPS transport across the periplasm
           [Vibrio vulnificus MO6-24/O]
 gi|319999113|gb|AAO09202.2| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           vulnificus CMCP6]
          Length = 164

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 57/176 (32%), Gaps = 18/176 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  +HL +  L L            A S     K    + ++I +D  ++     +  F 
Sbjct: 1   MKPLHLSLFALML------------ATSNAYALKSDTQQPVYIDSDSQQLDMRSNQVIFD 48

Query: 65  GNVFMTQEDFSLQADKMTIDYNN--TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           G+V + Q   ++ ADK+ +  +             +      +      ++  A      
Sbjct: 49  GDVSLKQGSININADKIVVTRDPESNTIKKIEAFGQPATFSQLMDDGKTLSGSAKQLDYS 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                L + G       L +  N   G  ++  I          ++++V ++++  
Sbjct: 109 IDNDQLTMKGQAE----LAQDNNVIKGSSIVYQIALQKLMADSSKNERVTTVLQPS 160


>gi|85714033|ref|ZP_01045022.1| OstA-like protein [Nitrobacter sp. Nb-311A]
 gi|85699159|gb|EAQ37027.1| OstA-like protein [Nitrobacter sp. Nb-311A]
          Length = 225

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 22/169 (13%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q   + M  F    ++ I I+A  LE++D  ++A F GNV + Q D ++ +  + + Y +
Sbjct: 43  QGVPNAMQGFSQNRDQPIQIEAAALEMRDKKKEATFSGNVKVVQGDTTMTSKTLVVYYQS 102

Query: 88  TNRDVSNK-----------------INRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           +                        I R++   N+ +   +  V       D    ++ +
Sbjct: 103 SATAKGGAPAKLKPAAAPAPAGASSIKRLEARGNVVVTQKDQVVTGDTAVFDTTTNLITM 162

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            G    KV+L +  N   G +L+V++ T  + ++   S +VQ +     
Sbjct: 163 RG----KVVLSQCKNVLRGDRLLVDMTTGVSRVES-NSGRVQGLFIQKD 206


>gi|120555624|ref|YP_959975.1| OstA family protein [Marinobacter aquaeolei VT8]
 gi|120325473|gb|ABM19788.1| OstA family protein [Marinobacter aquaeolei VT8]
          Length = 188

 Score = 95.0 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 61/175 (34%), Gaps = 18/175 (10%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +   + L   LL   +S         F +  +  I + AD   + D+   A + G V 
Sbjct: 7   RSFCRPVILAMALLAGPVS--------AFNLDSDIPIKVSADSARLDDSAGTAVYTGAVE 58

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI-FIQSGEINVIASNGYVDFQKRI 127
           + Q +  L+AD++ +  N                R       G  +  A N      + +
Sbjct: 59  LIQGETRLEADRVVLYRNQQGVSRIEAAGNPAHYRQPGQEGEGMTDAKALNITWSGDENL 118

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC-----ESDQVQSIIRY 177
           ++       + ++++  N F G  +  +      + +G       S +V+ +I+ 
Sbjct: 119 VIFE----RQAVIEQGGNVFRGDVIHYDTVRRVVTAEGDTSSEGGSGRVEMVIQP 169


>gi|212711082|ref|ZP_03319210.1| hypothetical protein PROVALCAL_02151 [Providencia alcalifaciens DSM
           30120]
 gi|212686250|gb|EEB45778.1| hypothetical protein PROVALCAL_02151 [Providencia alcalifaciens DSM
           30120]
          Length = 185

 Score = 94.6 bits (233), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/158 (13%), Positives = 54/158 (34%), Gaps = 6/158 (3%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A    A +      K    + + I +    +        F  +V + Q    ++A+K+
Sbjct: 13  AVASAILALSLPAMALKTDTQQPMTINSVKQSLDLEKNVTTFTDDVVIKQGSIDIRANKV 72

Query: 82  TIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
            +    +++++ V            +      I   AS    +  K+++ L GD      
Sbjct: 73  IVTRPSSDSDKIVIEAFGTPVTFYQLQDDGKPIKGHASKARYEVDKQLVTLTGDAY---- 128

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           L++  +   G K+   + T        +  +V +++  
Sbjct: 129 LEQLDSNIKGDKITYVVPTQQMEAFSDKGKRVTTVLLP 166


>gi|319407890|emb|CBI81542.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 199

 Score = 94.6 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/195 (21%), Positives = 79/195 (40%), Gaps = 23/195 (11%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
                    L L  + L      A  ++         E I + AD LE++D  + A F G
Sbjct: 8   KKQMGLYLALILGTLGLTMVWGHAEEAHFGINLSNSKEPIELHADSLEIRDKEEIAVFSG 67

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR----------------MDVERNIFIQS 109
           NV + Q +  +Q  ++ + Y+ T++ +                      M+    ++I+ 
Sbjct: 68  NVSIVQGERLMQTSQLIVYYDKTHKTIDENKKNIESTSPVGFDVTGIKKMEALGKVYIKI 127

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC--- 166
                    G  D Q   ++L G+   KV+LK+  N   GCKL V++++  A L+GC   
Sbjct: 128 ATQIATGDKGIFDRQSNRMILTGN---KVVLKDNNNVATGCKLTVHMESGKAFLEGCQAF 184

Query: 167 -ESDQVQSIIRYDGR 180
            + ++   I++   +
Sbjct: 185 EKKNRASIILKSSQK 199


>gi|85713034|ref|ZP_01044071.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
 gi|85693137|gb|EAQ31098.1| Uncharacterized conserved membrane protein [Idiomarina baltica
           OS145]
          Length = 180

 Score = 94.6 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 57/165 (34%), Gaps = 8/165 (4%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L+ A L+  +   + + +    + I + A          +     NV +TQ    ++AD
Sbjct: 5   FLILASLAAVSQLAVAQGESDFEKPIEVSAGHEHFDIKNNQLLLTDNVIVTQGSLRIEAD 64

Query: 80  KMTID--YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           ++           D      R  V   +     EI+  A        +  + L G+    
Sbjct: 65  RLEASGGEAKDQADTFVAHGRPAVYTQLLENGTEISAEADQITYFQSQGRIELKGNAQ-- 122

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDGR 180
             + +  +   G  ++ ++     S +G +   ++V +I   + +
Sbjct: 123 --ITQGSSLSRGDTIVYDLTNQHVSARGSKESGERVTTIFNPNKQ 165



 Score = 37.6 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 13/71 (18%), Positives = 24/71 (33%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I  +AD +    +  +   KGN  +TQ     + D +  D  N +          +    
Sbjct: 99  ISAEADQITYFQSQGRIELKGNAQITQGSSLSRGDTIVYDLTNQHVSARGSKESGERVTT 158

Query: 105 IFIQSGEINVI 115
           IF  + +    
Sbjct: 159 IFNPNKQSEKE 169


>gi|258622781|ref|ZP_05717799.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258625807|ref|ZP_05720686.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258582045|gb|EEW06915.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258584969|gb|EEW09700.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 154

 Score = 94.6 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 55/150 (36%), Gaps = 6/150 (4%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A++          + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  N  N
Sbjct: 3   ASTQAYALSTDREQPVYIDSDSQQLDMKSNRVTFLGDVKLKQGSININADKLIVIRNADN 62

Query: 90  --RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
              +       +     +  +   +   A   Y   +   LV+     +K +L +  +  
Sbjct: 63  GKIEEIEGYGNVATFSQLTDEGKTLYGEAKELYYKVRDDELVMI----NKAMLSQDDSEI 118

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            G K+   I +           +V ++++ 
Sbjct: 119 RGSKIRYKISSQKLIADSDGKGRVSTVLQP 148


>gi|145635600|ref|ZP_01791298.1| hypothetical protein CGSHiAA_07486 [Haemophilus influenzae PittAA]
 gi|145637099|ref|ZP_01792762.1| hypothetical protein CGSHiHH_02528 [Haemophilus influenzae PittHH]
 gi|148828308|ref|YP_001293061.1| hypothetical protein CGSHiGG_09410 [Haemophilus influenzae PittGG]
 gi|229846180|ref|ZP_04466292.1| hypothetical protein CGSHi7P49H1_05018 [Haemophilus influenzae
           7P49H1]
 gi|260581802|ref|ZP_05849598.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae NT127]
 gi|329124123|ref|ZP_08252670.1| YhbN like protein [Haemophilus aegyptius ATCC 11116]
 gi|145267162|gb|EDK07168.1| hypothetical protein CGSHiAA_07486 [Haemophilus influenzae PittAA]
 gi|145269753|gb|EDK09693.1| hypothetical protein CGSHiHH_02528 [Haemophilus influenzae PittHH]
 gi|148719550|gb|ABR00678.1| hypothetical protein CGSHiGG_09410 [Haemophilus influenzae PittGG]
 gi|229811184|gb|EEP46901.1| hypothetical protein CGSHi7P49H1_05018 [Haemophilus influenzae
           7P49H1]
 gi|260094995|gb|EEW78887.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae NT127]
 gi|309973384|gb|ADO96585.1| Lipooligosaccharide transporter, periplasmic binding protein LptA
           [Haemophilus influenzae R2846]
 gi|327467548|gb|EGF13046.1| YhbN like protein [Haemophilus aegyptius ATCC 11116]
          Length = 172

 Score = 94.6 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    ++  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|16273644|ref|NP_439307.1| hypothetical protein HI1149m [Haemophilus influenzae Rd KW20]
 gi|260580233|ref|ZP_05848063.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae RdAW]
 gi|1176174|sp|P45074|LPTA_HAEIN RecName: Full=Lipopolysaccharide export system protein lptA; Flags:
           Precursor
 gi|260093517|gb|EEW77450.1| lipopolysaccharide transport periplasmic protein LptA [Haemophilus
           influenzae RdAW]
          Length = 172

 Score = 94.6 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    ++  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|313667761|ref|YP_004048045.1| hypothetical protein NLA_4160 [Neisseria lactamica ST-640]
 gi|313005223|emb|CBN86656.1| hypothetical outer membrane protein [Neisseria lactamica 020-06]
          Length = 171

 Score = 94.6 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 54/159 (33%), Gaps = 10/159 (6%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           + +A S     +    + I I+AD   +    Q   F GNV + Q   ++ A ++ +   
Sbjct: 13  ALSATSPAFALQSDSRQPIQIEADRGSLDQTKQSTTFSGNVVIRQGTLNISASRVNVTRG 72

Query: 87  NTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
               +                   G +   A+N         +VL G+      ++   +
Sbjct: 73  GKGGESVRAEGSPVRFSQTLDGGKGTVRGQANNIAYSSAGSTVVLTGNAK----VQRGGD 128

Query: 146 TFLGCKLIVNIDTSFASLQGC-----ESDQVQSIIRYDG 179
              G  +  N  T   ++ G      +S +V  +IR  G
Sbjct: 129 VVEGAVITYNTQTEVYTVSGGAKSAAKSGRVSVVIRPAG 167


>gi|188996154|ref|YP_001930405.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931221|gb|ACD65851.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 179

 Score = 94.6 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 66/177 (37%), Gaps = 18/177 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F + I+     + L FVL+             + +    E + I AD LE  +  + A +
Sbjct: 19  FASRIYKLAFFIILFFVLVAYS--------QEKKETNKKEPVVITADKLEYFNKDKIAIY 70

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            G V   + +  L AD M I  ++        ++++    N++ +               
Sbjct: 71  TGKVEAIKGNIKLNADMMKIFLDDK-----GDVSKIIATGNVYFEQENKWGKGKEAEYYK 125

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            K +++L  +      + +  N   G ++   ID   A     ++ +V+SII    +
Sbjct: 126 DKNLIILRNNAE----VHQDKNVVEGDEIYYYIDEEKAIATS-KTKRVRSIIFPKEK 177


>gi|225851254|ref|YP_002731488.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
 gi|225646594|gb|ACO04780.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
          Length = 156

 Score = 94.6 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 19/169 (11%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            + L+ + F+L      Q         +    E I I+AD L        A +KGNV + 
Sbjct: 1   MVRLILIFFMLFSFAYPQ---------EEKKEEPILIEADELVYNKNENTAVYKGNVTVK 51

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           + + ++ A+KM I  +         I+R+  E ++  + G  +  +        K I+VL
Sbjct: 52  KGNLTINAEKMIIYLSEE-----GDISRIYAEGDVRFKKGNRSGSSKKAEYIKDKDIIVL 106

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
                DK  L ++ N   G ++I ++DT  A ++G ++  V+++I  D 
Sbjct: 107 I----DKAKLIQEKNIIEGDEIIYHLDTEVAEVKGKDNK-VRTVIFPDK 150


>gi|123443940|ref|YP_001007911.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|332163085|ref|YP_004299662.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|122090901|emb|CAL13783.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604035|emb|CBY25533.1| lpta, protein essential for LPS transport across the periplasm
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667315|gb|ADZ43959.1| lipopolysaccharide transport periplasmic protein LptA [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862759|emb|CBX72901.1| lipopolysaccharide export system protein lptA [Yersinia
           enterocolitica W22703]
          Length = 181

 Score = 94.2 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 14/143 (9%), Positives = 44/143 (30%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNK 95
               ++ + + +    +        F  NV + Q    ++ADK+ +     + ++ V   
Sbjct: 27  TGDTDQPVLVDSVKQALDMGANTVTFTDNVVIKQGTIEIKADKVVVTRPGGDQSKMVIEG 86

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                    +      +         +     +VL G+      L++  +   G ++   
Sbjct: 87  FGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGNAY----LEQLDSNIKGDRITYL 142

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V +++   
Sbjct: 143 VKKQQMEAFSDKGKRVTTVLLPS 165


>gi|33151776|ref|NP_873129.1| hypothetical protein HD0587 [Haemophilus ducreyi 35000HP]
 gi|6969426|gb|AAF33770.1|AF219259_3 YhbN [Haemophilus ducreyi]
 gi|33147997|gb|AAP95518.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 167

 Score = 94.2 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 60/173 (34%), Gaps = 14/173 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S+   + +LA +F    +  +          K    ++I+I A    +        F 
Sbjct: 1   MKSLSKSV-VLATLFSFSLSAYA---------LKSDAEKQINIDAGSQSLDINTNTVIFS 50

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
            NV +TQ    + A+K+ I      ++  +        +        +    +  + D  
Sbjct: 51  DNVIITQGSIKVTANKVKITRQTGKKETLDATGSPVTFQQTLDNGKPVKGKGNTVHYDLN 110

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
              L L G+      LK++ +     K+  ++     +     + +V++I+  
Sbjct: 111 SEFLTLTGNAE----LKQQGSFIQADKITYDVKKQKLTAGSGNNSRVKTILIP 159


>gi|218530673|ref|YP_002421489.1| OstA family protein [Methylobacterium chloromethanicum CM4]
 gi|218522976|gb|ACK83561.1| OstA family protein [Methylobacterium chloromethanicum CM4]
          Length = 246

 Score = 94.2 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 59/162 (36%), Gaps = 31/162 (19%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD------------ 91
            I I AD L+V D   KA F GNV   Q + +++   MT+ Y                  
Sbjct: 46  PIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPAKDANKDAAK 105

Query: 92  ---------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
                            N I +++    + +   +      N   D + + +VL G+   
Sbjct: 106 SEAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTGN--- 162

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            V+L +  N   G +L+ ++ +  A++      +V ++    
Sbjct: 163 -VVLSQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPG 203


>gi|145627881|ref|ZP_01783682.1| hypothetical protein CGSHi22121_02550 [Haemophilus influenzae
           22.1-21]
 gi|144979656|gb|EDJ89315.1| hypothetical protein CGSHi22121_02550 [Haemophilus influenzae
           22.1-21]
          Length = 159

 Score = 94.2 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 50/152 (32%), Gaps = 7/152 (4%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY---N 86
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 4   ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVITRPAEK 63

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +  ++                    +   A+  + D     L L  +      LK+  + 
Sbjct: 64  SGKKETVEAFGTPVTFHQQLDNGKPVEGKANKVHYDLGNEFLTLTNNAE----LKQLDSK 119

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G  +  ++        G    +V +++   
Sbjct: 120 INGSVITYDVKKQQLKANGNGKSRVTTVLIPS 151


>gi|262278511|ref|ZP_06056296.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258862|gb|EEY77595.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 194

 Score = 94.2 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 58/180 (32%), Gaps = 10/180 (5%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   LN  H    L     +   A  S +            +++I + AD     +    
Sbjct: 13  MHQSLNLKHSSAFLKQAAVITFVALSSASTF----ALPSDRSQQISLVADRATYNEKTGL 68

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINV--IASN 118
             + GNV + Q    LQAD +    N+     +        +    I + +         
Sbjct: 69  TTYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGRPSKFQQQISADKGVARGEGQT 128

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              +    I+ L G       L +  ++  G  L  +++      QG  S++VQ II   
Sbjct: 129 IVYNADTGIITLAGGAY----LYQDGSSIRGNSLKYSMNKGDVEAQGSSSNRVQIIIPPS 184


>gi|226940942|ref|YP_002796016.1| OstA-like protein [Laribacter hongkongensis HLHK9]
 gi|226715869|gb|ACO75007.1| OstA-like protein [Laribacter hongkongensis HLHK9]
          Length = 183

 Score = 94.2 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 56/178 (31%), Gaps = 19/178 (10%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L   LL + L+   +      +   ++ I I+AD   +        ++GNV +TQ    +
Sbjct: 6   LAGFLLISGLA-GLSVPAHAEQADRSKPIVIEADRANLDQLKGVTVYEGNVILTQGTARI 64

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-----VIASNGYVDFQKRILVLN 131
             +++ +  +N  + ++N        +       +               D  K ++ + 
Sbjct: 65  TGNRLVVTEDNAKQQIANVYGNPATFKQRLDADKDGKVEWVDGKGQRIEYDSGKDLVRIW 124

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYDGR 180
            +      +    +   G  ++ N  T      G             +V   I+   +
Sbjct: 125 DNGR----VTRGGDVVTGNYIVYNAKTEQFEASGQQAGPNGQPQGKGRVTVTIQPRQQ 178


>gi|93006315|ref|YP_580752.1| OstA-like protein [Psychrobacter cryohalolentis K5]
 gi|92393993|gb|ABE75268.1| OstA-like protein [Psychrobacter cryohalolentis K5]
          Length = 189

 Score = 94.2 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 51/160 (31%), Gaps = 6/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
            L   +  A   Y        N+ I + AD     +      + G V +TQ  F + AD 
Sbjct: 25  ALPVVMLLALPLYSHALPSDANQPIKLLADKATYSERSGITSYSGTVVITQGTFKMTADN 84

Query: 81  MTIDYNNTNRDVSNKINRMDVERNI--FIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           +T++ +      S                + G     A+    +    I+ L G+     
Sbjct: 85  ITVNLSQGRSINSAVATGRPATMQQVVTQEKGLAKGQANKIDYNAVTGIVTLTGNAK--- 141

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L +   +F G  +  ++           + +V+ +   +
Sbjct: 142 -LVQNGASFAGNVIRYSLKAGDVEATAGGNQRVELVFPPN 180


>gi|317046698|ref|YP_004114346.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           At-9b]
 gi|316948315|gb|ADU67790.1| lipopolysaccharide transport periplasmic protein LptA [Pantoea sp.
           At-9b]
          Length = 184

 Score = 93.8 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 17/152 (11%), Positives = 51/152 (33%), Gaps = 7/152 (4%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
            +          ++ ++I ++   +      A F GNV +TQ    + ADK+ +     +
Sbjct: 21  TSLPALALTGDSDKPVNIDSENQSLDLQGNVATFTGNVIVTQGSIKITADKVVVTRPGGD 80

Query: 90  RDVS--NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
              +  +          +      +   A+  + +     + L G+      +++  +  
Sbjct: 81  SKKTIVDAWGNPATFYQMQDNGKPVQGHAAKLHYELANDFVELTGNAY----IEQLDSNI 136

Query: 148 LGCKLIVNIDTSFASLQG-CESDQVQSIIRYD 178
            G ++   +           +S +V +++   
Sbjct: 137 KGDRITYLVKEQKMQAYSQGQSKRVTTVLVPS 168


>gi|217976353|ref|YP_002360500.1| lipopolysaccharide transport periplasmic protein LptA [Methylocella
           silvestris BL2]
 gi|217501729|gb|ACK49138.1| lipopolysaccharide transport periplasmic protein LptA [Methylocella
           silvestris BL2]
          Length = 207

 Score = 93.8 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 62/164 (37%), Gaps = 15/164 (9%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A  +               E IHI+A  L+  D  QK  + GNV  TQ   +L++  +
Sbjct: 26  SVAARAAEQQGSSILPGGDSKEPIHIEAAKLDYFDKEQKLIYTGNVVATQGGSTLKSTIL 85

Query: 82  TIDYNNTNRD-------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            +     +          S+++ RM+    + + + +       G  +  +  L L  + 
Sbjct: 86  ILYLTPKSDPDQAGVPSSSSQLRRMEATGPVTMITKDQVSTGDRGVYEKAENKLYLYDN- 144

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
              V + +  N   G K+  ++ T  A + G    +V+S+   +
Sbjct: 145 ---VTVTQGTNVTKGDKMTYDLTTKKAIVTG----RVKSMFLPE 181


>gi|217969306|ref|YP_002354540.1| lipopolysaccharide transport periplasmic protein LptA [Thauera sp.
           MZ1T]
 gi|217506633|gb|ACK53644.1| lipopolysaccharide transport periplasmic protein LptA [Thauera sp.
           MZ1T]
          Length = 180

 Score = 93.8 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 56/162 (34%), Gaps = 17/162 (10%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN----NT 88
                K   ++ ++I+AD L V D  +   F+G+V +TQ   +++ DK+ +  +      
Sbjct: 19  PALAEKADRDQPVNIEADRLTVDDRNKVHIFEGSVVLTQGTLTIRGDKLVVTQDAAGFQN 78

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               +         +     +  +   A     D +     L         +    +   
Sbjct: 79  GVATAAGKGLATFRQRRDGSAEYVEGEAERIEYDSRTEKARLFNRAK----VSSGGDQVS 134

Query: 149 GCKLIVNIDTSFASLQ-------GCESDQVQSIIRY--DGRP 181
           G  +  +  T             G  + +V+++I+   DG+P
Sbjct: 135 GHYIEYDAITENYLATNAPGSRQGAPAGRVRAVIQPKSDGQP 176


>gi|327479596|gb|AEA82906.1| OstA family protein [Pseudomonas stutzeri DSM 4166]
          Length = 169

 Score = 93.8 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/164 (14%), Positives = 49/164 (29%), Gaps = 13/164 (7%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
            +    +          + I ++AD  E+ D    A ++G+V +TQ    +  D +TI  
Sbjct: 2   SAFWLGASAWALPEDREQPIRVQADSAELDDRQGVAVYRGDVVITQGTMKITGDTVTITQ 61

Query: 86  NNTNRDVSNKINRMDVERNIFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
           ++                          +               +VL         + ++
Sbjct: 62  DSNGDVEVFTSIGKPAYYEQKPAVDKEIVKAYGLTIQYFAANERIVLLDQAK----VVQE 117

Query: 144 LNTFLGCKLIVNIDTSFASL-------QGCESDQVQSIIRYDGR 180
            NTF G K++ +      +              +V  +I+   R
Sbjct: 118 GNTFEGEKIVYDTRRQIVNAGRATNTDVSTPRPRVDMVIQPRKR 161


>gi|319945406|ref|ZP_08019666.1| cell envelope biogenesis protein YhbN [Lautropia mirabilis ATCC
           51599]
 gi|319741192|gb|EFV93619.1| cell envelope biogenesis protein YhbN [Lautropia mirabilis ATCC
           51599]
          Length = 219

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 58/148 (39%), Gaps = 6/148 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K   ++ I+I+++ LE  DA + + F GNV +T+    +  D+M +     N   +  
Sbjct: 31  AEKADRDKPINIESNRLEYNDATKVSTFIGNVVLTKGTIRITGDRMVLTQVGRNAQTARV 90

Query: 96  INRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRADKVILK-EKLNTFLGCKLI 153
                  R       +    +A   + D +   + L G    +     + ++   G  ++
Sbjct: 91  NGNQASFRQKRDGMEQYIHGVADQIFYDTRTEQVTLTGRARLQRQNCNQPVDEITGGHIV 150

Query: 154 VNIDTSFASLQGCES----DQVQSIIRY 177
            +  T   S+ G +      +V+ +I+ 
Sbjct: 151 YSASTETFSVDGQQRGERPGRVRIVIQP 178


>gi|260753181|ref|YP_003226074.1| OstA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552544|gb|ACV75490.1| OstA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 198

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 73/190 (38%), Gaps = 19/190 (10%)

Query: 1   MSAFLNSIHL--YIHLLALVFVLLKADLSQAAASYMTRFKV-LGNEKIHIKADMLEVKDA 57
           M + L       ++   AL+       L+  +A     F+    N  I I AD  EV   
Sbjct: 1   MYSGLKKYKPLPFLKAAALLLCGFTLILTPLSALSAQGFRHHDTNAPIDIDADHSEVLYN 60

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDY----NNTNRDVSNKINRMDVERNIFIQSGEIN 113
             +A + G+V   Q D ++ A  + I Y    N+   + S ++ R+D    + IQ+ +  
Sbjct: 61  DNRAIYSGHVRARQADMTITAAYVRIAYTMPKNSKTGEASPQMQRLDASGGVTIQTPDEM 120

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC------- 166
                   D  KR++ L G     V +    +   G +LI++++T   ++ G        
Sbjct: 121 AKGEIAIYDVPKRLVTLVG----HVEMVRGDSVVHGARLIIDLNTGKGTMDGSLVGSDGS 176

Query: 167 -ESDQVQSII 175
               +V    
Sbjct: 177 QGKGRVTGHF 186


>gi|145630249|ref|ZP_01786031.1| hypothetical protein CGSHi22421_09358 [Haemophilus influenzae
           R3021]
 gi|144984530|gb|EDJ91953.1| hypothetical protein CGSHi22421_09358 [Haemophilus influenzae
           R3021]
          Length = 159

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 51/152 (33%), Gaps = 7/152 (4%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY---N 86
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 4   ASSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVITRPAEK 63

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +  ++                    ++  A+  + D     L L  +      LK+  + 
Sbjct: 64  SGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGSEFLTLTNNAE----LKQLDSK 119

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G  +  ++        G    +V +++   
Sbjct: 120 INGSVITYDVKKQQLKANGNGKSRVTTVLIPS 151


>gi|329118332|ref|ZP_08247041.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327465556|gb|EGF11832.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 188

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 52/148 (35%), Gaps = 11/148 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +    + I I+AD  E+    +   F GNV + Q   +++A  + +  ++  +       
Sbjct: 38  ESDRKQPIEIEADQGELDQKNRSTTFSGNVSIKQGTLNIRAASVHVVRSDDGQQTMKATG 97

Query: 98  RMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                        G ++  AS         ++ L+G+      +    +   G  +  N 
Sbjct: 98  SPVRFGQTLDGGKGTVSGEASQVDYSSATNVVRLSGNAK----VTRGGDKAEGAVITYNT 153

Query: 157 DTSFASLQGCE------SDQVQSIIRYD 178
            T   ++ G +        +V  +I+ D
Sbjct: 154 RTEVYTVSGSKPASGKGGKRVSVVIQPD 181


>gi|197117259|ref|YP_002137686.1| cell envelope biogenesis ABC transporter periplasmic protein
           [Geobacter bemidjiensis Bem]
 gi|197086619|gb|ACH37890.1| cell envelope biogenesis ABC transporter, periplasmic protein
           [Geobacter bemidjiensis Bem]
          Length = 162

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 64/149 (42%), Gaps = 8/149 (5%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S      + GNE + +K+D L   +  + A F+G V   Q + +L  D++ +        
Sbjct: 16  SGAVAAPISGNEPLKVKSDNLTADNEKKTATFEGKVVAHQGELTLYTDRLVVSSAGD--- 72

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
             N++++++   N+ I  G       +   D ++ +++L+G+    V             
Sbjct: 73  -GNELSKVEAFGNVRILQGIRQATGGHAVYDPKRGVILLDGNPRVVVGDDVVTGKV---- 127

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           +   I+   + + G   ++V+++I   G+
Sbjct: 128 ITYFINEQRSIVTGGPKERVEAVIHPGGK 156


>gi|225851689|ref|YP_002731922.1| OstA-like protein [Brucella melitensis ATCC 23457]
 gi|256045948|ref|ZP_05448820.1| OstA-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112661|ref|ZP_05453582.1| OstA-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|265992358|ref|ZP_06104915.1| OstA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994101|ref|ZP_06106658.1| OstA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|225640054|gb|ACN99967.1| OstA-like protein [Brucella melitensis ATCC 23457]
 gi|262765082|gb|EEZ11003.1| OstA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|263003424|gb|EEZ15717.1| OstA family protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 204

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I  +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 194


>gi|226943409|ref|YP_002798482.1| LPS transport protein LptA [Azotobacter vinelandii DJ]
 gi|226718336|gb|ACO77507.1| LPS transport protein LptA [Azotobacter vinelandii DJ]
          Length = 184

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 52/160 (32%), Gaps = 13/160 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
            A+         ++ I ++AD  E+ D    A + G+V +TQ    +  +K+TI  ++  
Sbjct: 22  GAASAWALSSDRDQPIRVQADSAELDDKQGVAVYHGDVVITQGTLKITGNKVTITQDDNG 81

Query: 90  RDVSNKINRMDVERNIFIQSGEI--NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                                +              +   +VL     DK  + +  NTF
Sbjct: 82  DIKVFTSVGNPAYYEQKPAPDKSVVKAYGQTIQYFAENERIVLI----DKARVIQDGNTF 137

Query: 148 LGCKLIVNIDTSFASL-------QGCESDQVQSIIRYDGR 180
            G K++ +      +              ++  +I+   +
Sbjct: 138 EGEKIVYDTQRQIVNAGRATGAKVTSPKPRIDMVIQPKKK 177


>gi|238764277|ref|ZP_04625229.1| hypothetical protein ykris0001_25430 [Yersinia kristensenii ATCC
           33638]
 gi|238697558|gb|EEP90323.1| hypothetical protein ykris0001_25430 [Yersinia kristensenii ATCC
           33638]
          Length = 171

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 45/143 (31%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNK 95
               ++ + + +    +  A     F  NV + Q    ++ADK+ +     + ++ V   
Sbjct: 17  TGDTDQPVKVDSVKQALDMAANTITFTDNVIIKQGTIEIKADKVVVTRPGGDQSKMVIEG 76

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                    +      +         +     +VL GD      L++  +   G ++   
Sbjct: 77  FGNPVTFYQMQDSGKPVKGHGQKLRYEVANDFVVLTGDAY----LEQLDSNIKGDRITYL 132

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           +          +  +V +++   
Sbjct: 133 VKKQQMEAFSDKGKRVTTVLLPS 155


>gi|157373867|ref|YP_001472467.1| OstA family protein [Shewanella sediminis HAW-EB3]
 gi|157316241|gb|ABV35339.1| OstA family protein [Shewanella sediminis HAW-EB3]
          Length = 217

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 61/168 (36%), Gaps = 14/168 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + ++AL+ ++  + +++              +++ I A   E      +  F G V +TQ
Sbjct: 6   LLIIALLSIVSFSGMAKL---------DDLKQEVKISAASQEADIKNNQIIFNGPVEVTQ 56

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVL 130
               + AD++                      +  ++ G   +  A     +   R L L
Sbjct: 57  GSVKILADELRAFSKEEGGGKILVATGSPATYSQIMEDGRPASASAKEIRYELSSRTLTL 116

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G+      L++  +   G ++  NI       +   +D+V +II+ +
Sbjct: 117 IGNA----TLEQAGSQVTGHQIRYNIAKQQLIAESTGNDRVITIIQPE 160


>gi|218710675|ref|YP_002418296.1| hypothetical protein VS_2755 [Vibrio splendidus LGP32]
 gi|218323694|emb|CAV20030.1| hypothetical protein VS_2755 [Vibrio splendidus LGP32]
          Length = 175

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 52/144 (36%), Gaps = 6/144 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVS 93
                  + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  N  N   +  
Sbjct: 31  ALSSDSEQPVYIDSDSQQLDMKSNQVTFLGDVNLKQGSININADKVIVTRNAVNGEIEEI 90

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
               +      +      +   A + +       L++  +     +L +  +   G K+ 
Sbjct: 91  QGFGKPATFSQLTDDGKTLYGEADDLHYQLIADRLIMTKNA----MLSQDGSIIRGSKIT 146

Query: 154 VNIDTSFASLQGCESDQVQSIIRY 177
             I +         S++V ++++ 
Sbjct: 147 YQITSQKLVADSDSSERVSTVLQP 170


>gi|254718372|ref|ZP_05180183.1| OstA-like protein [Brucella sp. 83/13]
          Length = 204

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTRGRVSIIMAPKDQ 194


>gi|1574705|gb|AAC22804.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
          Length = 159

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 51/152 (33%), Gaps = 7/152 (4%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY---N 86
           A+S     K   N+ I+I +D   +        F  NV +TQ    ++A+K+ I      
Sbjct: 4   ASSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIKANKVVITRPAEK 63

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +  ++                    ++  A+  + D     L L  +      LK+  + 
Sbjct: 64  SGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTLTNNAE----LKQLDSK 119

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G  +  ++        G    +V +++   
Sbjct: 120 INGSVITYDVKKQQLKANGNGKSRVTTVLIPS 151


>gi|148265013|ref|YP_001231719.1| OstA family protein [Geobacter uraniireducens Rf4]
 gi|146398513|gb|ABQ27146.1| OstA family protein [Geobacter uraniireducens Rf4]
          Length = 169

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 68/164 (41%), Gaps = 8/164 (4%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           ++ ++L   L+    +          + I IK++ L   +  + A F G V   Q D ++
Sbjct: 6   ILAIVLSLTLAGVVLAAGKSGGDRNAQPIKIKSNELFTDNNNRTATFVGKVSARQGDMTI 65

Query: 77  QADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
            +DK+ I+Y+  +      + +++   N+ +  G    +A +   + +   +VL+     
Sbjct: 66  YSDKLVINYSEKD----KDVEKVEAFGNVRVVQGNRQALAGHALYENKAGKIVLDTSPK- 120

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
              + +  +   G  +   +D   + + G    +V+++I    +
Sbjct: 121 ---VYQGDDVVSGKVITYFVDEQKSVVTGGGDARVEAVIHPMDK 161


>gi|254561640|ref|YP_003068735.1| hypothetical protein METDI3227 [Methylobacterium extorquens DM4]
 gi|254268918|emb|CAX24879.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 246

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 59/162 (36%), Gaps = 31/162 (19%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD------------ 91
            I I AD L+V D   KA F GNV   Q + +++   MT+ Y                  
Sbjct: 46  PIKIDADRLDVFDKENKAIFAGNVVAVQGESTIRCSAMTVHYKRDKDKDPSKDANKDAAK 105

Query: 92  ---------------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRAD 136
                            N I +++    + +   +      N   D + + +VL G+   
Sbjct: 106 SDAEAAEDAKAKAALGGNGIRKVECAGPVTVAQKDQIATGDNAVFDQEAKRIVLTGN--- 162

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            V+L +  N   G +L+ ++ +  A++      +V ++    
Sbjct: 163 -VVLSQCQNVTRGSRLVYDMASGRANMDPVAGGRVSAMFVPG 203


>gi|254292597|ref|YP_003058620.1| lipopolysaccharide transport periplasmic protein LptA [Hirschia
           baltica ATCC 49814]
 gi|254041128|gb|ACT57923.1| lipopolysaccharide transport periplasmic protein LptA [Hirschia
           baltica ATCC 49814]
          Length = 178

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 70/178 (39%), Gaps = 23/178 (12%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
            +A++ +L+ A  +Q   S            I I AD  E+ D   +A ++GNV + Q  
Sbjct: 11  FVAIITMLVPAAHAQLGNSRG---------PIEITADRFELDDVKHEAIYQGNVDVIQGQ 61

Query: 74  FSLQADKMTIDYNNTNRDV---------SNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
             ++A+K+ + Y +                 +  +     ++  +    V A  G  + +
Sbjct: 62  SRIRANKVVVSYWSKESQKERAAAATGSIGALKEIIATGEVYYITPVEKVKAERGVYNAE 121

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE-SDQVQSIIRYDGRP 181
           K  + L+G+    V++        G  L+++I     ++ G     +V S+    G P
Sbjct: 122 KERITLSGN----VLVTNAEGVIAGAHLVIDIPKGRYNMDGGGLGGRVTSVFESVGEP 175


>gi|163842426|ref|YP_001626830.1| hypothetical protein BSUIS_A0157 [Brucella suis ATCC 23445]
 gi|163673149|gb|ABY37260.1| hypothetical protein BSUIS_A0157 [Brucella suis ATCC 23445]
          Length = 204

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A ++ C+     +V  I+    +
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRAKVESCKGQTKGRVSIIMAPKDQ 194


>gi|86147578|ref|ZP_01065888.1| hypothetical protein MED222_22853 [Vibrio sp. MED222]
 gi|85834617|gb|EAQ52765.1| hypothetical protein MED222_22853 [Vibrio sp. MED222]
          Length = 164

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 52/144 (36%), Gaps = 6/144 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVS 93
                  + ++I +D  ++     +  F G+V + Q   ++ ADK+ +  N  N   +  
Sbjct: 20  ALSSDSEQPVYIDSDSQQLDMKSNQVTFLGDVNLKQGSININADKVIVTRNAVNGEIEEI 79

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
               +      +      +   A + +       L++  +     +L +  +   G K+ 
Sbjct: 80  QGFGKPATFSQLTDDGKTLYGEADDLHYQLIADRLIMTKNA----MLSQDGSIIRGSKIT 135

Query: 154 VNIDTSFASLQGCESDQVQSIIRY 177
             I +         S++V ++++ 
Sbjct: 136 YQITSQKLVADSDSSERVSTVLQP 159


>gi|224826290|ref|ZP_03699392.1| lipopolysaccharide transport periplasmic protein LptA [Lutiella
           nitroferrum 2002]
 gi|224601391|gb|EEG07572.1| lipopolysaccharide transport periplasmic protein LptA [Lutiella
           nitroferrum 2002]
          Length = 173

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 58/166 (34%), Gaps = 11/166 (6%)

Query: 19  FVLLKADLS-QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           F L  A L+   +A+     K   ++ I I A+   +        ++GNV +TQ    + 
Sbjct: 5   FTLTLAVLAGLCSATAALAEKADQSKPIEINANSGTLDQLKGHTVWEGNVVVTQGTLRVN 64

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRAD 136
           AD++ +  ++          ++   R       E     AS           VL G+   
Sbjct: 65  ADRVVVTRDDKGNQTVQATGKVVTFRQKMDGKDEYIEGQASRLDYTGITNTAVLTGNAR- 123

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGC-----ESDQVQSIIRY 177
              +K   +  +G  +  N  +    ++G         ++  I++ 
Sbjct: 124 ---VKRGEDLVIGDVITYNTQSQTYQVKGGAATGPNKGRITVILQP 166


>gi|23501067|ref|NP_697194.1| hypothetical protein BR0156 [Brucella suis 1330]
 gi|62289132|ref|YP_220925.1| hypothetical protein BruAb1_0152 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699071|ref|YP_413645.1| OstA-like protein [Brucella melitensis biovar Abortus 2308]
 gi|161618144|ref|YP_001592031.1| hypothetical protein BCAN_A0161 [Brucella canis ATCC 23365]
 gi|254690460|ref|ZP_05153714.1| OstA-like protein [Brucella abortus bv. 6 str. 870]
 gi|254694949|ref|ZP_05156777.1| OstA-like protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696580|ref|ZP_05158408.1| OstA-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254705335|ref|ZP_05167163.1| OstA-like protein [Brucella suis bv. 3 str. 686]
 gi|254707152|ref|ZP_05168980.1| OstA-like protein [Brucella pinnipedialis M163/99/10]
 gi|254709305|ref|ZP_05171116.1| OstA-like protein [Brucella pinnipedialis B2/94]
 gi|254713272|ref|ZP_05175083.1| OstA-like protein [Brucella ceti M644/93/1]
 gi|254716375|ref|ZP_05178186.1| OstA-like protein [Brucella ceti M13/05/1]
 gi|254731493|ref|ZP_05190071.1| OstA-like protein [Brucella abortus bv. 4 str. 292]
 gi|256030828|ref|ZP_05444442.1| OstA-like protein [Brucella pinnipedialis M292/94/1]
 gi|256060298|ref|ZP_05450471.1| OstA-like protein [Brucella neotomae 5K33]
 gi|256158853|ref|ZP_05456710.1| OstA-like protein [Brucella ceti M490/95/1]
 gi|256254234|ref|ZP_05459770.1| OstA-like protein [Brucella ceti B1/94]
 gi|256258716|ref|ZP_05464252.1| OstA-like protein [Brucella abortus bv. 9 str. C68]
 gi|256368620|ref|YP_003106126.1| hypothetical protein BMI_I159 [Brucella microti CCM 4915]
 gi|260169732|ref|ZP_05756543.1| OstA-like protein [Brucella sp. F5/99]
 gi|260885032|ref|ZP_05896646.1| OstA family protein [Brucella abortus bv. 9 str. C68]
 gi|261221383|ref|ZP_05935664.1| OstA family protein [Brucella ceti B1/94]
 gi|261324270|ref|ZP_05963467.1| OstA family protein [Brucella neotomae 5K33]
 gi|265987883|ref|ZP_06100440.1| OstA family protein [Brucella pinnipedialis M292/94/1]
 gi|265997344|ref|ZP_06109901.1| OstA family protein [Brucella ceti M490/95/1]
 gi|23346935|gb|AAN29109.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195264|gb|AAX73564.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615172|emb|CAJ10111.1| OstA-like protein [Brucella melitensis biovar Abortus 2308]
 gi|161334955|gb|ABX61260.1| hypothetical protein BCAN_A0161 [Brucella canis ATCC 23365]
 gi|255998778|gb|ACU47177.1| hypothetical protein BMI_I159 [Brucella microti CCM 4915]
 gi|260874560|gb|EEX81629.1| OstA family protein [Brucella abortus bv. 9 str. C68]
 gi|260919967|gb|EEX86620.1| OstA family protein [Brucella ceti B1/94]
 gi|261300250|gb|EEY03747.1| OstA family protein [Brucella neotomae 5K33]
 gi|262551812|gb|EEZ07802.1| OstA family protein [Brucella ceti M490/95/1]
 gi|264660080|gb|EEZ30341.1| OstA family protein [Brucella pinnipedialis M292/94/1]
          Length = 204

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 84

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 194


>gi|288942543|ref|YP_003444783.1| lipopolysaccharide transport periplasmic protein LptA
           [Allochromatium vinosum DSM 180]
 gi|288897915|gb|ADC63751.1| lipopolysaccharide transport periplasmic protein LptA
           [Allochromatium vinosum DSM 180]
          Length = 166

 Score = 93.5 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 57/149 (38%), Gaps = 8/149 (5%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           ++    +    + I+I+AD +EV +A   + + G+V + Q    L AD +T+ +    + 
Sbjct: 22  THAWALEADARQPIYIEADEVEVNEANSTSVYVGHVQVDQGSMRLLADHVTVYHREDRQP 81

Query: 92  VSNKINRMDVERNI--FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                               GE+   A     D  K  L L G+     +L +  +   G
Sbjct: 82  RLIIALGQPARYKQLLDDDQGEVQAFAKRMEYDADKDELALIGEG----LLIQGEDRLTG 137

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +++ +     A  +   + +V+  I  D
Sbjct: 138 ERILYDRA--KARFRAGGAGRVKITITPD 164


>gi|319776610|ref|YP_004139098.1| hypothetical protein HICON_01500 [Haemophilus influenzae F3047]
 gi|319897384|ref|YP_004135581.1| hypothetical protein HIBPF11260 [Haemophilus influenzae F3031]
 gi|317432890|emb|CBY81256.1| conserved hypothetical protein [Haemophilus influenzae F3031]
 gi|317451201|emb|CBY87434.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 172

 Score = 93.1 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKGDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIIIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    ++  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQKLDNGTPVDGKANKVHYDLGSEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|257092275|ref|YP_003165916.1| lipopolysaccharide transport periplasmic protein LptA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257044799|gb|ACV33987.1| lipopolysaccharide transport periplasmic protein LptA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 207

 Score = 93.1 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 53/177 (29%), Gaps = 17/177 (9%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
            +     + L    +      +   ++ IH++AD + + D  +    +GNV M Q    L
Sbjct: 4   TLCCACASSLLIVLSLPAQAERADRDKPIHLEADRMSIDDIKKVKTLEGNVVMIQGTLEL 63

Query: 77  QADKMTIDYNNTNRDV----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           + +++ +  +                    +        +   A     D +  +     
Sbjct: 64  RTNRLVVTDDADGFQKGVATGGANGLARFRQKREGVDEWMEGEAERIEHDARSEVTQFF- 122

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFA---------SLQGCESDQVQSIIRYDGR 180
               +  ++   +   G  +  +               +  G    +V++II+   +
Sbjct: 123 ---IRAWVQSGADEVRGPYISYDALNEKYAVNSGGATKTATGAAQARVRAIIQPKSK 176


>gi|145633121|ref|ZP_01788853.1| hypothetical protein CGSHi3655_06149 [Haemophilus influenzae 3655]
 gi|229844896|ref|ZP_04465034.1| hypothetical protein CGSHi6P18H1_01641 [Haemophilus influenzae
           6P18H1]
 gi|144986347|gb|EDJ92926.1| hypothetical protein CGSHi3655_06149 [Haemophilus influenzae 3655]
 gi|229812277|gb|EEP47968.1| hypothetical protein CGSHi6P18H1_01641 [Haemophilus influenzae
           6P18H1]
 gi|301169889|emb|CBW29493.1| predicted transporter subunit: periplasmic-binding component of ABC
           superfamily [Haemophilus influenzae 10810]
          Length = 172

 Score = 93.1 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIVIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    I+  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGTPIDGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|104780311|ref|YP_606809.1| hypothetical protein PSEEN1095 [Pseudomonas entomophila L48]
 gi|95109298|emb|CAK13995.1| conserved hypothetical protein; OstA family [Pseudomonas
           entomophila L48]
          Length = 174

 Score = 93.1 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 66/177 (37%), Gaps = 13/177 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L+  + +LL   ++  +AS         ++ I I+AD   + D    A + G+V +TQ
Sbjct: 1   MRLVKTIPLLLSLGVALGSASAF-ALPNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI---QSGEINVIASNGYVDFQKRIL 128
               ++ + +T+    +                      +  ++   A       QK ++
Sbjct: 60  GSMMIKGNTVTMTRAASGDIDVVTSVGNLAYFEQQQSAAKPDKMKGWAVTIQYQAQKDMV 119

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-----DQVQSIIRYDGR 180
           +L         ++ + NT  G K++ N  T  A+     +      ++  +I+   +
Sbjct: 120 ILTDRAK----VENEGNTTEGEKIVYNTKTQVATAGRGGNVTAPRQRIDMVIQPKKK 172


>gi|254700965|ref|ZP_05162793.1| OstA-like protein [Brucella suis bv. 5 str. 513]
          Length = 204

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A ++T+ 
Sbjct: 25  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQITVY 84

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 85  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 144

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 145 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 194


>gi|88811871|ref|ZP_01127124.1| OstA-like protein [Nitrococcus mobilis Nb-231]
 gi|88790755|gb|EAR21869.1| OstA-like protein [Nitrococcus mobilis Nb-231]
          Length = 189

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 62/172 (36%), Gaps = 11/172 (6%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L+  ++      A  S  T      ++ I + A+  E+ +    + ++G+V +TQ    
Sbjct: 14  LLITAMIALLALLAPCSSSTARDSDRDQPIKLSANQAEIDNVKGVSVYRGDVVLTQGTLR 73

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           +  + M I Y       S  ++ + VE +           +   +    +      G R 
Sbjct: 74  ITGEIMHIYYAPD----SRALDHIIVEGDPASYRELPEGESEYVHAKAPRMEYYETGPRR 129

Query: 136 DK----VILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRYDGRP 181
            +      L +  NTF G +++ +I+         +    ++   I  + RP
Sbjct: 130 IRLLQGATLWQGSNTFRGNQVVYDIEADQVEAHSGKDKTKRIHITIYPN-RP 180


>gi|303256247|ref|ZP_07342263.1| lipopolysaccharide transport periplasmic protein LptA
           [Burkholderiales bacterium 1_1_47]
 gi|302860976|gb|EFL84051.1| lipopolysaccharide transport periplasmic protein LptA
           [Burkholderiales bacterium 1_1_47]
          Length = 197

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 64/190 (33%), Gaps = 24/190 (12%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL + F      LS   A           + I I +D  +  D  Q A + G+V + Q
Sbjct: 1   MKLLPIWFFCALGLLSFGTA---HAETADSEQPIQIFSDKFDGDDVKQVAIYTGDVAVHQ 57

Query: 72  EDFSLQADKMTIDYNNTNRD--------VSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
               +  +K+ +  +                   +   ++        ++        D 
Sbjct: 58  GTLEIHGNKLVLTVDPQGYRHAVMTPLKGKLVTFKQRRDQKTPGVEEWMHGKGDELTYDE 117

Query: 124 QKRILVLNGDRADKVILKEK--LNTFLGCKLIVNIDTSFASLQG----CESDQVQSIIRY 177
           ++ +L+L   RA+    +     +   G K+  N+  S A + G      S +V ++I  
Sbjct: 118 KRNVLILT-HRAEVARSENGVLKDESKGDKITYNLTNSTAIIDGNKAKGPSGRVSTVIAP 176

Query: 178 D------GRP 181
                  G+P
Sbjct: 177 RDSNMDAGKP 186


>gi|294851556|ref|ZP_06792229.1| hypothetical protein BAZG_00464 [Brucella sp. NVSL 07-0026]
 gi|294820145|gb|EFG37144.1| hypothetical protein BAZG_00464 [Brucella sp. NVSL 07-0026]
          Length = 218

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/173 (27%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + I I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPIKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ IN +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGAEAPEPANAGVGGIGSSSINHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 208


>gi|260563229|ref|ZP_05833715.1| OstA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|265999666|ref|ZP_05467330.2| OstA family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260153245|gb|EEW88337.1| OstA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|263095209|gb|EEZ18878.1| OstA family protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 216

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I  +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 206


>gi|68249698|ref|YP_248810.1| hypothetical protein NTHI1317 [Haemophilus influenzae 86-028NP]
 gi|68057897|gb|AAX88150.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
          Length = 172

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKDDVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGSIIIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    I+  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGTPIDGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|326408178|gb|ADZ65243.1| OstA-like protein [Brucella melitensis M28]
 gi|326537891|gb|ADZ86106.1| OstA-like protein [Brucella melitensis M5-90]
          Length = 218

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I  +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGAEAPEPANAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 208


>gi|253701986|ref|YP_003023175.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M21]
 gi|251776836|gb|ACT19417.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. M21]
          Length = 162

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 63/143 (44%), Gaps = 8/143 (5%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
            + GNE + +K+D L   +  + A F+G V   Q + +L  D++ +          N+++
Sbjct: 22  PISGNEPLKVKSDNLTADNEKKTATFEGKVVAHQGELTLYTDRLVVSSAGD----GNELS 77

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +++   N+ I  G       +   D ++ +++L+G+    V             +   I+
Sbjct: 78  KVEAFGNVRILQGNRQATGGHAVYDPKRGVILLDGNPRVVVGDDVVTGKV----ITYFIN 133

Query: 158 TSFASLQGCESDQVQSIIRYDGR 180
              + + G   ++V+++I   G+
Sbjct: 134 EQRSVVTGGPKERVEAVIHPGGK 156


>gi|260567206|ref|ZP_05837676.1| OstA family protein [Brucella suis bv. 4 str. 40]
 gi|261756046|ref|ZP_05999755.1| OstA family protein [Brucella suis bv. 3 str. 686]
 gi|260156724|gb|EEW91804.1| OstA family protein [Brucella suis bv. 4 str. 40]
 gi|261745799|gb|EEY33725.1| OstA family protein [Brucella suis bv. 3 str. 686]
          Length = 216

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 206


>gi|306839603|ref|ZP_07472407.1| OstA-like protein [Brucella sp. NF 2653]
 gi|306405301|gb|EFM61576.1| OstA-like protein [Brucella sp. NF 2653]
          Length = 216

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTRGRVSIIMAPKDQ 206


>gi|265983333|ref|ZP_06096068.1| OstA family protein [Brucella sp. 83/13]
 gi|264661925|gb|EEZ32186.1| OstA family protein [Brucella sp. 83/13]
          Length = 218

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTRGRVSIIMAPKDQ 208


>gi|257454874|ref|ZP_05620125.1| lipopolysaccharide transport periplasmic protein LptA
           [Enhydrobacter aerosaccus SK60]
 gi|257447807|gb|EEV22799.1| lipopolysaccharide transport periplasmic protein LptA
           [Enhydrobacter aerosaccus SK60]
          Length = 179

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 52/151 (34%), Gaps = 6/151 (3%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           AA++         NE I + AD     +      + GNV +TQ    + AD +T++   T
Sbjct: 22  AASNVANALPSDANEPIRLLADKATYSERSGVTSYTGNVTITQGTLKMAADNLTVNLTPT 81

Query: 89  NRDVSNKINRMDVERNI--FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
               S                + G     A+    + +  ++ L G+      L +   +
Sbjct: 82  RAIESAVATGRPATIQQIVTQEKGLAKGQANRIDYNVKTGLVTLTGNAR----LTQNGGS 137

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           F G  +  ++       +   + +V+ +   
Sbjct: 138 FSGNVIHYSLKVGDIEAKAGNNQRVELVFPP 168


>gi|222084665|ref|YP_002543194.1| cell envelope biogenesis protein YhbN [Agrobacterium radiobacter
           K84]
 gi|221722113|gb|ACM25269.1| cell envelope biogenesis protein YhbN [Agrobacterium radiobacter
           K84]
          Length = 222

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 32/185 (17%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             AD      S M    +  ++ I I++D LE+ DA  +A F GNV + Q   ++QA KM
Sbjct: 32  PGADAQTTTTSKMPGLALSSDQPIQIESDKLEIHDAESQAVFTGNVKVVQGTTTMQAGKM 91

Query: 82  TIDY--------------------------NNTNRDVSNKINRMDVERNIFIQSGEINVI 115
           T+ Y                          N +       I+ + V   +++ SG     
Sbjct: 92  TVFYKKKQPAADAAAKPATDNPVAKAAKEQNQSLVSGDANIDHILVTNKVYLVSGTQTAT 151

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           A +G  D   ++ VL G    KV+L +  N F GC+L V++ T  A L  C   +VQ  I
Sbjct: 152 ADDGSFDMANQLAVLKG---QKVVLTDGPNVFTGCQLTVHMATGEAQLDAC-GGRVQ--I 205

Query: 176 RYDGR 180
           + D +
Sbjct: 206 QLDPK 210


>gi|295691422|ref|YP_003595115.1| OstA family protein [Caulobacter segnis ATCC 21756]
 gi|295433325|gb|ADG12497.1| OstA family protein [Caulobacter segnis ATCC 21756]
          Length = 187

 Score = 92.7 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 63/158 (39%), Gaps = 11/158 (6%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID--YN 86
            AA      +   +  I + A+  E  ++     F+GNV + Q+   ++A ++T+     
Sbjct: 18  GAAGVAHAQQGDSSAPIDVSANQQETINSKCITIFRGNVEILQDRSRMRAQQVTVYSAKR 77

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
             +        R++ E ++++ S             F     VL GD    VIL +  + 
Sbjct: 78  AGSESGCGNAQRLEAEGDVYVVSENQKARGDRAVYTFSDNTAVLTGD----VILTKGKDV 133

Query: 147 FLGCKLIVNIDTSFASLQGCESD-----QVQSIIRYDG 179
             G +L VN  T+ A L+   +      +V+++   D 
Sbjct: 134 ARGDRLTVNTKTNDAKLESNATGRGSARRVRAVFYQDD 171


>gi|306842557|ref|ZP_07475208.1| OstA-like protein [Brucella sp. BO2]
 gi|306287413|gb|EFM58893.1| OstA-like protein [Brucella sp. BO2]
          Length = 218

 Score = 92.3 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 208


>gi|306844424|ref|ZP_07477014.1| OstA-like protein [Brucella sp. BO1]
 gi|306275237|gb|EFM56987.1| OstA-like protein [Brucella sp. BO1]
          Length = 216

 Score = 92.3 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGDEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 206


>gi|260546430|ref|ZP_05822170.1| OstA family protein [Brucella abortus NCTC 8038]
 gi|260759236|ref|ZP_05871584.1| OstA family protein [Brucella abortus bv. 4 str. 292]
 gi|260760958|ref|ZP_05873301.1| OstA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261215288|ref|ZP_05929569.1| OstA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218157|ref|ZP_05932438.1| OstA family protein [Brucella ceti M13/05/1]
 gi|261314630|ref|ZP_05953827.1| OstA family protein [Brucella pinnipedialis M163/99/10]
 gi|261316814|ref|ZP_05956011.1| OstA family protein [Brucella pinnipedialis B2/94]
 gi|261759270|ref|ZP_06002979.1| OstA family protein [Brucella sp. F5/99]
 gi|260096537|gb|EEW80413.1| OstA family protein [Brucella abortus NCTC 8038]
 gi|260669554|gb|EEX56494.1| OstA family protein [Brucella abortus bv. 4 str. 292]
 gi|260671390|gb|EEX58211.1| OstA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260916895|gb|EEX83756.1| OstA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|260923246|gb|EEX89814.1| OstA family protein [Brucella ceti M13/05/1]
 gi|261296037|gb|EEX99533.1| OstA family protein [Brucella pinnipedialis B2/94]
 gi|261303656|gb|EEY07153.1| OstA family protein [Brucella pinnipedialis M163/99/10]
 gi|261739254|gb|EEY27250.1| OstA family protein [Brucella sp. F5/99]
          Length = 216

 Score = 92.3 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 206


>gi|189023408|ref|YP_001934176.1| OstA-like protein [Brucella abortus S19]
 gi|225626695|ref|ZP_03784734.1| OstA-like protein [Brucella ceti str. Cudo]
 gi|237814626|ref|ZP_04593624.1| OstA-like protein [Brucella abortus str. 2308 A]
 gi|260756012|ref|ZP_05868360.1| OstA family protein [Brucella abortus bv. 6 str. 870]
 gi|261320995|ref|ZP_05960192.1| OstA family protein [Brucella ceti M644/93/1]
 gi|297247548|ref|ZP_06931266.1| hypothetical protein BAYG_00459 [Brucella abortus bv. 5 str. B3196]
 gi|189018980|gb|ACD71702.1| OstA-like protein [Brucella abortus S19]
 gi|225618352|gb|EEH15395.1| OstA-like protein [Brucella ceti str. Cudo]
 gi|237789463|gb|EEP63673.1| OstA-like protein [Brucella abortus str. 2308 A]
 gi|260676120|gb|EEX62941.1| OstA family protein [Brucella abortus bv. 6 str. 870]
 gi|261293685|gb|EEX97181.1| OstA family protein [Brucella ceti M644/93/1]
 gi|297174717|gb|EFH34064.1| hypothetical protein BAYG_00459 [Brucella abortus bv. 5 str. B3196]
          Length = 218

 Score = 92.3 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 39  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 98

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 99  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 158

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 159 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 208


>gi|148559284|ref|YP_001258189.1| hypothetical protein BOV_0151 [Brucella ovis ATCC 25840]
 gi|148370541|gb|ABQ60520.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 216

 Score = 92.3 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A +MT+ 
Sbjct: 37  AQQAGDGSVPGLKFSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 206


>gi|326560124|gb|EGE10514.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 46P47B1]
 gi|326565403|gb|EGE15580.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 103P14B1]
 gi|326573391|gb|EGE23359.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 101P30B1]
 gi|326577178|gb|EGE27072.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis O35E]
          Length = 175

 Score = 92.3 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 65/183 (35%), Gaps = 20/183 (10%)

Query: 1   MSA-FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQ 59
           M A F+ + +L++  +  + ++                    N+ I + AD     +   
Sbjct: 1   MKADFVITKYLFLSCIVSIPMIAS------------ALPSDTNQPIRLLADRATYSERTG 48

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIA 116
              + G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A
Sbjct: 49  VTTYSGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGQPATIQQVVTQEKGLAKGQA 108

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +    +    I+ L G+      L +  ++F G  +  ++             +V+ +  
Sbjct: 109 NRIDYNAVSGIVTLTGNAK----LTQAGSSFSGNTIRYSLSVGDVEANAGGGQRVELVFP 164

Query: 177 YDG 179
              
Sbjct: 165 PSD 167


>gi|85058179|ref|YP_453881.1| hypothetical protein SG0201 [Sodalis glossinidius str. 'morsitans']
 gi|84778699|dbj|BAE73476.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 187

 Score = 92.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/140 (13%), Positives = 46/140 (32%), Gaps = 6/140 (4%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKIN 97
              + IHI +    V  A     F G V + +    ++ADK+ I         +V     
Sbjct: 38  DNQQPIHIDSAQQAVDMATNTVTFTGEVVVKRGSIDIRADKVVITRPDGKDGNEVVESYG 97

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
                  +      +   +     +    +++L G+      L++  +   G ++   + 
Sbjct: 98  NPVTFYQLQDDGKPVRGHSQKVRYETTNDLVILTGNAY----LEQLDSNVKGDRITYLVK 153

Query: 158 TSFASLQGCESDQVQSIIRY 177
                +   +  QV +++  
Sbjct: 154 KQRMEVFSDKGKQVTTVLVP 173


>gi|261751483|ref|ZP_05995192.1| OstA family protein [Brucella suis bv. 5 str. 513]
 gi|261741236|gb|EEY29162.1| OstA family protein [Brucella suis bv. 5 str. 513]
          Length = 216

 Score = 92.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 26  LSQAAASYMTRFK-VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             QA    +   K     + + I AD LE++D    A F GNV ++Q D  L+A ++T+ 
Sbjct: 37  AQQAGDGSVPGLKLSNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQITVY 96

Query: 85  YNNTNR--------------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Y+   +                S+ I+ +D+   ++++SG        G  D + +I+VL
Sbjct: 97  YSKAKKGAEAPEPANAGVGGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVL 156

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
            G    KV+L +  N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 157 QG---QKVVLTDGDNIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 206


>gi|145641261|ref|ZP_01796841.1| hypothetical protein CGSHiR3021_05649 [Haemophilus influenzae
           R3021]
 gi|145274098|gb|EDK13964.1| hypothetical protein CGSHiR3021_05649 [Haemophilus influenzae
           22.4-21]
          Length = 172

 Score = 92.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+   +S     K   N+ I+I +D   +        F  NV +TQ    ++
Sbjct: 8   ILFLATMVLA---SSSAFALKDDVNQPINIISDNQSLDMEKSVVTFTDNVVITQGSIIIK 64

Query: 78  ADKMTIDY---NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           A+K+ I      +  ++                    ++  A+  + D     L L  + 
Sbjct: 65  ANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGTPVDGKANKVHYDLGNEFLTLTNNA 124

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                LK+  +   G  +  ++        G    +V +++   
Sbjct: 125 E----LKQLDSKINGSVITYDVKKQQLKANGNGKSRVTTVLIPS 164


>gi|163784675|ref|ZP_02179499.1| hypothetical protein HG1285_12282 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880057|gb|EDP73737.1| hypothetical protein HG1285_12282 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 164

 Score = 91.9 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 16/165 (9%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           LL +V +L     +Q  ++   +        I I+AD  E  +  + A +K NV + + D
Sbjct: 5   LLMVVLLLTSFLYAQTESNEKNKV------PIVIEADSFEYDNKQKIAVYKDNVIVRKGD 58

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
           F+L ++ M + ++       +KI  +  E N+  + G     A+ G  +  K I+ L G+
Sbjct: 59  FTLWSNLMRVYFDEN-----SKIKEIIAEGNVKFEKGLYKGKANKGIYNANKEIIRLIGN 113

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                ++K+K N   G ++I  +    A + G ++ +V++II  +
Sbjct: 114 A----MVKKKSNILEGDEIIYYMKEDKAVVIG-KNKKVRTIIVPE 153


>gi|331001308|ref|ZP_08324934.1| lipopolysaccharide transport periplasmic protein LptA
           [Parasutterella excrementihominis YIT 11859]
 gi|329569035|gb|EGG50831.1| lipopolysaccharide transport periplasmic protein LptA
           [Parasutterella excrementihominis YIT 11859]
          Length = 197

 Score = 91.9 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 65/190 (34%), Gaps = 24/190 (12%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + LL + F      LS   A           + I I +D  +  D  Q A + G+V + Q
Sbjct: 1   MKLLPIWFFCALGLLSFGTA---HAETADSEQPIQIFSDKFDGDDVKQVAIYTGDVAVHQ 57

Query: 72  EDFSLQADKMTIDYNNTNRD--------VSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
               +  +K+ +  +                   +   ++        ++   +    D 
Sbjct: 58  GTLEIHGNKLVLTVDPQGYRHAVMTPLKGKLVTFKQRRDQKTPGVEEWMHGKGNELTYDE 117

Query: 124 QKRILVLNGDRADKVILKEK--LNTFLGCKLIVNIDTSFASLQG----CESDQVQSIIRY 177
           ++ +L+L   RA+    +     +   G K+  N+  S A + G      S +V ++I  
Sbjct: 118 KRNVLILT-HRAEVARSENGVLKDESKGDKITYNLTNSTAIIDGNKAKGPSGRVSTVIAP 176

Query: 178 D------GRP 181
                  G+P
Sbjct: 177 RDSNMDAGKP 186


>gi|17988074|ref|NP_540708.1| periplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|17983824|gb|AAL52972.1| hypothetical periplasmic protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 172

 Score = 91.9 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 75/159 (47%), Gaps = 20/159 (12%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR-------- 90
               + + I AD LE++D    A F GNV ++Q D  L+A +MT+ Y+   +        
Sbjct: 7   SNSKDPVKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPA 66

Query: 91  ------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                   S+ I  +D+   ++++SG        G  D + +I+VL G    KV+L +  
Sbjct: 67  NAGVGGIGSSSIEHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQG---QKVVLTDGD 123

Query: 145 NTFLGCKLIVNIDTSFASLQGCES---DQVQSIIRYDGR 180
           N   GCKL  ++DT  A+++ C+     +V  I+    +
Sbjct: 124 NIVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQ 162


>gi|319639071|ref|ZP_07993828.1| hypothetical protein HMPREF0604_01452 [Neisseria mucosa C102]
 gi|317399649|gb|EFV80313.1| hypothetical protein HMPREF0604_01452 [Neisseria mucosa C102]
          Length = 176

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 60/167 (35%), Gaps = 14/167 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A ++  AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +
Sbjct: 8   TLALVAVFAASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSV 67

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           T+  N+ +  +                  G +N  A+         ++ L+G+      +
Sbjct: 68  TVSRNDKSEQLMKATGSPVKFSQELDGGKGVVNGQANTVTYSSAANLVTLSGNAK----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGC---------ESDQVQSIIRYD 178
           +   +   G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTINGSAKSGVKSAAKSGRVSVVIQPS 170


>gi|15838011|ref|NP_298699.1| hypothetical protein XF1410 [Xylella fastidiosa 9a5c]
 gi|9106422|gb|AAF84219.1|AE003972_4 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 176

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 62/165 (37%), Gaps = 12/165 (7%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDF 74
             +F LL A LS AA S         N+ + I +   E       KA + GNV + Q   
Sbjct: 9   FFLFPLLFAPLSAAAKS------SDRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSL 62

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
              AD   +   N + D    I +    +        ++  A N     ++ I++L G+ 
Sbjct: 63  EAHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
                ++       G ++I N  T      G +  +V++ I+  G
Sbjct: 123 K----VESPKGNNTGQRMIYNTQTGDMR-SGNDGTRVRTTIQPKG 162


>gi|304386603|ref|ZP_07368891.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate binding protein [Neisseria
           meningitidis ATCC 13091]
 gi|304339432|gb|EFM05504.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, substrate binding protein [Neisseria
           meningitidis ATCC 13091]
          Length = 176

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 61/164 (37%), Gaps = 14/164 (8%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
            ++  +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ + 
Sbjct: 11  LIAFFSASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVT 70

Query: 85  YN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            N    + +    + +   + +    G +   A+N         +VL G+      ++  
Sbjct: 71  RNGKGEQFMKADGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----VQRG 126

Query: 144 LNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
            +   G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 127 GDVAEGAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVVIQPS 170


>gi|291612909|ref|YP_003523066.1| lipopolysaccharide transport periplasmic protein LptA [Sideroxydans
           lithotrophicus ES-1]
 gi|291583021|gb|ADE10679.1| lipopolysaccharide transport periplasmic protein LptA [Sideroxydans
           lithotrophicus ES-1]
          Length = 195

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 59/169 (34%), Gaps = 12/169 (7%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
             L + L     +         ++ IH+++D + + DA Q + F+G V +TQ    +QA+
Sbjct: 8   AALCSLLLMGWNNLALAEHADRDKPIHVESDRVVIDDAKQTSVFEGQVELTQGTLFIQAE 67

Query: 80  KMTIDYNN-TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           K+ +  +   N+  +   +  +  +        +         D +   +   G      
Sbjct: 68  KIVLTQDKLGNKHCTATGSPANFRQKHEGTDQYMEGYGDRIEYDTRTETVDFFGHAR--- 124

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCE-------SDQVQSIIRYDGR 180
            +K   +   G  +  +  T    + G           +  ++I+   +
Sbjct: 125 -VKRDQDDVQGDHIAYSTRTEVFEVSGDPTRLNDPDKGRAHAVIQPKAK 172


>gi|307824374|ref|ZP_07654600.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylobacter tundripaludum SV96]
 gi|307734754|gb|EFO05605.1| lipopolysaccharide transport periplasmic protein LptA
           [Methylobacter tundripaludum SV96]
          Length = 184

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 64/183 (34%), Gaps = 12/183 (6%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N +   +   +   +LL A  S  A       +  G++ I I ++     D    
Sbjct: 1   MKQNKN-LRCRMLRGSGCCLLLLALYSAGAY----ALESDGDQPIIIDSNTATYDDVKAT 55

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN-IFIQSGEINVIASNG 119
           + + GNV   Q    + +DK+ + + +   D       +   +        +I   A  G
Sbjct: 56  STYTGNVISIQGSIRVNSDKLVVYFIDGEADKMVFTGNLAKFKQTPNEGDQDITGEALTG 115

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL--QGCESDQVQSIIRY 177
               +K +L+L     DK  + +    +    +  ++ TS      +     +V  +++ 
Sbjct: 116 EYYPKKNLLILI----DKATVWQGSGAYSSDLIEYDLKTSLVKAGEKESAGKRVHVVLQP 171

Query: 178 DGR 180
             +
Sbjct: 172 KAK 174


>gi|261391880|emb|CAX49339.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           8013]
          Length = 176

 Score = 91.9 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/167 (16%), Positives = 62/167 (37%), Gaps = 14/167 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L   ++  +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++
Sbjct: 8   LFVLIAFFSASPAFALQGDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARV 67

Query: 82  TIDY-NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
            +   +   + +    + +   + +    G +   A+N         +VL G+      +
Sbjct: 68  NVTRNDKGEQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAR----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           +   +   G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVVIQPS 170


>gi|119505154|ref|ZP_01627230.1| possible OstA-like protein [marine gamma proteobacterium HTCC2080]
 gi|119459136|gb|EAW40235.1| possible OstA-like protein [marine gamma proteobacterium HTCC2080]
          Length = 182

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 61/183 (33%), Gaps = 19/183 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
             +   L+  LL L+ + L A LSQ             ++ I I AD     +   +  +
Sbjct: 1   MRSRNDLWARLLVLLSMTLIASLSQ-------ALPSDRDQPIKITADSAVRNEQTGETRY 53

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG--EINVIASNGYV 121
           +G+V +TQ    ++AD +T+  N+   D                Q G   I   A     
Sbjct: 54  EGSVELTQGSLHIEADLLTLYQNDGAADGLITATGTPATLQQTPQEGKAPIKAAAHRIAY 113

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE------SDQVQSII 175
           D +   + L  +      +++      G  +   +     +    +        +V+ II
Sbjct: 114 DQKGDKVTLTENAR----IEQDGAIVTGATIDYVLSQQRVTANSDQTTGQGTGQRVEMII 169

Query: 176 RYD 178
              
Sbjct: 170 PPS 172



 Score = 36.8 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 6/89 (6%), Positives = 20/89 (22%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +    + + +    G   I   A  +       K     N  + Q+   +    +    +
Sbjct: 86  ATGTPATLQQTPQEGKAPIKAAAHRIAYDQKGDKVTLTENARIEQDGAIVTGATIDYVLS 145

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVI 115
                 ++                  + +
Sbjct: 146 QQRVTANSDQTTGQGTGQRVEMIIPPSAM 174


>gi|255066043|ref|ZP_05317898.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sicca ATCC 29256]
 gi|261365378|ref|ZP_05978261.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           mucosa ATCC 25996]
 gi|255049588|gb|EET45052.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sicca ATCC 29256]
 gi|288566174|gb|EFC87734.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           mucosa ATCC 25996]
          Length = 176

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 54/167 (32%), Gaps = 14/167 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                +  A +     +    + I I+AD   +    Q   F GNV + Q   +++A  +
Sbjct: 8   ACVLTAFFATAPAYALQSDSKQPIQIEADQGSLDQNNQSTTFTGNVIIKQGTLNIRAGSV 67

Query: 82  TIDYNNTNRDVSNKINRMDVERNI-FIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
            +  N+                       G +N  A+N        ++ L G+      +
Sbjct: 68  NVSRNDKGEQFMKASGSPVRFSQTLDDNKGTVNGQANNVTYSSAINLVTLTGNAK----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGC---------ESDQVQSIIRYD 178
           +   +   G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTINGSSKTGAKSAAKSGRVSVVIQPS 170


>gi|53804951|ref|YP_113246.1| hypothetical protein MCA0743 [Methylococcus capsulatus str. Bath]
 gi|53758712|gb|AAU93003.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 177

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 58/168 (34%), Gaps = 10/168 (5%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L    L+               + I+I+AD     +A  +  + G+V  TQ    + +D
Sbjct: 13  TLGTLALACLWPGLTFGLSSDAKQPIYIEADTATYDEATGQTVYVGHVRSTQGSLIVDSD 72

Query: 80  KMTIDYNNTNRDVSNKI-NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
           KM +       +      N + +++       +I+          +  IL+L     DK 
Sbjct: 73  KMIVYQKEGKTEKVVAWANPVRLKQTPDGGKEDIHGTGQRAEYFPETGILIL----YDKA 128

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQG--CESDQVQSIIRYD---GRP 181
           ++ +  ++    ++  +   +F           +V+  +      G+P
Sbjct: 129 VVWQGGDSTESDRIEYDSHKNFVKAGDPQSNKSRVRVKLAPKAEAGKP 176


>gi|225848796|ref|YP_002728960.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643365|gb|ACN98415.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 157

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 58/143 (40%), Gaps = 10/143 (6%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
                E + I AD LE  +  + A + GNV + + +F+L+AD + I  +         ++
Sbjct: 22  TENKKEPVVINADKLEYYNKEKVAVYSGNVDVKKGNFNLKADTVKIYLDEK-----GDVS 76

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R+    N++ Q       +        K +++L  +      + +  N   G ++   ID
Sbjct: 77  RIYAVGNVYFQQENKWGKSKEAEYYKDKNLIILKNNAE----VHQGKNVVEGDEIYYYID 132

Query: 158 TSFASLQGCESDQVQSIIRYDGR 180
              A     +  +V+S++    +
Sbjct: 133 EEKAVATS-KGSRVRSVLFPKEK 154


>gi|148652634|ref|YP_001279727.1| cell envelope biogenesis YhbN [Psychrobacter sp. PRwf-1]
 gi|148571718|gb|ABQ93777.1| Cell envelope biogenesis YhbN [Psychrobacter sp. PRwf-1]
          Length = 157

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 50/147 (34%), Gaps = 6/147 (4%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
                    + IH+ AD     +      + GNV +TQ    L AD +T++ +N+   +S
Sbjct: 6   ANALPSDAQQPIHLLADKATYSERTGVTSYSGNVTITQGTLKLAADNITVNLSNSRSILS 65

Query: 94  NKINRMDVERNI--FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
                           + G     A+    + Q  I+ L G+      L +   +F G  
Sbjct: 66  AVATGRPATMQQVVTKEKGLARGQANKIDYNAQNGIVTLTGNAK----LTQNGASFAGNV 121

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYD 178
           +  ++           S +V+ +    
Sbjct: 122 IRYSLKVGDVEATAGGSQRVELVFPPS 148


>gi|325205431|gb|ADZ00884.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M04-240196]
          Length = 176

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 62/167 (37%), Gaps = 14/167 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L   ++  ++S     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++
Sbjct: 8   LFVLIAFFSSSPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARV 67

Query: 82  TIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
            +  N    + +    + +   + +    G +   A+N         +VL G+      +
Sbjct: 68  NVTRNGKGEQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           +   +   G  +  N  T   ++ G          +S +V  II+  
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 170


>gi|121998903|ref|YP_001003690.1| OstA family protein [Halorhodospira halophila SL1]
 gi|121590308|gb|ABM62888.1| OstA family protein [Halorhodospira halophila SL1]
          Length = 175

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 17/142 (11%), Positives = 52/142 (36%), Gaps = 7/142 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           +  + ++AD ++V      + ++G+  +T+ +  +  D+M +  +         ++    
Sbjct: 35  DAPVELEADSVDVDAVAGVSVYEGDAVLTRGEMRITGDRMEVYTDEDGDLSHVYVDGTPA 94

Query: 102 ERNIFIQSGEINVIASNGYVDF---QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
                 ++    V A    +++           GD      L +  +      + V+++ 
Sbjct: 95  TYRDHPENQPRPVHAEAKRMEYYTRGPERAHFQGDAR----LWQGDDQVTAETIDVDLEG 150

Query: 159 SFASLQGCESDQVQSIIRYDGR 180
                +G E  + ++I+    R
Sbjct: 151 QIMKARGAEGQRARTILYPTRR 172


>gi|326575712|gb|EGE25635.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis CO72]
          Length = 175

 Score = 91.5 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 65/183 (35%), Gaps = 20/183 (10%)

Query: 1   MSA-FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQ 59
           M A F+ + +L++  +  + ++                    N+ I + AD     +   
Sbjct: 1   MKADFVITKYLFLSCIVSIPMIAS------------ALPSDTNQPIRLLADRATYSERTG 48

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIA 116
              + G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A
Sbjct: 49  VTTYSGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGQPATIQQVVTQEKGLAKGQA 108

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +    +    I+ L G+      L +  ++F G  +  ++             +V+ +  
Sbjct: 109 NRIDYNAVSGIVTLTGNAK----LTQAGSSFSGNTIRYSLSVGDIEANAGGGQRVELVFP 164

Query: 177 YDG 179
              
Sbjct: 165 PSD 167


>gi|56551172|ref|YP_162011.1| OstA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760849|ref|ZP_04758938.1| OstA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|56542746|gb|AAV88900.1| OstA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374468|gb|EER63929.1| OstA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 198

 Score = 91.5 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 69/190 (36%), Gaps = 19/190 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFK---VLGNEKIHIKADMLEVKDA 57
           M + L        L A    L    L     S ++         N  I I AD  EV   
Sbjct: 1   MYSGLKKYKPLPFLKAAALSLCGFTLILTPLSALSAQGFRHHDTNAPIDIDADHSEVLYN 60

Query: 58  VQKAFFKGNVFMTQEDFSLQADKMTIDY----NNTNRDVSNKINRMDVERNIFIQSGEIN 113
             +A + G+V   Q D ++ A  + I Y    N+   + S ++ R+D    + IQ+ +  
Sbjct: 61  DNRAIYSGHVRARQADMTITAAYVRIAYTMPKNSKTGEASPQMQRLDASGGVTIQTPDEM 120

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC------- 166
                   D  KR++ L G     V +    +   G +LI++++T   ++ G        
Sbjct: 121 AKGEIAIYDVPKRLVTLVG----HVEMVRGDSVVHGARLIIDLNTGKGTMDGSLVGSDGS 176

Query: 167 -ESDQVQSII 175
               +V    
Sbjct: 177 QGKGRVTGHF 186


>gi|149378028|ref|ZP_01895752.1| hypothetical protein MDG893_01465 [Marinobacter algicola DG893]
 gi|149357683|gb|EDM46181.1| hypothetical protein MDG893_01465 [Marinobacter algicola DG893]
          Length = 184

 Score = 91.5 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 61/167 (36%), Gaps = 11/167 (6%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            ++L   ++  A    T F +  ++ I + AD   + +    A + G+V M+Q D +L A
Sbjct: 1   MIVLALTMTMGAPFA-TAFDLESDQPIRVNADNARLDEGQGIATYTGSVEMSQGDANLMA 59

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNI-FIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           DK+ +  +                R       GE +  A           +        +
Sbjct: 60  DKVVLHRDENGVSRIEATGTPARYRQPAMEGQGETDARALTITWSASDNRVTF----RRE 115

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQ-----GCESDQVQSIIRYDG 179
            ++++  N F G  +  +      + +     G  S +V+ +I+  G
Sbjct: 116 AVIEQGGNLFRGDVIHYDSAERVVTAEGSADQGDGSGRVEMVIQPRG 162


>gi|262369716|ref|ZP_06063044.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315784|gb|EEY96823.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 197

 Score = 91.5 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 62/183 (33%), Gaps = 12/183 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N    +      +   L   L  A +++        ++ I + AD     +      + 
Sbjct: 10  MNHNPKFSISKTFLKQTLALSLGVAVSTFALALPSDRSKAISLVADRATFNEKTGVTTYT 69

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIA--SNGYVD 122
           GNV + Q    LQAD +  + N T +  +   N         + + +            +
Sbjct: 70  GNVIIEQGTMKLQADSIVANLNQTRQISTITANGKPARFQQQVSTNKGIAKGQAQKIIYN 129

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL------QGCESDQVQSIIR 176
            +  I+ L+G      +L++   +  G  L  +++             G  S +VQ +I 
Sbjct: 130 AETGIITLSGSA----LLEQDGASIRGNTLRYSMNKGDIEAIGTPNSSGSSSGRVQIVIP 185

Query: 177 YDG 179
             G
Sbjct: 186 PSG 188


>gi|238898999|ref|YP_002924681.1| hypothetical protein HDEF_1945 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466759|gb|ACQ68533.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 181

 Score = 91.5 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 52/178 (29%), Gaps = 16/178 (8%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
            +   IH  + L+ ++  L                    ++ + I +D   +        
Sbjct: 2   KYKKKIHK-LFLIGILLTLKFPAF---------GLTDDTDQPVIITSDKQSLDILNHTNT 51

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVERNIFIQSGEINVIASNGY 120
           +  NV + Q    + A K+ +   N +   +  +          +      +   +    
Sbjct: 52  YIDNVMIKQGSIKITASKVVVIRPNGDPQKTVVDGFGDPITFYQMQDNGKPLKGHSEKLR 111

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             F  ++LVL G+      L +  +     ++   I          +   V S+I   
Sbjct: 112 YTFSDKLLVLTGNAY----LDQLDSHIKADRITYLIPQKKMHAFSSKGKPVYSVILPS 165


>gi|118594084|ref|ZP_01551431.1| OstA-like protein [Methylophilales bacterium HTCC2181]
 gi|118439862|gb|EAV46489.1| OstA-like protein [Methylophilales bacterium HTCC2181]
          Length = 195

 Score = 91.5 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 68/191 (35%), Gaps = 20/191 (10%)

Query: 5   LNSIHLYIHLLAL---VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           ++S + Y  LL     +   L   ++   +++    K    + I I++D + + D    +
Sbjct: 6   MSSQNNYYLLLITPKKILSHLFLFVALLFSNHAKAEKGDREQPIEIESDTMTMDDTKNLS 65

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGY 120
            +KG+V +TQ    ++AD++ +  +N     S         +       E    I     
Sbjct: 66  IYKGDVILTQGTLIIKADELIVREDNQGFQHSTSTGNPTSFKQKREGVDEYIEGIGQRIE 125

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG------------CES 168
            D     + +  +     I+K   +T +G  +I + +   A                 + 
Sbjct: 126 YDGHMDKVHIYKNA----IVKRGNDTVMGDYIIYDANAEVAQAMSRQSNGSESSDVIKKK 181

Query: 169 DQVQSIIRYDG 179
            + ++II    
Sbjct: 182 SRTRAIINPKK 192


>gi|302877523|ref|YP_003846087.1| lipopolysaccharide transport periplasmic protein LptA [Gallionella
           capsiferriformans ES-2]
 gi|302580312|gb|ADL54323.1| lipopolysaccharide transport periplasmic protein LptA [Gallionella
           capsiferriformans ES-2]
          Length = 178

 Score = 91.5 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 57/176 (32%), Gaps = 16/176 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            ++ L+ +F+LL   +           +   ++ I I AD + V DA Q + F G+V +T
Sbjct: 1   MLNKLSFIFMLLAVSV------PCQAERADRDKPIDIDADQVIVDDAKQISTFTGHVILT 54

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDFQKRILV 129
           Q     + DK+ +  +                R       E           D +   + 
Sbjct: 55  QGTMVFRGDKIVVVQDKAGFQRGTAYGHTASFRQKREGLDEYVEGFGERIEYDTRADTV- 113

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-----DQVQSIIRYDGR 180
              D   +  +K   +   G  +  N  T         +      +V +++    +
Sbjct: 114 ---DFYIQARVKRAQDEVRGEHVTYNSKTEIFQADSKNAAAGTPGRVHAVLFPKSK 166


>gi|237809671|ref|YP_002894111.1| lipopolysaccharide transport periplasmic protein LptA [Tolumonas
           auensis DSM 9187]
 gi|237501932|gb|ACQ94525.1| lipopolysaccharide transport periplasmic protein LptA [Tolumonas
           auensis DSM 9187]
          Length = 172

 Score = 91.1 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 59/171 (34%), Gaps = 12/171 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L +   +   +LL +  +QA  S          + + + +   E +    K  F  +V
Sbjct: 1   MQLTLSHASFGLLLLLSVSAQAKQS-------DYQQPVVVDSVSQEAELNENKVTFLQDV 53

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            +TQ    + ADK+ +  +    D      R      I      +N  AS      + R+
Sbjct: 54  TITQGSIIIHADKVVVLRHEKGNDEMIATGRPATFFQILDNGKPVNASASELRYQLKDRL 113

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL-QGCESDQVQSIIRY 177
           + L G       LK+  N   G  +  +I           +  +V++I   
Sbjct: 114 VTLTGKAE----LKQDDNQVNGDVIRYDIQKQQMIAQSSGKGSRVKTIFLP 160


>gi|326560507|gb|EGE10889.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 7169]
 gi|326565763|gb|EGE15925.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis BC1]
          Length = 175

 Score = 91.1 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/171 (13%), Positives = 59/171 (34%), Gaps = 11/171 (6%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             +   +F+     +   A+          N+ I + AD     +      + G V + Q
Sbjct: 5   FVITKYLFLACIVSVPMIAS----ALPSDANQPIRLLADRATYSERTGVTTYSGKVTIEQ 60

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
               + AD +T++ +  NR + + +       +++ +  + G     A+    +    I+
Sbjct: 61  GTLKIAADNLTVNLDTNNRSIKSAVATGRPATIQQVVTQEKGLAKGQANRIDYNAVSGIV 120

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            L G+      L +  ++F G  +  ++             +V+ +     
Sbjct: 121 TLIGNAK----LTQAGSSFSGNTIRYSLSVGDVEANAGGGQRVELVFPPSD 167


>gi|83950824|ref|ZP_00959557.1| hypothetical protein ISM_06980 [Roseovarius nubinhibens ISM]
 gi|83838723|gb|EAP78019.1| hypothetical protein ISM_06980 [Roseovarius nubinhibens ISM]
          Length = 139

 Score = 91.1 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 60/148 (40%), Gaps = 12/148 (8%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                    +  + + A+ L V      A F G+V + Q D  L A  + + Y       
Sbjct: 2   AFGASPHSRDLPVEVTAETLSVDQKDGTAIFTGDVLIAQGDMRLSAPWVKVHYQEGQ--- 58

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
            ++I +++ +  + + SG     A     +    I+ ++GD    V+L +  +   G ++
Sbjct: 59  -SEIEKLEAKEGVTLVSGADAAEAQQADYNVSTGIITMDGD----VLLVQGASAITGDQM 113

Query: 153 IVNIDTSFASLQGCESDQVQSIIRYDGR 180
            V+     A + G    +V+++++   R
Sbjct: 114 FVDTVAGTARMAG----RVKTVLQPQSR 137


>gi|94501784|ref|ZP_01308297.1| hypothetical protein RED65_07609 [Oceanobacter sp. RED65]
 gi|94426092|gb|EAT11087.1| hypothetical protein RED65_07609 [Oceanobacter sp. RED65]
          Length = 173

 Score = 91.1 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 63/175 (36%), Gaps = 14/175 (8%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           IH   + L LV     A +                ++I I +D   +     +  + GNV
Sbjct: 2   IHPISNTLILVLSFWVAAV--------QALPEDTQQEIRIASDKAFLDKPKGELIYTGNV 53

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ-SGEINVIASNGYVDFQKR 126
            + Q    ++ADK+TI  + T         +      +  Q   +            + +
Sbjct: 54  RLNQGSLKIEADKVTIIRDETGLKQVVAEGKPARYEQVLNQDQEKTKAYGETIIYLTKSK 113

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRYDGR 180
            L L  +      L+++ N F G +++  ID      +   E  +++ +I+ + +
Sbjct: 114 QLTLLKNAG----LQKQGNEFSGERIVYLIDQQKVKAESPQEDQRIRMVIQPEQQ 164


>gi|323498691|ref|ZP_08103681.1| hypothetical protein VISI1226_21881 [Vibrio sinaloensis DSM 21326]
 gi|323316247|gb|EGA69268.1| hypothetical protein VISI1226_21881 [Vibrio sinaloensis DSM 21326]
          Length = 165

 Score = 91.1 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 58/173 (33%), Gaps = 16/173 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L    L     L    L+               + ++I +D  ++     +  F G+V
Sbjct: 1   MKLSHLSLISCLFLSGQALA---------LSSDQQQPVYIDSDSQQLDMQSNQVTFLGDV 51

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            + Q   ++ ADK+ +  +  +  + N      +     +      +   A         
Sbjct: 52  KLKQGSININADKIVVTRDPKDGSIKNIDGFGNLATFSQLTDDGKTLYGEAKELQYSLAN 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
             L +        +L +  +T  G ++  +I +      G  + D+V ++++ 
Sbjct: 112 DQLTM----RYSAMLSQDDSTIRGNQIRYHISSQKLVADGKSKGDRVSTVLQP 160


>gi|312114052|ref|YP_004011648.1| OstA family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219181|gb|ADP70549.1| OstA family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 250

 Score = 91.1 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 71/212 (33%), Gaps = 44/212 (20%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKV--LGNEKIHIKADMLEVKDAVQKAFFK 64
              L   L+    V+     +Q   S            + I I++D LEV D    A F 
Sbjct: 5   KALLAFALMLSAAVMSIPSYAQTPGSGFRGIGSGDNAKKPIDIESDRLEVDDKRHVAIFI 64

Query: 65  GNVFMTQEDFSLQADKMTIDYNNT------------------------------------ 88
           GNV   Q D++L+A ++ + Y                                       
Sbjct: 65  GNVSANQGDYNLRAPRLEVTYERQGGDSAGGKAQKLVSAPGGDSPAKSPKTATDAAAAAD 124

Query: 89  --NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
             +      I  +     +  +  E  V       D + + + + G    +VIL +K N 
Sbjct: 125 PISSGQIRYIRALGGHVVVTNKKDEQEVTGDEALYDVKGQKITMTG---KEVILSQKANV 181

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             G +L ++++T  A++   E  +VQ+I    
Sbjct: 182 VKGRQLSIDLETGRATVIP-EKGRVQAIFDQG 212


>gi|262376229|ref|ZP_06069459.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter lwoffii SH145]
 gi|262308830|gb|EEY89963.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter lwoffii SH145]
          Length = 188

 Score = 91.1 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 60/179 (33%), Gaps = 18/179 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +H ++  + L  V+    ++              N+ I + AD     +      + GNV
Sbjct: 10  MHTFLKRMTLATVVGLGSIAA------FALPSDRNQPITLLADRATFNERTGVTTYSGNV 63

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS--GEINVIASNGYVDFQK 125
            + Q    LQA+ +  + NN  +           +    +    G     A     + + 
Sbjct: 64  IIEQGTMKLQANSIVANLNNKRQISLITATGSPAQFQQKVDPAKGLAKGQAQKIVYNAET 123

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL------QGCESDQVQSIIRYD 178
            I+ L+G+      L++   +  G  L  +++             G  S +VQ +I   
Sbjct: 124 GIITLSGNAF----LQQDGASIRGATLKYSMNKGDIEAIGTPNKTGSSSGRVQIVIPPS 178


>gi|227112735|ref|ZP_03826391.1| hypothetical protein PcarbP_07224 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 149

 Score = 91.1 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 54/162 (33%), Gaps = 15/162 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +  N++     + + +F +  +  +              N+ IHI +    +      
Sbjct: 1   MKSKTNNLMRNTLIASSLFAVSVSAFA---------VTGDSNQPIHIDSAQQSLDMQGNT 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV + Q    ++ADK+ +      +  +V            +      +   A  
Sbjct: 52  VTFTGNVVVKQGTIEVKADKVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKPVKGHAQK 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
              +  K  LVL GD      L+++ +   G ++   +    
Sbjct: 112 IRYELAKDFLVLTGDAY----LEQQDSNVKGDRITYLVKQQQ 149


>gi|99079866|ref|YP_612020.1| OstA-like protein [Ruegeria sp. TM1040]
 gi|99036146|gb|ABF62758.1| OstA-like protein [Ruegeria sp. TM1040]
          Length = 144

 Score = 91.1 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 65/154 (42%), Gaps = 12/154 (7%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           ++Q         +   ++ + I +D + V      A   GNV + Q +  L AD + +  
Sbjct: 1   MAQGTGVSFGVLQTDTSQPVDIASDNMSVNQEDGSALLTGNVLIIQGEMRLSADNVLVVR 60

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
                   N I R++   N+ + SGE    A       Q   +V+ G+    V+L ++ +
Sbjct: 61  RTE----GNGIERLEARGNVLLVSGEDAAEAREADYTIQSGTVVMRGN----VLLTQQGS 112

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           T    ++ VN+ T  A+L G    +V++ +   G
Sbjct: 113 TLGAEQMTVNMTTGNATLSG----RVRTTLPGSG 142


>gi|254283657|ref|ZP_04958625.1| lipopolysaccharide transport periplasmic protein LptA, putative
           [gamma proteobacterium NOR51-B]
 gi|219679860|gb|EED36209.1| lipopolysaccharide transport periplasmic protein LptA, putative
           [gamma proteobacterium NOR51-B]
          Length = 216

 Score = 91.1 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 51/152 (33%), Gaps = 9/152 (5%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A  +   K    + I I AD  E  +  Q+  + G+V + Q    ++AD++T+ ++  N 
Sbjct: 29  APPIAALKDDREQPIKISADSAERDERSQRTQYIGSVELVQGSLHIKADRLTVFHDKANA 88

Query: 91  DVSNKINRMDV-ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           D    +       +   +    I   A        + ++ L         +++      G
Sbjct: 89  DRIIAVGDPATLTQLPAVGDPPIEAEAGKIEYIRSEDLIKLTQTAR----IEQDGAVVTG 144

Query: 150 CKLIVNIDTSFASLQGCE----SDQVQSIIRY 177
             +   I       +  E      +V+  I  
Sbjct: 145 DSIDYLITEQRVLARAGERIEGGQRVEVTIPP 176


>gi|261250137|ref|ZP_05942713.1| LptA protein [Vibrio orientalis CIP 102891]
 gi|260939253|gb|EEX95239.1| LptA protein [Vibrio orientalis CIP 102891]
          Length = 165

 Score = 90.8 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 62/169 (36%), Gaps = 17/169 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L++ +F+          +S         ++ ++I +D  ++     K  F G+V + Q
Sbjct: 6   LSLISCLFI----------SSQALALSTDQDQPVYIDSDSQQLDMQSNKVTFLGDVKLKQ 55

Query: 72  EDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
              ++ ADK+ +  +  +           +     +      +   A   Y    +  L 
Sbjct: 56  GSININADKVIVTRDPKDGSIQEIEGYGDLATFSQLTDDGKTLYGEAKELYYVMAEDQLT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
           +     DK +L +  +   G K+   I +      G  + D+V ++++ 
Sbjct: 116 MI----DKAMLSQDDSVIRGTKIRYKISSQKLIADGKEKGDRVSTVLQP 160


>gi|261379304|ref|ZP_05983877.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           subflava NJ9703]
 gi|284797744|gb|EFC53091.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           subflava NJ9703]
          Length = 176

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 60/167 (35%), Gaps = 14/167 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
             A ++  AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +
Sbjct: 8   TLALVAVFAASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSV 67

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           T+  N+ +  +                  G +N  A+         ++ L+G+      +
Sbjct: 68  TVSRNDKSEQLMKATGSPVKFSQELDGGKGVVNGQANTVMYSSAANLVTLSGNAK----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGC---------ESDQVQSIIRYD 178
           +   +   G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTINGSAKSGVKSAAKSGRVSVVIQPS 170


>gi|296313583|ref|ZP_06863524.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           polysaccharea ATCC 43768]
 gi|296839816|gb|EFH23754.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           polysaccharea ATCC 43768]
          Length = 176

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 61/164 (37%), Gaps = 14/164 (8%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
            ++  +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ + 
Sbjct: 11  LIAFFSASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVT 70

Query: 85  Y-NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
             +   + +    + +   + +    G +   A+N         +VL G+      ++  
Sbjct: 71  RNDKGEQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRG 126

Query: 144 LNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
            +   G  +  N  T   ++ G          +S +V  II+  
Sbjct: 127 GDVAEGAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 170


>gi|261378335|ref|ZP_05982908.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           cinerea ATCC 14685]
 gi|269145440|gb|EEZ71858.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           cinerea ATCC 14685]
          Length = 176

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 61/164 (37%), Gaps = 14/164 (8%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
            ++  +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ + 
Sbjct: 11  LIAFFSASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARVNVT 70

Query: 85  YN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
            N    + +    + +   + +    G +   A+N         +VL G+      ++  
Sbjct: 71  RNGKGEQFMKADGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRG 126

Query: 144 LNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
            +   G  +  N  T   ++ G          +S +V  II+  
Sbjct: 127 GDVAEGAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 170


>gi|15676270|ref|NP_273404.1| hypothetical protein NMB0355 [Neisseria meningitidis MC58]
 gi|121635509|ref|YP_975754.1| hypothetical protein NMC1813 [Neisseria meningitidis FAM18]
 gi|218768869|ref|YP_002343381.1| putative outer membrane hypothetical protein [Neisseria
           meningitidis Z2491]
 gi|254805609|ref|YP_003083830.1| hypothetical protein NMO_1685 [Neisseria meningitidis alpha14]
 gi|7225577|gb|AAF40798.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120867215|emb|CAM10984.1| putative outer membrane hypothetical protein [Neisseria
           meningitidis FAM18]
 gi|121052877|emb|CAM09229.1| putative outer membrane hypothetical protein [Neisseria
           meningitidis Z2491]
 gi|254669151|emb|CBA07831.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|254670189|emb|CBA05301.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|308388563|gb|ADO30883.1| hypothetical protein NMBB_0396 [Neisseria meningitidis alpha710]
 gi|316984361|gb|EFV63335.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           meningitidis H44/76]
 gi|319411110|emb|CBY91514.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           WUE 2594]
 gi|325128940|gb|EGC51794.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis N1568]
 gi|325130884|gb|EGC53614.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis OX99.30304]
 gi|325132909|gb|EGC55586.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M6190]
 gi|325134936|gb|EGC57568.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M13399]
 gi|325136929|gb|EGC59526.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M0579]
 gi|325138894|gb|EGC61444.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis ES14902]
 gi|325141004|gb|EGC63510.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis CU385]
 gi|325143040|gb|EGC65392.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis 961-5945]
 gi|325145150|gb|EGC67432.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M01-240013]
 gi|325198956|gb|ADY94412.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis G2136]
 gi|325199549|gb|ADY95004.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis H44/76]
 gi|325202826|gb|ADY98280.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M01-240149]
 gi|325203467|gb|ADY98920.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis M01-240355]
 gi|325208819|gb|ADZ04271.1| lipopolysaccharide ABC transporter, periplasmic
           lipopolysaccharide-binding protein [Neisseria
           meningitidis NZ-05/33]
          Length = 176

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/167 (16%), Positives = 56/167 (33%), Gaps = 14/167 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L   ++  +AS     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++
Sbjct: 8   LFVLIAFFSASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLNISAARV 67

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
            +       +                   G +   A+N         +VL G+      +
Sbjct: 68  NVTRGGKGGESVRAEGSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----V 123

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           +   +   G  +  N  T   ++ G          +S +V  +I+  
Sbjct: 124 QRGGDVAEGAVITYNTKTEVYTISGSTKSGAKSASKSGRVSVVIQPS 170


>gi|212633559|ref|YP_002310084.1| OstA-like protein [Shewanella piezotolerans WP3]
 gi|212555043|gb|ACJ27497.1| OstA-like protein [Shewanella piezotolerans WP3]
          Length = 182

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 59/169 (34%), Gaps = 16/169 (9%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            L  L+ +L  +  +               +++ I A   E      +  F G V +TQ 
Sbjct: 7   ILAGLLCLLSISSYAAV---------DDLKQEVKIAAASQEADIKNNQVIFFGPVEVTQG 57

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLN 131
              + AD++ +     N   +             ++ G      A     +   R L L 
Sbjct: 58  SIKMNADELRVFSKEANSGKTLVATGNPATYTQIMEDGRPATASAKEIRYELATRTLTLL 117

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
           GD      L+++ +   G ++  NI      A   G  +D+V +II+ +
Sbjct: 118 GDA----TLEQEGSQVTGNRIKYNIGLQQLIAESTGEGNDRVITIIQPE 162


>gi|258405723|ref|YP_003198465.1| OstA family protein [Desulfohalobium retbaense DSM 5692]
 gi|257797950|gb|ACV68887.1| OstA family protein [Desulfohalobium retbaense DSM 5692]
          Length = 181

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 64/169 (37%), Gaps = 13/169 (7%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L       + AS +   +      I I +D +    A ++  FKG+V   ++ F L 
Sbjct: 5   LLFLGMLAAVLSMASPLGAQQGEQTAPIKITSDTMRYAHADKQVRFKGSVHAIRDTFELW 64

Query: 78  ADKMTIDYNNTN---------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           ++ +T+                     I+ +  E ++ +Q G         +    + +L
Sbjct: 65  SETLTVFLKAGAADTAEGGMGMGGDQSIDHLVAEGDVRLQEGNRTGYCDTAWFYPDEGML 124

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            L G       L++  N+  G  + + +  + + + G +S +V+++   
Sbjct: 125 RLEGSPR----LEQGENSISGSVIKMYLKENRSEVIGGDSGRVEALFYS 169


>gi|254467830|ref|ZP_05081236.1| cell envelope biogenesis protein YhbN [beta proteobacterium KB13]
 gi|207086640|gb|EDZ63923.1| cell envelope biogenesis protein YhbN [beta proteobacterium KB13]
          Length = 169

 Score = 90.8 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 63/183 (34%), Gaps = 27/183 (14%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
           + +I+L+  +                   K   ++ I I +D L + D+   + + G+V 
Sbjct: 3   NKFIYLILFISFFSF------------AEKADKDQPIIIDSDELLIDDSKNISTYSGDVI 50

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRI 127
           + Q    ++ DK+ I  +      S    +    +     S +     A     D     
Sbjct: 51  LQQGTLIIRGDKLIIREDKQGFQHSTSEGKPTTFKQKMEGSDDYIEGQALRIEYDGNMDK 110

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC----------ESDQVQSIIRY 177
           + L      K  +K+  +  +G  ++ +  + FA               +  + ++IIR 
Sbjct: 111 IHL----YSKARVKKGNDLVIGDYIMYDASSEFAQAMSGNTKTKDGEELKKGRTRAIIRP 166

Query: 178 DGR 180
           D +
Sbjct: 167 DKK 169


>gi|83944935|ref|ZP_00957301.1| hypothetical protein OA2633_09909 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851717|gb|EAP89572.1| hypothetical protein OA2633_09909 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 193

 Score = 90.8 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 57/139 (41%), Gaps = 7/139 (5%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
             G   + I AD  +  DA     + G+V + + D  L+AD++   Y       S ++NR
Sbjct: 27  GSGEGPVDISADDFQAFDAQGMGVYTGDVNVVRGDVRLRADRLEAYYVR-RGGGSPELNR 85

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDT 158
           +  E  +F  +         G  D    ++ L G     V+L +  N   G  L   + T
Sbjct: 86  IVAEGEVFYITPNEIARGDRGTYDLVNEVIELTG----SVVLTQGCNVSTGEHLHAELAT 141

Query: 159 SFASLQGC--ESDQVQSII 175
             A L+G    S +V+S+ 
Sbjct: 142 GVARLEGGQNSSGRVRSVF 160


>gi|296113133|ref|YP_003627071.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis RH4]
 gi|295920827|gb|ADG61178.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis RH4]
          Length = 155

 Score = 90.8 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 53/149 (35%), Gaps = 7/149 (4%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
            +      N+ I + AD     +      + G V + Q    + AD +T++ +  NR + 
Sbjct: 3   ASALPSDTNQPIRLLADRATYSERTGVTTYSGKVTIEQGTLKIAADNLTVNLDTNNRSIK 62

Query: 94  NKI---NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
           + +       +++ +  + G     A+    +    I+ L G+      L +  ++F G 
Sbjct: 63  SAVATGQPATIQQVVTQEKGLAKGQANRIDYNAVSGIVTLTGNAK----LTQAGSSFSGN 118

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            +  ++             +V+ +     
Sbjct: 119 TIRYSLSVGDVEANAGGGQRVELVFPPSD 147


>gi|225025297|ref|ZP_03714489.1| hypothetical protein EIKCOROL_02195 [Eikenella corrodens ATCC
           23834]
 gi|224941915|gb|EEG23124.1| hypothetical protein EIKCOROL_02195 [Eikenella corrodens ATCC
           23834]
          Length = 172

 Score = 90.4 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 46/148 (31%), Gaps = 9/148 (6%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               N+ I I+AD   +    +   F GNV + Q    ++A K+ +              
Sbjct: 29  TSDRNQPIQIEADQGSLDQGNRSTEFSGNVVIQQGTMYIRAAKVRVVKAADGAQTMTASG 88

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
                     + G +   A+         I+ L+G       ++   +   G  +  N  
Sbjct: 89  SPVHFGQQLDRQGTVKGQAARVEYQSATGIVKLSGGAK----IERGGDRASGDTITYNTR 144

Query: 158 TSFASLQGC-----ESDQVQSIIRYDGR 180
           T   ++ G         +V   I+   +
Sbjct: 145 TEVYTVLGGSRSNANKGRVSITIQPQQK 172


>gi|90022819|ref|YP_528646.1| alpha amylase domain-containing protein [Saccharophagus degradans
           2-40]
 gi|89952419|gb|ABD82434.1| OstA-like protein [Saccharophagus degradans 2-40]
          Length = 179

 Score = 90.4 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 49/143 (34%), Gaps = 8/143 (5%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN-RDVSNKI 96
               ++ +   AD LE+ D        GNV + Q    + ADK+ + YN      V    
Sbjct: 31  PSDRSQPLSTDADKLELDDKSGTTTLYGNVIIEQGSMRITADKVILHYNKNKLTHVIATG 90

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                 +        +   A       ++  L L  + +   ++++   +  G ++  ++
Sbjct: 91  EPAHYSQVPRANQEPVQARAKRLEYHIEQETLTLLNNAS---LVQDGGTSLSGNRIDYDV 147

Query: 157 DTSFASLQGC----ESDQVQSII 175
             S           E  +V+ +I
Sbjct: 148 KKSLVKAGSDIEEGEKRRVRLVI 170


>gi|229588428|ref|YP_002870547.1| hypothetical protein PFLU0884 [Pseudomonas fluorescens SBW25]
 gi|229360294|emb|CAY47151.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 177

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 56/179 (31%), Gaps = 14/179 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L+  + +LL    +  + S          + IHI AD  ++ D    A + G V +TQ
Sbjct: 1   MRLVKTLPILLGLGAALGSVSAW-ALPNDSQQPIHISADDAQLDDKQGVATYTGGVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI---QSGEINVIASNGYVDFQKRIL 128
               +  + +T+                            +G +           Q+  +
Sbjct: 60  GSMKITGNTVTLTRTPAGDIDVVTSVGNLAYFEQKQSAADTGPMKGYGKTIQYHAQQNRI 119

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDGR 180
           VL        +L    N+  G K+  +     A+      ++V         +I+   +
Sbjct: 120 VLIDQAK---VLSPDGNSTEGEKITYDTVKQIANAGRANGNKVTAPRPRIDMVIQPKKK 175


>gi|326564160|gb|EGE14396.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis 12P80B1]
 gi|326570414|gb|EGE20454.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis BC8]
 gi|326571099|gb|EGE21123.1| lipopolysaccharide transport periplasmic protein LptA [Moraxella
           catarrhalis BC7]
          Length = 175

 Score = 90.4 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 65/183 (35%), Gaps = 20/183 (10%)

Query: 1   MSA-FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQ 59
           M A F+ + +L++  +  + ++                    N+ I + A+     +   
Sbjct: 1   MKADFVITKYLFLSCIVSIPMIAS------------ALPSDTNQPIRLLANRATYSERTG 48

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI---NRMDVERNIFIQSGEINVIA 116
              + G V + Q    + AD +T++ +  NR + + +       +++ +  + G     A
Sbjct: 49  VTTYSGKVTIEQGTLKIAADNLTVNLDTNNRSIKSAVATGQPATIQQVVTQEKGLAKGQA 108

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           +    +    I+ L G+      L +  ++F G  +  ++             +V+ +  
Sbjct: 109 NRIDYNAVSGIVTLTGNAK----LTQAGSSFSGNTIRYSLSVGDVEANAGGGQRVELVFP 164

Query: 177 YDG 179
              
Sbjct: 165 PSD 167


>gi|323491750|ref|ZP_08096927.1| hypothetical protein VIBR0546_01084 [Vibrio brasiliensis LMG 20546]
 gi|323314006|gb|EGA67093.1| hypothetical protein VIBR0546_01084 [Vibrio brasiliensis LMG 20546]
          Length = 165

 Score = 90.0 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 60/169 (35%), Gaps = 17/169 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L++ +F+          +S          + ++I +D  ++     K  F G+V + Q
Sbjct: 6   LSLISCLFL----------SSQALALSTDQEQPVYIDSDSQQLDMQSNKVTFIGDVKLKQ 55

Query: 72  EDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
              ++ ADK+ +  +  +           +     +      +   A   Y       L 
Sbjct: 56  GSININADKVIVTRDPKDGSIQEIEGYGDLATFSQLTDDGKTLYGEAKELYYVMVDDQLT 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
           +     D+ +L +  +   G K+   I +      G  + D+V ++++ 
Sbjct: 116 MI----DQAMLSQDDSVIRGTKIRYKISSQKLIADGKDKGDRVSTVLQP 160


>gi|89093949|ref|ZP_01166894.1| hypothetical protein MED92_01594 [Oceanospirillum sp. MED92]
 gi|89081835|gb|EAR61062.1| hypothetical protein MED92_01594 [Oceanospirillum sp. MED92]
          Length = 175

 Score = 90.0 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 52/153 (33%), Gaps = 12/153 (7%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNTNRDVSN 94
                  + IHI AD   + D      +KG V +TQ    ++AD + +   +     +  
Sbjct: 22  ALPDDQEKPIHITADTASINDKTGITTYKGKVVITQGSLLIEADYVDMYRGDEGVDKLIA 81

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
           K       +   I     +    +       + L +      +  + +  +TF G K+I 
Sbjct: 82  KGAPAHFRQQPEINGAFSDAWGLHMVYMVNDQKLTIT----KQAKVVQAKDTFTGEKIIY 137

Query: 155 NIDTSFASLQGCE-------SDQVQSIIRYDGR 180
           ++D S     G           +V  +I+   +
Sbjct: 138 DLDRSIVDAFGTNKGDPGESKGRVNMVIQPKKK 170


>gi|327398725|ref|YP_004339594.1| lipopolysaccharide transport periplasmic protein LptA [Hippea
           maritima DSM 10411]
 gi|327181354|gb|AEA33535.1| lipopolysaccharide transport periplasmic protein LptA [Hippea
           maritima DSM 10411]
          Length = 166

 Score = 90.0 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 60/166 (36%), Gaps = 9/166 (5%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
           ++VF+ +      A A     +   GN  IHI AD L   D      F+G V  T+ D  
Sbjct: 5   SIVFLAILLIGLNALAVNPKSYIKKGNIPIHITADKLTAFDKKGLYIFEGGVVATRGDVR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L +DKM +  +      +  I ++    ++ I   +                +VL G   
Sbjct: 65  LTSDKMEVYKDKK----TGDIGKVVCIGHVVITKQDKKATGDKAIYTASDSKVVLIGHAK 120

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCES-DQVQSIIRYDGR 180
               +    N     ++I  +D  +   Q      +V+ II  + +
Sbjct: 121 ----VVSGKNNITSDRIIYYLDRDYVVSQSDNKTKRVEVIIYPNQK 162


>gi|332187941|ref|ZP_08389674.1| ostA-like family protein [Sphingomonas sp. S17]
 gi|332012102|gb|EGI54174.1| ostA-like family protein [Sphingomonas sp. S17]
          Length = 172

 Score = 89.6 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 20/174 (11%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
              L   AAS   + +      I   AD +E++D   +A   GNV + Q + +L A +MT
Sbjct: 2   APVLIVLAASAPAQTRHNSRAPIDFGADHIELQDKANRAVLSGNVAVRQAEMTLNAARMT 61

Query: 83  IDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
           + Y       + +++R+D    + ++  +    +     D  +R++ + G+    V L +
Sbjct: 62  VAYTGQVIGGNPQVSRLDASGGVVVKRPDQTARSQYAIYDLNRRVITMLGN----VSLTQ 117

Query: 143 KLNTFLGCKLIVNIDTSFASLQG----------------CESDQVQSIIRYDGR 180
             NT  G +L +N+DT  A + G                  S +V        R
Sbjct: 118 GGNTVNGGRLTINLDTGRAVIDGSAVAGGGSSGVGTTTRAPSGRVTGTFSVPDR 171


>gi|223039879|ref|ZP_03610163.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter rectus RM3267]
 gi|222878888|gb|EEF13985.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter rectus RM3267]
          Length = 158

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 61/138 (44%), Gaps = 3/138 (2%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E++ + AD     +  Q + FKGNV + +   +L A+   I ++     +    +  + +
Sbjct: 23  EQVEVTADEFYADEGKQISEFKGNVNIKKGKDTLTANLAVIYFDKKRNPLKYVASG-NAK 81

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +FI++   +   +    +  + +  +NG+     I  +      G K+ VN ++   +
Sbjct: 82  FRVFIKNKTYDGSGNELIYEPAQNLYTINGNGFLHEI--QTDKKVYGEKITVNQNSGTYN 139

Query: 163 LQGCESDQVQSIIRYDGR 180
           + G + + V+ I + + +
Sbjct: 140 VNGSKKEPVKFIFQIEDK 157


>gi|257458775|ref|ZP_05623898.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter gracilis RM3268]
 gi|257443763|gb|EEV18883.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter gracilis RM3268]
          Length = 171

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 60/178 (33%), Gaps = 18/178 (10%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           + +H  I   AL+     + LS A             E++ + AD     +  Q +   G
Sbjct: 7   SKLHKLILAAALITGFSASALSAAQ------------EQVEVTADNFFADEIKQISVLTG 54

Query: 66  NVFMTQEDF-SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           NV + +  + +L +DK+TI ++   +         +    I +     +        D  
Sbjct: 55  NVRIKKGAYDTLNSDKVTIYFDAKRQPTKYVATG-NANFKILLNQKHYDGRGGVLTYDPT 113

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ--GCESDQVQSIIRYDGR 180
                L  +               G K+IVN       ++  G E   V+ I + + +
Sbjct: 114 IEAYTLENNAYLHEAET--KKEVYGDKIIVNRQKGTYEVKSGGGEKKPVRLIFQVEDQ 169


>gi|260779440|ref|ZP_05888331.1| LptA protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604530|gb|EEX30830.1| LptA protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 165

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/173 (13%), Positives = 59/173 (34%), Gaps = 16/173 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L    L    ++    L+              ++ ++I +D  ++     K  F G+V
Sbjct: 1   MKLSHLSLISCLLISGQALA---------LSTDQDQPVYIDSDSQQLDMQSNKVTFLGDV 51

Query: 68  FMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            + Q   ++ ADK+ +  +  +           +     +      +   A   Y     
Sbjct: 52  KLKQGSININADKVIVTRDPKDGSIQEIEGYGDLATFSQLTDDGKTLYGEAKELYYVMVD 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRY 177
             L +     D+ +L +  +   G K+   I +      G  + D+V ++++ 
Sbjct: 112 DQLTMI----DEAMLSQDDSVIRGTKIRYKISSQKLIADGKEKGDRVSTVLQP 160


>gi|127514237|ref|YP_001095434.1| OstA family protein [Shewanella loihica PV-4]
 gi|126639532|gb|ABO25175.1| OstA family protein [Shewanella loihica PV-4]
          Length = 181

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 55/159 (34%), Gaps = 5/159 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L+ A L    +           +++ I A   E      +  F G V +TQ    + A +
Sbjct: 6   LILAGLLPLVSVGAYAKVNDLLQEVKISAASQEADIKNNQIIFHGPVEVTQGSIKILASE 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +       N              +  ++ G   +  A     +   R L L GD      
Sbjct: 66  LRAFSKEKNSGKILIATGNPATYSQVMEDGRPASASAKEIRYELSSRTLTLIGDA----T 121

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L+++ +   G ++  NI+      +    D+V +II+ +
Sbjct: 122 LEQEGSQVTGSQIRYNIEQQQLIAESTGKDRVITIIQPE 160


>gi|297570148|ref|YP_003691492.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296926063|gb|ADH86873.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 212

 Score = 89.6 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 60/164 (36%), Gaps = 15/164 (9%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID---- 84
           A  +     +    E + I+AD +E  D      F+G V   Q D  + AD MTI     
Sbjct: 16  AGVAVTYAAEGERAEPVRIEADRMETGDEPNSVLFRGQVVARQGDLVIHADTMTIFHLSQ 75

Query: 85  --YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
              +        ++ ++     + +++ +              R ++L G         +
Sbjct: 76  EEQDQLPAGDRRRLKKLYATGQVRVEAEDWIGTGDTLEYTEADRKVLLAGKARA----WQ 131

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRYDG---RP 181
           + N   G  + + +D   + ++  E+  ++V++    D    +P
Sbjct: 132 EGNLITGRSITLYLDEGRSVVERGETPEERVRAFFYADDDQPKP 175


>gi|289812307|ref|ZP_06542936.1| lipopolysaccharide transport periplasmic protein LptA [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 142

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 47/132 (35%), Gaps = 6/132 (4%)

Query: 49  ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIF 106
           +D   +        F GNV MTQ    + ADK+ +        ++V +          + 
Sbjct: 1   SDQQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQ 60

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
                +   AS+ + +  K  +VL G+      L++  +   G K+   +          
Sbjct: 61  DNGKPVKGHASHMHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSE 116

Query: 167 ESDQVQSIIRYD 178
           +  +V +++   
Sbjct: 117 KGKRVTTVLVPS 128



 Score = 35.3 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 26/82 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D ++  DK+T           ++  +
Sbjct: 60  QDNGKPVKGHASHMHYELAKDFVVLTGNAYLEQLDSNITGDKITYLVKEQKMQAFSEKGK 119

Query: 99  MDVERNIFIQSGEINVIASNGY 120
                 +  Q  E      +G 
Sbjct: 120 RVTTVLVPSQLQEQKQRPDSGD 141


>gi|241760827|ref|ZP_04758918.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           flavescens SK114]
 gi|241318724|gb|EER55276.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           flavescens SK114]
          Length = 176

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 56/159 (35%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           AAS     +    + I I+AD   +    Q   F GNV + Q   +++A  +T+  N+ +
Sbjct: 16  AASPAFALQSDSKQPIQIEADQGSLDQNNQSTTFSGNVIIKQGTLNIRAGSVTVSRNDKS 75

Query: 90  RDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
             +                  G +N  A+         ++ L G+      ++   +   
Sbjct: 76  EQLMKATGSPVKFSQELDGGKGVVNGQANTVTYSSAASLVTLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQGC---------ESDQVQSIIRYD 178
           G  +  N  T   ++ G          +S +V  +IR  
Sbjct: 132 GAVITYNTKTEVYTINGSAKSGVKSAAKSGRVSVVIRPS 170


>gi|326795049|ref|YP_004312869.1| lipopolysaccharide transport periplasmic protein LptA [Marinomonas
           mediterranea MMB-1]
 gi|326545813|gb|ADZ91033.1| lipopolysaccharide transport periplasmic protein LptA [Marinomonas
           mediterranea MMB-1]
          Length = 172

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/160 (12%), Positives = 59/160 (36%), Gaps = 6/160 (3%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L     +  +AS     +   ++ + I+AD         +A +KG+V + Q    ++AD
Sbjct: 11  TLFLTVSACLSASSNYALESDTSQPLEIQADEAFYDQKAGEATYKGDVLIKQGTIEIKAD 70

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG--DRADK 137
            + +  +      +N  + +         + +++   +       +   + +G  +   K
Sbjct: 71  FLKVFTDP----ATNTFSSLQATGTPARFTQQLDEAGNRVTSRGDQIDYITDGRLEINGK 126

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
             LK  L+      ++  +     + +   + +V+  ++ 
Sbjct: 127 GYLKRGLDEIDADFILYMMKNETFTAENRGNGRVKMTLQP 166


>gi|182677565|ref|YP_001831711.1| OstA family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633448|gb|ACB94222.1| OstA family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 212

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 15/148 (10%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-------NNTNRD 91
             G++ ++I+A  L+  D  QK  + GNV  TQ +  L+   + I         N+    
Sbjct: 58  GNGHQPVNIEATKLDYFDKEQKLIYTGNVVATQGETILKTSTLIIYLVPKGSTANSAGGT 117

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
            S+++ RM+    + + S +      +G  +  +  + LNG+    V L +  N   G K
Sbjct: 118 GSDQVRRMEAPNAVVMISKDQVGTGDSGVYEKAENKVTLNGN----VTLTQGPNVTKGDK 173

Query: 152 LIVNIDTSFASLQGCESDQVQSIIRYDG 179
           L+ ++ TS A + G     V+S+     
Sbjct: 174 LVYDLHTSQAVVIGH----VRSLFLPSD 197


>gi|254463023|ref|ZP_05076439.1| OstA family protein [Rhodobacterales bacterium HTCC2083]
 gi|206679612|gb|EDZ44099.1| OstA family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 180

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 68/176 (38%), Gaps = 21/176 (11%)

Query: 10  LYIHLLALVFVLLKADLSQ---------AAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           L   +L L         +Q                  K   +  I + ++ L V +    
Sbjct: 7   LSAVVLGLALSFGGFVHAQDTNTDPAEGGTTIAFGDRKQDTDAPIDVTSERLAVDENANT 66

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
           A F G+V + Q+  +L A  + + Y      +S     +  +  + +   E         
Sbjct: 67  ALFTGDVVVIQDTMTLYAPWVKVFYKEDQSGIS----HLKAKDGVTLLQNEEAAEGETAD 122

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
            D +K I+V+NGD    V++ +KL+     K+ V +D   A + G    +V+S++R
Sbjct: 123 YDLEKEIIVMNGD----VLVTQKLSAIASDKMTVRLDEGTALMTG----RVKSLLR 170


>gi|294139187|ref|YP_003555165.1| hypothetical protein SVI_0416 [Shewanella violacea DSS12]
 gi|293325656|dbj|BAJ00387.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 217

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 57/179 (31%), Gaps = 16/179 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   +N  +L I  L  V                   +    +++ I A   E      +
Sbjct: 1   MKDDMNKHNLIIAALLCVTSFSGIA-----------KQNDLMQEVKISASSQEADIKNNQ 49

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNG 119
             F G V +TQ    + AD++                      +  ++ G   +  A   
Sbjct: 50  MIFHGPVEVTQGSIKILADELRATSKEDGGGKILVAIGNPATYSQIMEDGRPASASAKEI 109

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             +   R L L G+      L++  +   G  +  NI       +   +D+V +II+ +
Sbjct: 110 RYELSSRTLTLLGNA----TLEQDASRVTGNMIRYNIAKQQLIAESKGNDRVITIIQPE 164


>gi|254497761|ref|ZP_05110534.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254353054|gb|EET11816.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 155

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 53/154 (34%), Gaps = 9/154 (5%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR-- 90
                     + +H+ AD  ++     K  + GNV + Q   +L+A K     ++ N+  
Sbjct: 5   AAYALPTDKEQVMHVMADSADLSQQDHKGTYVGNVELIQGTTNLRAAKAITQGDDKNQLV 64

Query: 91  ---DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
                 NK  +         +    +  A        + ++ L G+      +++  N+F
Sbjct: 65  LAIANGNKEKQAHYWAITDPKKPPFHAYADTIRYYPLRHLIELIGNAR----VEQGDNSF 120

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
              K+  +        QG    ++  I   + +P
Sbjct: 121 SAAKITYDTIKQHVLSQGDRKQRITIIYHPEKKP 154



 Score = 34.5 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 25/87 (28%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
            VL  A+ ++   ++            H  AD +            GN  + Q D S  A
Sbjct: 63  LVLAIANGNKEKQAHYWAITDPKKPPFHAYADTIRYYPLRHLIELIGNARVEQGDNSFSA 122

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNI 105
            K+T D    +        +       
Sbjct: 123 AKITYDTIKQHVLSQGDRKQRITIIYH 149


>gi|319790124|ref|YP_004151757.1| lipopolysaccharide transport periplasmic protein LptA [Thermovibrio
           ammonificans HB-1]
 gi|317114626|gb|ADU97116.1| lipopolysaccharide transport periplasmic protein LptA [Thermovibrio
           ammonificans HB-1]
          Length = 173

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 67/170 (39%), Gaps = 10/170 (5%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +   + L   V ++  A     A + + + +V  N  + ++A  L   D  ++A + G+V
Sbjct: 1   MRKVVFLFLTVLLVSPAVEFAHAGTPLKKIEVNKNLPVVVEAQELIYNDKKRQAVYIGSV 60

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
                   +  DK+ I +         +I ++ VE N+ ++                +  
Sbjct: 61  VAQHGSTVITGDKLIIYF----GPAKTRITKIVVEGNVHVKDPRGEGWCDELIYYPMQEK 116

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           +VL G+      LK+  N  +G K+I   D     + G +   V+++I  
Sbjct: 117 VVLLGNAK----LKQGKNVLIGDKIIAYRD-GRVEVVGLKQK-VKTVIYP 160


>gi|167625608|ref|YP_001675902.1| cell envelope biogenesis YhbN [Shewanella halifaxensis HAW-EB4]
 gi|167355630|gb|ABZ78243.1| Cell envelope biogenesis YhbN [Shewanella halifaxensis HAW-EB4]
          Length = 185

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 53/170 (31%), Gaps = 15/170 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + +LA +F LL                    +++ I A   E      +  F G V +TQ
Sbjct: 5   LSILAGLFCLLSFS--------SVAKVDDLLQEVKIAAASQEADIKNNQVIFFGPVEVTQ 56

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVL 130
               + ADK+ +         +             +  G      A     +   R L L
Sbjct: 57  GSIKMNADKLRVFSKEDKSGKTLVATGNPATYTQIMDDGRPATASAKEIRYELATRTLTL 116

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD--QVQSIIRYD 178
            GD      L +  +   G ++  NI       +       +V +II+ +
Sbjct: 117 VGDA----TLAQDGSQVTGNRIKYNISLQQLIAESSGKGDDRVITIIQPE 162


>gi|298530339|ref|ZP_07017741.1| OstA family protein [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509713|gb|EFI33617.1| OstA family protein [Desulfonatronospira thiodismutans ASO3-1]
          Length = 176

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 65/180 (36%), Gaps = 18/180 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +H       LV VL    L      Y    +   ++   I +  +  K A     F G+V
Sbjct: 1   MHCRFFPYILVCVLAALFL------YPAGIQAENDKGTEITSRDMTFKGAENLIVFSGDV 54

Query: 68  FMTQEDFSLQADKMTIDYNNTNRD--------VSNKINRMDVERNIFIQSGEINVIASNG 119
           ++ + DF L +DK+ +   +              + I ++     + IQ       +   
Sbjct: 55  YVRRPDFELWSDKLYVYLRSDADMDETAPEAGEDDDIEKIVARGQVRIQGEGREGRSGLL 114

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
                  I+ L  D      L E  N+  G K+++N+  + + + G E  +V+ I   D 
Sbjct: 115 TYYPDTEIVELEQDPR----LIEGKNSVEGEKIVLNLKDNTSRVYGSEERRVRVIFHSDD 170


>gi|325273322|ref|ZP_08139594.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           sp. TJI-51]
 gi|324101555|gb|EGB99129.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           sp. TJI-51]
          Length = 165

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 58/168 (34%), Gaps = 13/168 (7%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L    +  +AS         ++ I I+AD   + D    A + G+V +TQ    ++ + 
Sbjct: 1   MLSLSAALGSASAF-ALPNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNT 59

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFI---QSGEINVIASNGYVDFQKRILVLNGDRADK 137
           +T+                           +  ++   A       QK  ++L       
Sbjct: 60  VTMTRAANGDIDVVTSVGNLAYFEQQQSAAKPDKMKGWAVTIQYQAQKDTVILTDRAK-- 117

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCES-----DQVQSIIRYDGR 180
             ++ + NT  G K++ N  +  A+     +      ++  +I+   +
Sbjct: 118 --VENEGNTTEGEKIVYNTKSQVATAGRGGNVTQPRQRIDMVIQPKKK 163


>gi|28899442|ref|NP_799047.1| ABC transporter [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840279|ref|ZP_01992946.1| cell envelope biogenesis protein YhbN [Vibrio parahaemolyticus
           AQ3810]
 gi|260363389|ref|ZP_05776241.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus K5030]
 gi|260879324|ref|ZP_05891679.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AN-5034]
 gi|260895717|ref|ZP_05904213.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus Peru-466]
 gi|260900290|ref|ZP_05908685.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AQ4037]
 gi|28807678|dbj|BAC60931.1| putative ABC superfamily transport protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746058|gb|EDM57188.1| cell envelope biogenesis protein YhbN [Vibrio parahaemolyticus
           AQ3810]
 gi|308087415|gb|EFO37110.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus Peru-466]
 gi|308093097|gb|EFO42792.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AN-5034]
 gi|308107556|gb|EFO45096.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus AQ4037]
 gi|308111173|gb|EFO48713.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus K5030]
 gi|328471421|gb|EGF42316.1| ABC transporter [Vibrio parahaemolyticus 10329]
          Length = 164

 Score = 89.2 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/145 (14%), Positives = 51/145 (35%), Gaps = 6/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVS 93
             K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +         
Sbjct: 20  ALKSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPKTEAIKQI 79

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
               +      +      ++  A+          L + G       L +  NT  G  + 
Sbjct: 80  QAFGKPATFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDGNTIKGSSIR 135

Query: 154 VNIDTSFASLQGCESDQVQSIIRYD 178
             I          ++++V +I++ +
Sbjct: 136 YQIGQQKLVADSSKNERVTTILQPN 160


>gi|198284715|ref|YP_002221036.1| lipopolysaccharide transport periplasmic protein LptA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667648|ref|YP_002427394.1| hypothetical protein AFE_3027 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198249236|gb|ACH84829.1| lipopolysaccharide transport periplasmic protein LptA
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519861|gb|ACK80447.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 182

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 10/174 (5%)

Query: 7   SIHLYIHLLAL--VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK-AFF 63
           ++ +++  L+    +  L A LS +A +     + LG   I I AD L  ++  Q+ A +
Sbjct: 4   AVRIFLKRLSFQRYWPFLLAVLSASALAAPIAEQGLGKGPIQISADALHGENKPQQQAVY 63

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            GNV MTQ D  + ADK+T+D        +  +          + + + +          
Sbjct: 64  TGNVVMTQGDVVVHADKLTVDAIAGKVHQATAVGSPVTF---TMSAAQRHGYGDTLVYKP 120

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            K  +VL G+      L +K N   G ++   + T   ++      +VQSI   
Sbjct: 121 GKGEIVLTGNA----HLWQKKNEISGQQVTYFLQTQQTAVTAAPGKRVQSIFYP 170


>gi|255322559|ref|ZP_05363704.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter showae RM3277]
 gi|255300467|gb|EET79739.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter showae RM3277]
          Length = 158

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 61/138 (44%), Gaps = 3/138 (2%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E++ I AD     +  Q + FKGNV + +   +L A+ + I ++     +    +  + +
Sbjct: 23  EQVEITADEFYADEGKQISEFKGNVNIKKGKDTLTANLVVIYFDKKRNPLKYVASG-NAK 81

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +FI++   +   S    +    +  +NG+     I  +K     G K+ VN ++   +
Sbjct: 82  FRVFIKNKTYDGSGSELVYEPAPNLYTINGNGFLHEIETDKK--VYGEKITVNQNSGTYN 139

Query: 163 LQGCESDQVQSIIRYDGR 180
           +   + + V+ I + + +
Sbjct: 140 VNSGKKEPVKFIFQVEDK 157


>gi|238022120|ref|ZP_04602546.1| hypothetical protein GCWU000324_02026 [Kingella oralis ATCC 51147]
 gi|237866734|gb|EEP67776.1| hypothetical protein GCWU000324_02026 [Kingella oralis ATCC 51147]
          Length = 176

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 46/150 (30%), Gaps = 11/150 (7%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             +    + I I AD   +    Q   F GNV +TQ   +++A+ + +  +       N 
Sbjct: 24  ALESDRQQPISIDADQGSLDQKNQVTVFTGNVIITQGTLNMRANTVRVVQDQNGNQTMNA 83

Query: 96  INRMDVERNI-FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                  R       G                 + L G+      ++   +   G  +  
Sbjct: 84  QGSPVYFRQELDNNKGIAEGWGDRAEYASANHTVKLVGNAK----VRRGGDVATGNAISY 139

Query: 155 NIDTSFASLQGCESD------QVQSIIRYD 178
           N  T   ++ G  +       +V  +I+  
Sbjct: 140 NTQTEVYTVLGGNATGSKNNPRVHIVIQPS 169


>gi|331005068|ref|ZP_08328472.1| LptA, protein essential for LPS transport across the periplasm
           [gamma proteobacterium IMCC1989]
 gi|330421123|gb|EGG95385.1| LptA, protein essential for LPS transport across the periplasm
           [gamma proteobacterium IMCC1989]
          Length = 178

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 54/174 (31%), Gaps = 18/174 (10%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L   L++ +F L     +               + I++ AD            ++GNV +
Sbjct: 19  LMTILISSLFFLSNPASA---------LPSDKEQPINVSADKARKNGNQGLTIYEGNVVI 69

Query: 70  TQEDFSLQADKMTID----YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
           TQ    +  D++ I       +      +K      ++    +  ++         D   
Sbjct: 70  TQGSIRITGDEVAIYDEAGTVSKMIAKGSKNQPAKFKQRPQPEGTDMIANGETIEYDINS 129

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             L+L         L++        K+  ++ ++  +  G    +V  +I    
Sbjct: 130 ETLLLLESAR----LEQDGRITDSNKITYDMKSTVVNA-GDSDGRVIMVIPPSK 178


>gi|330958012|gb|EGH58272.1| OstA-like protein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 173

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 52/164 (31%), Gaps = 14/164 (8%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +   ++         ++ IHI++D  ++ D    A ++GNV +TQ    +  + +TI  N
Sbjct: 6   AALGSASAWSLPTDRDQPIHIQSDDAQLDDKKGVATYRGNVVITQGSMKVTGNTVTITRN 65

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                                   +      A        +  +VL     DK  +    
Sbjct: 66  AQGEVDVFTSVGNLAYYEQKPAPDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVINDG 121

Query: 145 NTFLGCKLIVNIDTSFASLQGCESD--------QVQSIIRYDGR 180
           NT  G K++ +      +               ++  +I+   +
Sbjct: 122 NTSEGEKIVYDTVRQVVTAGRASGGTKLTTPRPRIDMVIQPKKK 165


>gi|114568661|ref|YP_755341.1| OstA family protein [Maricaulis maris MCS10]
 gi|114339123|gb|ABI64403.1| OstA family protein [Maricaulis maris MCS10]
          Length = 180

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 68/164 (41%), Gaps = 6/164 (3%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L   L     +    +  +      +  + I+A+  EV DA +   + GNV + Q D S
Sbjct: 3   LLAISLFGMAAAALPTTAASAQIGNSSLPLDIEAETFEVLDAERHIVWLGNVHVVQGDSS 62

Query: 76  LQADKMTIDYN-NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           LQAD+M + Y           I+R+    N+F  +         G  +  + ++ L GD 
Sbjct: 63  LQADRMDVYYTGEGPGGGWGDIDRIVATDNVFYITPAQRARGDRGVYELAEEVITLTGD- 121

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASL-QGCESDQVQSIIRY 177
              V++ +  N     + + N+ T  ++  +    ++V+ +++ 
Sbjct: 122 ---VVITQGDNVITTTRFVNNLTTGNSNFGEAGTGERVRMVLQP 162


>gi|90415751|ref|ZP_01223685.1| hypothetical protein GB2207_10546 [marine gamma proteobacterium
           HTCC2207]
 gi|90333074|gb|EAS48244.1| hypothetical protein GB2207_10546 [marine gamma proteobacterium
           HTCC2207]
          Length = 194

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 54/160 (33%), Gaps = 8/160 (5%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +L   LS   A+          + I I++D  E  +   +  ++GNV ++Q    ++AD
Sbjct: 23  TILIVVLSSVLATQCLALPDDRQQTISIESDYAERNEKTGRTIYRGNVVISQGSVLVEAD 82

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKV 138
           ++ +   +          +    +      G  +   A +         L L  +     
Sbjct: 83  QIVLHLEDNKISRIECTGKPASYKQKPTIEGATMIARADHIDYMPATNKLALKQNA---- 138

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESD---QVQSII 175
           +L        G  +  +I+      +G       ++Q +I
Sbjct: 139 MLSRNGTIIKGDSIDYDINKETWKAKGDNQGQQKRIQLVI 178


>gi|317485282|ref|ZP_07944162.1| OstA-like protein [Bilophila wadsworthia 3_1_6]
 gi|316923408|gb|EFV44614.1| OstA-like protein [Bilophila wadsworthia 3_1_6]
          Length = 191

 Score = 88.8 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 63/186 (33%), Gaps = 23/186 (12%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  + L I  L+L         +           V       I +D L      Q   F 
Sbjct: 1   MKKLFLGITTLSLSLFCSAPLWAAPVTPPKPAKNVET----RITSDQLTYLAEKQLVIFD 56

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTN---------------RDVSNKINRMDVERNIFIQS 109
            NV + + D  + AD++T+                        +  ++R+  ERN+ ++S
Sbjct: 57  KNVHVVRPDIEIWADRITVYLKPPKGDAQKKEGEKGGMPAGMAAGDVDRIVAERNVRMKS 116

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
              N   +         +L++ GD      L +  NT  G  +    + + + + G    
Sbjct: 117 ENRNGTCAKATYTMDDGVLLMEGDPR----LTDGENTVTGETIKYFTEENRSEVMGGSKK 172

Query: 170 QVQSII 175
           +V+++ 
Sbjct: 173 RVEAVF 178


>gi|107099955|ref|ZP_01363873.1| hypothetical protein PaerPA_01000976 [Pseudomonas aeruginosa PACS2]
 gi|296391170|ref|ZP_06880645.1| hypothetical protein PaerPAb_23579 [Pseudomonas aeruginosa PAb1]
 gi|313107045|ref|ZP_07793248.1| hypothetical protein PA39016_000840147 [Pseudomonas aeruginosa
           39016]
 gi|310879750|gb|EFQ38344.1| hypothetical protein PA39016_000840147 [Pseudomonas aeruginosa
           39016]
          Length = 155

 Score = 88.4 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 47/154 (30%), Gaps = 13/154 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  + I ++AD  E+ D    A ++G+V +TQ    L  + +T+  +         
Sbjct: 4   ALPSDREQPIRVQADSAELDDKQGVAVYRGDVVVTQGSTKLTGNTVTLKQDKNGDIEVVT 63

Query: 96  INRMDVERNIFIQSGEI--NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
                          +               +  +VL         + ++ NTF G K++
Sbjct: 64  SVGKPAYYEQKPAPDKDVTKAYGLTIQYFVTQNRVVLIDQAK----VIQEGNTFEGEKIV 119

Query: 154 VNIDTSFASLQGCESDQVQ-------SIIRYDGR 180
            +      +       QV         +I+   +
Sbjct: 120 YDTQRQIVNAGRATGSQVTSPRPRIDMVIQPKKK 153


>gi|28198547|ref|NP_778861.1| hypothetical protein PD0639 [Xylella fastidiosa Temecula1]
 gi|182681227|ref|YP_001829387.1| lipopolysaccharide transport periplasmic protein LptA [Xylella
           fastidiosa M23]
 gi|28056631|gb|AAO28510.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182631337|gb|ACB92113.1| lipopolysaccharide transport periplasmic protein LptA [Xylella
           fastidiosa M23]
 gi|307579674|gb|ADN63643.1| lipopolysaccharide transport periplasmic protein LptA [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 176

 Score = 88.4 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 59/163 (36%), Gaps = 12/163 (7%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDF 74
             +F LL   LS  A S         N+ + I +   E       KA + GNV + Q   
Sbjct: 9   FFLFPLLFTPLSATAKS------SDRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSL 62

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
              AD   +   N + D    I +    +        ++  A N     ++ I++L G+ 
Sbjct: 63  EAHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                ++       G ++I N  T      G +  +V++ I+ 
Sbjct: 123 K----VESPKGNNTGQRMIYNTQTGDMR-SGNDGTRVRTTIQP 160


>gi|296446796|ref|ZP_06888734.1| OstA family protein [Methylosinus trichosporium OB3b]
 gi|296255671|gb|EFH02760.1| OstA family protein [Methylosinus trichosporium OB3b]
          Length = 183

 Score = 88.4 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 62/144 (43%), Gaps = 11/144 (7%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN----TNRDVSN 94
             G + + I A  L+  D  Q+  + G V +     +L+A ++TI  +          S+
Sbjct: 34  ASGKDPVDIDAGKLDYFDKEQRLVYSGGVIVVNGPSTLKASRLTILLDKAKEGEQTTGSD 93

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
           ++  +D E  + + S +   +  +   D  +  + L G+    V L +  N   G KL+ 
Sbjct: 94  RVRHIDAEGPVTLVSKDQIGVGDHASYDRGEDKIYLTGN----VTLTQGDNIAKGDKLVY 149

Query: 155 NIDTSFASLQGCESDQVQSIIRYD 178
            + +  A++ G   ++V+S+    
Sbjct: 150 EVGSGHATMMG---ERVRSLFTPG 170



 Score = 36.1 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 11/85 (12%), Positives = 25/85 (29%), Gaps = 7/85 (8%)

Query: 40  LGNEKIHIKA-------DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                + + +       D         K +  GNV +TQ D   + DK+  +  + +  +
Sbjct: 99  DAEGPVTLVSKDQIGVGDHASYDRGEDKIYLTGNVTLTQGDNIAKGDKLVYEVGSGHATM 158

Query: 93  SNKINRMDVERNIFIQSGEINVIAS 117
             +  R            +     +
Sbjct: 159 MGERVRSLFTPGEAKGDKDAKSKRN 183


>gi|85859056|ref|YP_461258.1| organic solvent tolerance protein [Syntrophus aciditrophicus SB]
 gi|85722147|gb|ABC77090.1| organic solvent tolerance protein [Syntrophus aciditrophicus SB]
          Length = 197

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 74/172 (43%), Gaps = 15/172 (8%)

Query: 19  FVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
           + ++ A ++    S     +V G+E I I +D L+  +  +   F GN    Q D ++++
Sbjct: 26  WAVMAAPVAGEPQSQKKN-QVTGSEPIRIDSDRLDAYNDQRLVVFSGNAVAVQGDKTIKS 84

Query: 79  DKMTIDYNN----------TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +K+ + Y                 +  + R++ + N+ +  GE  V           + +
Sbjct: 85  EKILLYYKKGESGTQKVASKEVGKTGDLERIEAKGNVILTQGERVVTGDEAVYYQGSQKI 144

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           V++G+     +++E  N   G +++V I+ +   ++  +  +V + I    +
Sbjct: 145 VMSGNA----VMRENRNIIRGDRIVVFINENRGMVESTQRKRVTATIYPSEK 192


>gi|254509104|ref|ZP_05121206.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus 16]
 gi|219547985|gb|EED25008.1| lipopolysaccharide transport periplasmic protein LptA [Vibrio
           parahaemolyticus 16]
          Length = 147

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 56/145 (38%), Gaps = 7/145 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN--RDVS 93
                  + ++I +D  ++     K  F G+V + Q   ++ ADK+ +  N  +   +  
Sbjct: 2   ALSTDQQQPVYIDSDSQQLDMQSNKVTFLGDVKLKQGSININADKIVVTRNPNDGSIESI 61

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
           +   ++     +      +   A        K  L +      K +L +  +T  G ++ 
Sbjct: 62  DGFGKLATFSQLTDDGKTLYGEAEELEYSLAKDQLTM----RIKAMLSQDDSTIRGNQIR 117

Query: 154 VNIDTSFASLQG-CESDQVQSIIRY 177
            +I +   +  G  + D+V ++++ 
Sbjct: 118 YHISSQKLTADGQSKGDRVSTVLQP 142


>gi|56476150|ref|YP_157739.1| OstA-like family protein [Aromatoleum aromaticum EbN1]
 gi|56312193|emb|CAI06838.1| OstA-like family protein [Aromatoleum aromaticum EbN1]
          Length = 190

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 49/162 (30%), Gaps = 16/162 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
                        + ++I+A+ L V D  +   F+GNV +TQ    ++ D++ +      
Sbjct: 19  QPLPALAELADREKPVNIEANRLTVDDRNKVHVFEGNVVLTQGSLVIKGDRLVVTQGPDG 78

Query: 90  RD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
                   +        +     +  +   A     D +     L         ++   +
Sbjct: 79  FQTGVATGSDKRPATFRQKREGSNEFVEGEAERIEYDSRAERARLFNQAR----VESGGD 134

Query: 146 TFLGCKLIVNIDTSFASLQGCES--------DQVQSIIRYDG 179
              G  +  +  +    +              +V+++I+  G
Sbjct: 135 EVRGHYIEYDALSEKYFVTNQPGTSAATAGDSRVRAVIQPKG 176


>gi|71897587|ref|ZP_00679832.1| OstA-like protein [Xylella fastidiosa Ann-1]
 gi|71732490|gb|EAO34543.1| OstA-like protein [Xylella fastidiosa Ann-1]
          Length = 176

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 59/163 (36%), Gaps = 12/163 (7%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDF 74
             +F LL   LS  A S         N+ + I +   E       KA + GNV + Q   
Sbjct: 9   FFLFPLLFTPLSATAKS------SDRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSL 62

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
              AD   +   N + D    I +    +        ++  A N     ++ I++L G+ 
Sbjct: 63  EAHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                ++       G ++I N  T      G +  +V++ I+ 
Sbjct: 123 K----VESPKGNNTGQRMIYNTQTGDMR-SGNDGTRVRTTIQP 160


>gi|332994378|gb|AEF04433.1| OstA-like protein [Alteromonas sp. SN2]
          Length = 187

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 63/179 (35%), Gaps = 14/179 (7%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           +   I L    LA    +     +  AA      +   N+ I + +    V    + + F
Sbjct: 2   YKPFIRLATKALATSLAVSLFATAAIAA------ESDFNKPIKVDSKSQFVDGKNKTSLF 55

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVD 122
           K +V +TQ    + AD++ +  +  +              +  ++ G  +   A+    +
Sbjct: 56  KDDVRITQGSLVINADEVEVIASEGDGREIFVARGKPASYSQKLEDGAPVTAKANEIRYE 115

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG---CESDQVQSIIRYD 178
              R + L G+      L++  +   G K+  ++ T      G    E  +V ++   +
Sbjct: 116 VVNRTISLQGNAE----LQQDTSKVQGDKITFDMVTEQLLATGGEDGEGGRVTTVFTPE 170


>gi|152996438|ref|YP_001341273.1| cell envelope biogenesis YhbN [Marinomonas sp. MWYL1]
 gi|150837362|gb|ABR71338.1| Cell envelope biogenesis YhbN [Marinomonas sp. MWYL1]
          Length = 175

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 59/173 (34%), Gaps = 14/173 (8%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +I++  L+   L    +               + + I+AD         +A +KGNV
Sbjct: 1   MKRFINVSVLLTSALIGQYAY-------ALPEDTTKPLEIQADEASFDQNSGEAIYKGNV 53

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           F+ Q    +QA  + +  +   R  S+           + I      +    +  +    
Sbjct: 54  FVKQGTIEIQAQYLKVTTDANTRKFSSLEATGKPAKFSQQIDWSGNIVISKGNEIHYLTS 113

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           +  L + GD      L    N+     ++  ID    S +  +S +V   ++ 
Sbjct: 114 ESKLEIIGDGY----LSRMQNSITADYILYMIDDGTFSAEKKDSGRVSMTLQP 162


>gi|307544515|ref|YP_003896994.1| hypothetical protein HELO_1925 [Halomonas elongata DSM 2581]
 gi|307216539|emb|CBV41809.1| K09774 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 176

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 50/157 (31%), Gaps = 11/157 (7%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            S     +   +  I ++AD L++ D    A ++GNV + Q    L   ++ I  N+  +
Sbjct: 21  TSQAQALEGDASAPIQVEADRLDLDDRAGTAVYQGNVRIQQGSMLLTGARVEIRRNDAGQ 80

Query: 91  DVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
                               E               +R + L     D+  L    +TF 
Sbjct: 81  LSQAIATGQRAYIEQQPAPDESVVRGWGQRIVYHVAERRMELI----DQAELHRGGDTFN 136

Query: 149 GCKLIVNIDTSFASLQGC-----ESDQVQSIIRYDGR 180
           G  L   +D      +        + +V+  +  + +
Sbjct: 137 GGYLEYFLDRRVVQARSAAEGVEGNQRVRMTLEPEKQ 173


>gi|187479587|ref|YP_787612.1| hypothetical protein BAV3117 [Bordetella avium 197N]
 gi|115424174|emb|CAJ50727.1| putative exported protein [Bordetella avium 197N]
          Length = 201

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 59/190 (31%), Gaps = 19/190 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M+ F  +  L   LL    +   A   QA     +           I +D L+  D  ++
Sbjct: 1   MTDFPFAQRLMSALLLTAAMCAPALAQQAKPEDPSTL---------ILSDSLQYDDVKRQ 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR----MDVERNIFIQSGEINVIA 116
           + F GNV +T+   +L ADK+ +  +                + + +        I    
Sbjct: 52  SVFTGNVALTRGLMTLNADKLEVREDQKGNQFGTATANKGKLVRIRQERPDTFEIIEGEG 111

Query: 117 SNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGC-----ESDQ 170
                D       L G       +  K  +T  G ++  N  T     +G         +
Sbjct: 112 LRADYDGTNSQFDLIGQAVVTRYICGKPFDTIRGDRVRYNEKTGIYQAEGGPNSAAPGGR 171

Query: 171 VQSIIRYDGR 180
           V+S      +
Sbjct: 172 VRSYSPPRAK 181


>gi|213585574|ref|ZP_03367400.1| hypothetical protein SentesTyph_31632 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 140

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 51/153 (33%), Gaps = 15/153 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L   +        +               + IHI +D   +      
Sbjct: 1   MKFKTNKLSLNLMLAGSLLAASIPAFA---------VTGDTEQPIHIDSDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV MTQ    + ADK+ +        ++V +          +      +   AS+
Sbjct: 52  VTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVKGHASH 111

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
            + +  K  +VL G+      L++  +   G K
Sbjct: 112 MHYELAKDFVVLTGNAY----LEQLDSNITGDK 140


>gi|312958999|ref|ZP_07773518.1| OstA family protein [Pseudomonas fluorescens WH6]
 gi|311286769|gb|EFQ65331.1| OstA family protein [Pseudomonas fluorescens WH6]
          Length = 177

 Score = 88.4 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 55/179 (30%), Gaps = 14/179 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L+  + +LL    +   +           + IHI AD  ++ D    A + G V +TQ
Sbjct: 1   MRLVKTLPILLGLG-AVLGSVSAWALPNDSQQPIHISADDAQLDDKQGVATYTGGVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI---QSGEINVIASNGYVDFQKRIL 128
               +  + +T+    +                       +G +           Q+  +
Sbjct: 60  GSMKITGNTVTLTRTQSGDIDVVTSVGNLAYFEQKQSATDTGPMKGYGKTIQYHAQQNRI 119

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDGR 180
           VL        +L    N+  G K+  +     A+       +V         +I+   +
Sbjct: 120 VLIDQAK---VLSPDGNSTEGEKITYDTVKQIANAGRANGSKVTAPRPRIDMVIQPKKK 175


>gi|302063707|ref|ZP_07255248.1| ostA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302133819|ref|ZP_07259809.1| ostA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|331016689|gb|EGH96745.1| ostA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 173

 Score = 88.1 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 52/167 (31%), Gaps = 14/167 (8%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
              +   ++         ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI
Sbjct: 3   GLSAALGSASAWSLPNDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTI 62

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILK 141
             N                        +      A        +  +VL     DK  + 
Sbjct: 63  TRNAQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAITIQYYAGQDRIVLI----DKAKVV 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESD--------QVQSIIRYDGR 180
              NT  G K++ +      S               ++  +I+   +
Sbjct: 119 NDGNTSEGEKIVYDTVRQVVSAGRANGGAKVTTPRPRIDMVIQPKKK 165


>gi|310817098|ref|YP_003965062.1| OstA-like protein [Ketogulonicigenium vulgare Y25]
 gi|308755833|gb|ADO43762.1| OstA-like protein [Ketogulonicigenium vulgare Y25]
          Length = 160

 Score = 88.1 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 63/166 (37%), Gaps = 10/166 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N +     + A    L  A L    +  M   +   ++ + I ++ L V    Q A F 
Sbjct: 1   MNWLRPLGLVAA--MSLSPAALLAQTSIAMPGMRADPSQPVEITSETLNVNQGSQTAIFS 58

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV + Q D  + A    + Y++    V+++I R+ +E  +   +      +     D  
Sbjct: 59  GNVVIIQGDIRIGAQIANVSYSS----VTSQITRILLEGGVTFTTPTEAAESDRATYDIG 114

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
              LVL  +    V+L +        ++  ++    A L G    +
Sbjct: 115 DGALVLEDN----VLLTQGGLIMASDRMAADLAAGTAQLDGNVRTR 156


>gi|239996753|ref|ZP_04717277.1| OstA-like protein [Alteromonas macleodii ATCC 27126]
          Length = 184

 Score = 88.1 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 59/166 (35%), Gaps = 9/166 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L  + L   A+  +   +   ++ I I ++   +    + A +K +V +TQ    ++
Sbjct: 5   LIPLATSLLLAIASGAVHASEDDFSQPIKIGSNTQFIDGKNKTALYKDDVLITQGSLVIE 64

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRAD 136
           AD++ +   +                +  ++ G      A+    +   R + L G+   
Sbjct: 65  ADEVEVIATDGGGREIFIARGKPASYSQQLEDGTPVSAKANEIRYEVVNRTISLAGNAE- 123

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRYD 178
              LK+  +   G  +  ++ T      G        +V ++   +
Sbjct: 124 ---LKQDTSKVQGDNITFDMITEQLLATGGAGKDGEGRVTTVFTPE 166


>gi|157963428|ref|YP_001503462.1| cell envelope biogenesis YhbN [Shewanella pealeana ATCC 700345]
 gi|157848428|gb|ABV88927.1| Cell envelope biogenesis YhbN [Shewanella pealeana ATCC 700345]
          Length = 179

 Score = 88.1 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 56/168 (33%), Gaps = 15/168 (8%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +LA +F LL            T       +++ I A   E      +  F G V +TQ  
Sbjct: 7   ILAGLFCLLSFS--------STAKVDDLLQEVKIAAASQEADIKNNQVIFFGPVEVTQGS 58

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNG 132
             + AD++ +         +             ++ G      A     +   R L L G
Sbjct: 59  IKMNADELRVFSKEDKSGKTLVATGNPATYTQMMEDGRPATASAKEIRYELATRTLTLVG 118

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
           +      L +  +   G ++  NI      A   G   D+V +II+ +
Sbjct: 119 EA----TLAQDGSQVTGNRIKYNISLQQLIAESTGKGDDRVITIIQPE 162


>gi|289676084|ref|ZP_06496974.1| OstA-like protein [Pseudomonas syringae pv. syringae FF5]
 gi|330895270|gb|EGH27608.1| OstA-like protein [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330937988|gb|EGH41771.1| OstA-like protein [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330969689|gb|EGH69755.1| OstA-like protein [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330981130|gb|EGH79233.1| OstA-like protein [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 173

 Score = 88.1 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 52/164 (31%), Gaps = 14/164 (8%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +   ++         ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N
Sbjct: 6   AALGSASAWSLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRN 65

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                                   +      A        +  +VL     DK  +    
Sbjct: 66  AQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVINDG 121

Query: 145 NTFLGCKLIVNIDTSFASLQGCESD--------QVQSIIRYDGR 180
           NT  G K++ +      +               ++  +I+   +
Sbjct: 122 NTSEGEKIVYDTVRQVVTAGRANGGAKVTTPRPRIDMVIQPKKK 165


>gi|330501874|ref|YP_004378743.1| OstA family protein [Pseudomonas mendocina NK-01]
 gi|328916160|gb|AEB56991.1| OstA family protein [Pseudomonas mendocina NK-01]
          Length = 179

 Score = 88.1 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 48/153 (31%), Gaps = 13/153 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I I+AD  E+ D    A ++G+V +TQ    +  D +TI    +         
Sbjct: 26  PSDRDQPIRIQADSAELDDKQGVAVYRGDVIITQGTLKITGDTVTITQTASGDIDVFTSV 85

Query: 98  RMDVERNIFIQSGEI--NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                        +                  +VL         + ++ NTF G K++ +
Sbjct: 86  GNLAYYEQKPAVDKDIVKAYGKTIQYFASNERIVLIDQAK----VIQEGNTFEGEKIVYD 141

Query: 156 IDTSFASLQGCESDQVQS-------IIRYDGRP 181
                 +        V +       +I+   +P
Sbjct: 142 TRRQIVNAGRATGGNVSTPRPRIDMVIQPKNKP 174


>gi|94265427|ref|ZP_01289179.1| OstA-like protein [delta proteobacterium MLMS-1]
 gi|93454084|gb|EAT04419.1| OstA-like protein [delta proteobacterium MLMS-1]
          Length = 242

 Score = 88.1 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 67/173 (38%), Gaps = 18/173 (10%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +  +  L+   +S   A+            I I+AD +E  +      F G V   Q+  
Sbjct: 52  MRYLLFLIFGSISLLLAATAAAT------PIQIEADRMESVEGTNAILFTGQVVAQQQGL 105

Query: 75  SLQADKMTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           ++ +D+MT+ Y +             ++ ++    N+ I+S + +           +R++
Sbjct: 106 TVYSDEMTVHYFSDEEQAALADDDQRRLKKLFATGNVRIESDDFSGTGQRMDYFEVERVV 165

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ--GCESDQVQSIIRYDG 179
            L+G+        ++ N   G K+ + +D   +  +  G    +V++    D 
Sbjct: 166 HLSGNARA----WQEGNLVTGDKITMYLDEGKSIAEYDGKSDQRVRAFFFSDD 214


>gi|298369555|ref|ZP_06980872.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298282112|gb|EFI23600.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 174

 Score = 87.7 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 59/156 (37%), Gaps = 14/156 (8%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNTNRD 91
                +    + I I+AD   +  A Q   F GNV + Q   +L+A  + +   +   + 
Sbjct: 18  PAFALQSDSKQPIQIEADQGSLDQAKQVTHFSGNVIIKQGTLNLRAANVRVSRNDKGEQF 77

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           ++   + +   + +    G +N  A+N        I+ L G+      ++   +   G  
Sbjct: 78  MAADGSPVKFSQTLDDNQGVVNGQANNAEYSSATGIVKLTGNAK----VQRGGDVAQGAV 133

Query: 152 LIVNIDTSFASLQGC---------ESDQVQSIIRYD 178
           +  N+ T   ++ G          +S +V  +I+  
Sbjct: 134 ITYNMRTEVYNIIGGGKSSAKAGTKSGRVSVVIQPS 169


>gi|167835390|ref|ZP_02462273.1| hypothetical protein Bpse38_02796 [Burkholderia thailandensis
           MSMB43]
          Length = 221

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 60/166 (36%), Gaps = 15/166 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +    
Sbjct: 34  APAAHAEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGY 93

Query: 91  D----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-- 144
                 ++        +        I+  A     D ++ +  L  +   + +  +    
Sbjct: 94  QYATATASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGQSTVA 153

Query: 145 NTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
           +T  G  +  +    F + +G +          +V++++   +G P
Sbjct: 154 DTVHGSVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTPKNGGP 199


>gi|71274806|ref|ZP_00651094.1| OstA-like protein [Xylella fastidiosa Dixon]
 gi|71900940|ref|ZP_00683054.1| OstA-like protein [Xylella fastidiosa Ann-1]
 gi|170729946|ref|YP_001775379.1| hypothetical protein Xfasm12_0758 [Xylella fastidiosa M12]
 gi|71164538|gb|EAO14252.1| OstA-like protein [Xylella fastidiosa Dixon]
 gi|71729299|gb|EAO31416.1| OstA-like protein [Xylella fastidiosa Ann-1]
 gi|167964739|gb|ACA11749.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 176

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 59/163 (36%), Gaps = 12/163 (7%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKD-AVQKAFFKGNVFMTQEDF 74
             +F LL   LS  A S         N+ + I +   E       KA + GNV + Q   
Sbjct: 9   FFLFPLLFTPLSATAKS------SDRNQPMTIDSATQEGNMLGDGKAHYSGNVVIQQGSL 62

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
              AD   +   N + D    I +    +        ++  A N     ++ I++L G+ 
Sbjct: 63  EAHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQADNIDYKVKEGIIILTGNY 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                ++       G ++I N  T      G +  +V++ I+ 
Sbjct: 123 K----VESPKGNNTGQRMIYNTQTGDMR-SGNDGTRVRTTIQP 160


>gi|289627572|ref|ZP_06460526.1| OstA family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646998|ref|ZP_06478341.1| OstA family protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|302185310|ref|ZP_07261983.1| OstA family protein [Pseudomonas syringae pv. syringae 642]
 gi|320330040|gb|EFW86027.1| OstA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330875122|gb|EGH09271.1| OstA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330888618|gb|EGH21279.1| OstA family protein [Pseudomonas syringae pv. mori str. 301020]
 gi|330950270|gb|EGH50530.1| OstA family protein [Pseudomonas syringae Cit 7]
 gi|331011537|gb|EGH91593.1| OstA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 173

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 52/164 (31%), Gaps = 14/164 (8%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           +   ++         ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N
Sbjct: 6   AALGSASAWSLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRN 65

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKL 144
                                   +      A        +  +VL     DK  +    
Sbjct: 66  AQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVINDG 121

Query: 145 NTFLGCKLIVNIDTSFASLQGCESD--------QVQSIIRYDGR 180
           NT  G K++ +      S               ++  +I+   +
Sbjct: 122 NTSEGEKIVYDTVRQVVSAGRANGGAKVTTPRPRIDMVIQPKKK 165


>gi|157165382|ref|YP_001467170.1| cell envelope biogenesis protein YhbN [Campylobacter concisus
           13826]
 gi|112801410|gb|EAT98754.1| lipopolysaccharide transport periplasmic protein LptA
           [Campylobacter concisus 13826]
          Length = 158

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 62/154 (40%), Gaps = 4/154 (2%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF-SLQADKMTIDYN 86
            A  + +  F  L  E++ I ++     +  Q + F GNV + +  +  L+A+K+ + ++
Sbjct: 6   AAILAVILGFTFLNAEQVEITSNDFFADENKQISEFVGNVNIKKGSYDELKANKVVVHFD 65

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
              + V       +    IF++    +        +  K+   + G+     +  +K   
Sbjct: 66  KKRQPVKYVATG-NARAKIFMKDKHYDGKGDTLTYEPAKQTYTVTGNGYLHEVETDKN-- 122

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             G K++VN      S+   E   V+ I + + +
Sbjct: 123 VYGDKIVVNQKDGTYSVNSDEKKPVKFIFQIEDK 156


>gi|254453115|ref|ZP_05066552.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           238]
 gi|198267521|gb|EDY91791.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           238]
          Length = 143

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 55/153 (35%), Gaps = 12/153 (7%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           +       +          + I AD L +  A   A F GNV   Q D  L A ++ + Y
Sbjct: 1   MFAQTDINLGAINADPTAPVEITADSLSIDQASGTAIFIGNVVFGQGDLRLNAARVQVIY 60

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           N+     S  I+R+     +   +      A     +     L L GD    V+L +  +
Sbjct: 61  ND----ASGDISRLSASGGVTFATATEAAEALTADYNLDTGTLELAGD----VLLTQGAS 112

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
                 + VN+    A ++G    +V++I    
Sbjct: 113 AISSDTMRVNLSDGSAQMEG----RVRTIFNQG 141


>gi|154174256|ref|YP_001407907.1| cell envelope biogenesis protein YhbN [Campylobacter curvus 525.92]
 gi|112803366|gb|EAU00710.1| cell envelope biogenesis protein YhbN [Campylobacter curvus 525.92]
          Length = 161

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 59/159 (37%), Gaps = 4/159 (2%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF-SLQADKM 81
            A            F  L  E++ I ++     +  Q + F GNV + +  +  L A+K+
Sbjct: 4   AAKAVALGLFAALNFTTLHAEQVEITSNSFFADENKQISEFTGNVHIKKGAYDELFANKV 63

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
            + ++   + +       +    I ++    +        +   +   + G+     +  
Sbjct: 64  IVYFDTKRQPIKYVATG-NARAKIAMKDKHYDGKGDTLTYEPATQTYTVTGNGHLHEVET 122

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           +K     G K++VN ++   ++   E   V+ I + + +
Sbjct: 123 DKN--VYGEKIVVNQNSGTYNVNSDEKKPVKFIFQIEDK 159


>gi|329888478|ref|ZP_08267076.1| ostA-like family protein [Brevundimonas diminuta ATCC 11568]
 gi|328847034|gb|EGF96596.1| ostA-like family protein [Brevundimonas diminuta ATCC 11568]
          Length = 162

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 66/173 (38%), Gaps = 13/173 (7%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +++    L +   +L   L+  A S          + +   AD  E          +G  
Sbjct: 1   MNMSKSKLTIAGAVLMTALALPAVSGAQNRADASRQPVQYGADSGEYTPDG--FSLRGRA 58

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            +TQ    L+AD +           + ++NR++    ++  + + ++             
Sbjct: 59  EVTQGGNRLRADAIRGFT------ANGELNRIEANGGVYFVTPDQSMKGDRAVYTLNDGN 112

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE-SDQVQSIIRYDG 179
           +V+ GD    VIL +  +   G +L+ N+ T  A ++G   + +VQ +    G
Sbjct: 113 VVVTGD----VILTQGKSVLTGNRLVYNVRTETARIEGGGANGRVQGVFYPQG 161


>gi|254447024|ref|ZP_05060491.1| cell envelope biogenesis protein YhbN [gamma proteobacterium
           HTCC5015]
 gi|198263163|gb|EDY87441.1| cell envelope biogenesis protein YhbN [gamma proteobacterium
           HTCC5015]
          Length = 171

 Score = 87.7 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 55/154 (35%), Gaps = 11/154 (7%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            +     +      I + AD  E + A   A + GNV++ Q    ++ADKM +  +    
Sbjct: 18  PTASLALENDSTAPIKVSADKAEFQQAKGSAIYTGNVYLQQGSIEIRADKMELIADQGVL 77

Query: 91  DVSNKINRMDVERNIFIQSG-----EINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
             +      + ++   ++            A   +++     + L G+      L +  +
Sbjct: 78  KEAYVFGGSEDKQRALLKQKNEDGSWTEGQAEQIHIEQASGDIELKGNAR----LDDGNS 133

Query: 146 TFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRY 177
           T  G  +  N       A   G  SD+V+ I + 
Sbjct: 134 TIKGPLIHYNSRQQTVEAQSDGDNSDRVEMIFKP 167


>gi|167561501|ref|ZP_02354417.1| hypothetical protein BoklE_02989 [Burkholderia oklahomensis EO147]
          Length = 221

 Score = 87.7 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 56/161 (34%), Gaps = 14/161 (8%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +    
Sbjct: 34  APAAHAEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGY 93

Query: 91  D----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKL 144
                 +         +        I+  A     D ++ +  L  +   + +  L    
Sbjct: 94  QYATATAGGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGLSTVA 153

Query: 145 NTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
           +T  G  +  +    F + +G +          +V++++  
Sbjct: 154 DTVHGSVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 194


>gi|70728299|ref|YP_258048.1| ostA family protein [Pseudomonas fluorescens Pf-5]
 gi|68342598|gb|AAY90204.1| ostA family protein [Pseudomonas fluorescens Pf-5]
          Length = 181

 Score = 87.3 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 60/179 (33%), Gaps = 15/179 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L+  + +LL    +  + S          + I I+AD  ++ D    A +KG+V +TQ
Sbjct: 1   MRLVKTLPILLSLGAALGSVSAW-ALPNDSQQPIRIQADDAQLDDKNGVATYKGDVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI---FIQSGEINVIASNGYVDFQKRIL 128
               +  + +TI  + T                          +   A       Q+  +
Sbjct: 60  GSMKITGNTVTITRSKTGEIDVVTSVGNLAYFEQLQKQTDPKPVQAYAVTIQYHAQQNRI 119

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-------QVQSIIRYDGR 180
           VL     DK  +    NT  G K++ +     A+              ++  +I+   +
Sbjct: 120 VLI----DKAKVINDGNTTEGEKIVYDTVKQVANAGRANGSSVTAPRPRIDMVIQPKKK 174


>gi|258591943|emb|CBE68248.1| putative OstA-like protein precursor [NC10 bacterium 'Dutch
           sediment']
          Length = 187

 Score = 87.3 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 59/163 (36%), Gaps = 10/163 (6%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM--TQEDF 74
              V++  +L+        + +  G   + I +D LEV   +  A + GNV       D 
Sbjct: 7   FAAVVMLVNLAVPLGLGFAQEQPKGKYPVTITSDRLEVNRKLHTAIYTGNVMADDKDRDM 66

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            + ADKM   ++     +   I       N+     E  V A    +   +   VL G+ 
Sbjct: 67  VVLADKMEFLFDEKMERIQKGI----ATGNVRATIKEKRVTADQLELFPDEDKAVLTGNP 122

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
                  +  +   G K+ +      A ++G  S +V +I+  
Sbjct: 123 RA----WQDNDLVTGTKMTIFSKEDRAIVEGEPSKRVTAILYP 161


>gi|332140247|ref|YP_004425985.1| OstA-like protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550269|gb|AEA96987.1| OstA-like protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 184

 Score = 87.3 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 22/166 (13%), Positives = 62/166 (37%), Gaps = 9/166 (5%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L  + L   A+  ++  +   ++ I I ++   +    + A +K +V +TQ    ++
Sbjct: 5   LIPLATSLLLVIASGAVSASEDDFSQPIKIGSNTQFIDGKNKTALYKEDVLITQGSLVIE 64

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRAD 136
           AD++ +  +  +              +  ++ G      A+    +   R + L+G+   
Sbjct: 65  ADEVEVIASEGSGREIFIARGKPASYSQTLEDGTPVSAKANEIRYEVINRTISLSGNAE- 123

Query: 137 KVILKEKLNTFLGCKLIVNIDTSFASLQGCES----DQVQSIIRYD 178
              L++  +   G  +  ++ T      G        +V ++   +
Sbjct: 124 ---LQQDTSKVQGDNITFDMITEQLLATGGAGENGEGRVTTVFTPE 166


>gi|294625297|ref|ZP_06703935.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665380|ref|ZP_06730669.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600418|gb|EFF44517.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604839|gb|EFF48201.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 166

 Score = 87.3 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 51/144 (35%), Gaps = 7/144 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
                 N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D  
Sbjct: 2   AKTSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRV 61

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
               +    +        ++  A N        I++L G+      +     T  G +++
Sbjct: 62  VLNGKQATLKQEMDDGATMHGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMV 117

Query: 154 VNIDTSFASLQGCESDQVQSIIRY 177
            N  T      G +  +V+++I+ 
Sbjct: 118 YNTKTGNMQ-SGGDGSRVRTVIQP 140


>gi|301062327|ref|ZP_07202990.1| lipopolysaccharide transport periplasmic protein LptA [delta
           proteobacterium NaphS2]
 gi|300443531|gb|EFK07633.1| lipopolysaccharide transport periplasmic protein LptA [delta
           proteobacterium NaphS2]
          Length = 167

 Score = 87.3 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 62/165 (37%), Gaps = 10/165 (6%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +     +   AS   + +      + IK+  LE  D  +K  F+G+V   ++DF++   +
Sbjct: 1   MWVFSGAALCASSFAKSQNKPQGPMVIKSKTLEADDNKKKVTFEGDVEAKRDDFTVFCQE 60

Query: 81  MTIDYNNTNRDVSNKI------NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           + + Y   +     +         +       I++              +   LVL G  
Sbjct: 61  LVVLYEKPSEQKETEKVSARIDKIIATGGVKIIRAEGGVATGEKAVFHQKDEKLVLTGKP 120

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
               ++K+  +   G  + + +  + + ++   + +V+++I  + 
Sbjct: 121 ----VVKQGEDFVEGDVITLFLKENRSVVESAGNKKVRAVIFPNK 161


>gi|240116369|ref|ZP_04730431.1| hypothetical protein NgonPID1_09066 [Neisseria gonorrhoeae PID18]
 gi|240128868|ref|ZP_04741529.1| hypothetical protein NgonS_09638 [Neisseria gonorrhoeae SK-93-1035]
 gi|260439812|ref|ZP_05793628.1| hypothetical protein NgonDG_01757 [Neisseria gonorrhoeae DGI2]
 gi|268602036|ref|ZP_06136203.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268687250|ref|ZP_06154112.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043082|ref|ZP_06568805.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268586167|gb|EEZ50843.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268627534|gb|EEZ59934.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012688|gb|EFE04671.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 176

 Score = 87.3 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 52/159 (32%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A S     +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  ATSPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVIIRQGTLNISASRVNVTRGGKG 75

Query: 90  RDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            +                   G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          ++ +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSTKSGAKSASKTGRVSVVIQPS 170


>gi|330877184|gb|EGH11333.1| ostA family protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 173

 Score = 87.3 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 25/167 (14%), Positives = 52/167 (31%), Gaps = 14/167 (8%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
              +   ++         ++ IHI++D  ++ D    A ++GNV +TQ    +  + +TI
Sbjct: 3   GLSAALGSASAWSLPNDRDQPIHIQSDDAQLDDKKGVATYRGNVIITQGSMKVTGNTVTI 62

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILK 141
             N                        +      A        +  +VL     DK  + 
Sbjct: 63  TRNAQGEVDVFTSVGNLAYYEQKPAPDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVI 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESD--------QVQSIIRYDGR 180
              NT  G K++ +      S               ++  +I+   +
Sbjct: 119 NDGNTSEGEKIVYDTVRQVVSAGRANGGTKLTAPRPRIDMVIQPKNK 165


>gi|218885533|ref|YP_002434854.1| OstA family protein [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756487|gb|ACL07386.1| OstA family protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 224

 Score = 87.3 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 72/196 (36%), Gaps = 34/196 (17%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
               +AL+       ++  A S     +V  +    +K+D ++     Q   F+G+V++ 
Sbjct: 8   SALCVALLLTFSAPAMAADAKSAT---EVRRDVPTAVKSDRMQYDAKGQVVIFEGDVYVQ 64

Query: 71  QEDFSLQADKMTIDYNNT---------------------------NRDVSNKINRMDVER 103
           + DF + A+K+T+                                +   + +I+RM  ER
Sbjct: 65  RPDFEMWAEKITLHLRKKAAKPGKAGAGQGADASGAAGQSGAAGMSGMDAGEIDRMVAER 124

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + ++                  +LV+ G+     +L E  N+  G  +      + + +
Sbjct: 125 KVRMKRENRTGECEKATYTVDNAVLVMEGNP----VLHEGENSIRGDVITFYTRENRSEV 180

Query: 164 QGCESDQVQSIIRYDG 179
           +G  + +VQ++    G
Sbjct: 181 RGTSTKRVQAVFTSSG 196


>gi|323144373|ref|ZP_08078981.1| lipopolysaccharide transport periplasmic protein LptA
           [Succinatimonas hippei YIT 12066]
 gi|322415826|gb|EFY06552.1| lipopolysaccharide transport periplasmic protein LptA
           [Succinatimonas hippei YIT 12066]
          Length = 173

 Score = 87.3 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 57/179 (31%), Gaps = 16/179 (8%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + +  L + + A +                   +   ++ +++ +          K  F 
Sbjct: 1   MRTTSLKLSVAAFLLFSPVY--------TALALESDYSKPVNVLSVEQFADLKANKVIFS 52

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVS-NKINRMDVERNIFIQSGEINVIASNGYVDF 123
           GNV  TQ    + ADK+ I  ++  +               +      I+  ++    + 
Sbjct: 53  GNVVATQGTMKITADKVEITRDDEGKLKMVTAYGSPTTFEQMMENGKPIHSRSATINYEP 112

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL---QGCESDQVQSIIRYDG 179
            K ++VL G    K  + +  +  +G ++  N+ T           +  +V S      
Sbjct: 113 NKNLIVLTG----KATVWQGESRMVGERIEYNVKTQTMRANNKTKSQGGRVSSTFIPSD 167


>gi|163749270|ref|ZP_02156519.1| hypothetical protein KT99_08408 [Shewanella benthica KT99]
 gi|161330989|gb|EDQ01915.1| hypothetical protein KT99_08408 [Shewanella benthica KT99]
          Length = 218

 Score = 87.3 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 55/159 (34%), Gaps = 5/159 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L+ A L    +      +    +++ I A   E      +  F G V +TQ   ++ AD+
Sbjct: 6   LIIAALLCTTSFSGMTKQDDLMQEVKISAASQEADIKNNQMIFHGPVEVTQGSITILADE 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +                      +  ++ G   +  A     +   R L L G+      
Sbjct: 66  LRATSKEDGGGKILIAIGNPATYSQIMEDGRPASASAKEIRYELSSRTLTLVGNA----T 121

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           L++  +   G  +  NI       +   +++V +II+ +
Sbjct: 122 LEQDGSRVTGNMIRYNIAKQQLIAESIGNERVITIIQPE 160


>gi|83721552|ref|YP_441045.1| OstA-like protein [Burkholderia thailandensis E264]
 gi|167579777|ref|ZP_02372651.1| OstA-like protein [Burkholderia thailandensis TXDOH]
 gi|167617852|ref|ZP_02386483.1| OstA-like protein [Burkholderia thailandensis Bt4]
 gi|257140302|ref|ZP_05588564.1| OstA-like protein [Burkholderia thailandensis E264]
 gi|83655377|gb|ABC39440.1| OstA-like protein [Burkholderia thailandensis E264]
          Length = 221

 Score = 87.3 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 60/166 (36%), Gaps = 15/166 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +    
Sbjct: 34  APAAHAEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGY 93

Query: 91  D----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-- 144
                 ++        +        I+  A     D ++ +  L  +   + +  +    
Sbjct: 94  QYATATASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGQSTVA 153

Query: 145 NTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
           +T  G  +  +    F + +G +          +V++++   +G P
Sbjct: 154 DTVHGSVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTPKNGGP 199


>gi|134279896|ref|ZP_01766608.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           305]
 gi|134249096|gb|EBA49178.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           305]
          Length = 221

 Score = 87.3 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 22/163 (13%), Positives = 57/163 (34%), Gaps = 14/163 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
             A      K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +  
Sbjct: 32  GLAPAAHAEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQ 91

Query: 89  NRD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKE 142
                   ++        +        I+  A     D ++ +  L  +   + +  +  
Sbjct: 92  GYQYATATASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVST 151

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +T  G  +  +    F + +G +          +V++++  
Sbjct: 152 VADTVHGSVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 194


>gi|153834589|ref|ZP_01987256.1| cell envelope biogenesis protein YhbN [Vibrio harveyi HY01]
 gi|148869032|gb|EDL68077.1| cell envelope biogenesis protein YhbN [Vibrio harveyi HY01]
          Length = 164

 Score = 86.9 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNK 95
           K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +           
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPKTESIKQIQA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +      +      ++  A+          L + G       L +  NT  G  +   
Sbjct: 82  FGKPATFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDGNTIKGSSIRYQ 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I          + ++V +I++ +
Sbjct: 138 IGQQKLVADSSKDERVTTILQPN 160


>gi|167568730|ref|ZP_02361604.1| hypothetical protein BoklC_02719 [Burkholderia oklahomensis C6786]
          Length = 221

 Score = 86.9 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 56/161 (34%), Gaps = 14/161 (8%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +    
Sbjct: 34  APAAHAEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGY 93

Query: 91  D----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKL 144
                 +         +        I+  A     D ++ +  L  +   + +  L    
Sbjct: 94  QYATATAGGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGLSTVA 153

Query: 145 NTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
           +T  G  +  +    F + +G +          +V++++  
Sbjct: 154 DTVHGSVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 194


>gi|319940820|ref|ZP_08015159.1| hypothetical protein HMPREF9464_00378 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805702|gb|EFW02483.1| hypothetical protein HMPREF9464_00378 [Sutterella wadsworthensis
           3_1_45B]
          Length = 198

 Score = 86.9 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 52/151 (34%), Gaps = 11/151 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I + AD  +  +  Q A + GNV + Q    +   ++ +         +    
Sbjct: 23  STDRDQAIEVHADRFDGDEVKQTAVYTGNVIVDQGSMQITGARLEVRITPKGYRQATVTG 82

Query: 98  RMDVERNIFIQ------SGEINVIASNGYVDFQKRILVLNGDRADKVILK-EKLNTFLGC 150
                R           +  ++  AS    D +   + L G          ++ +   G 
Sbjct: 83  EPSRFRQQRDPDPKNPINEWMHARASKIVYDEETDTVTLIGAAYLSRTENGKERDMTEGE 142

Query: 151 KLIVNIDTSFASLQG----CESDQVQSIIRY 177
           +++ ++  + + ++G     E  +V +II  
Sbjct: 143 RIVYDMRNARSKVEGSTVKGEKQRVTTIIAP 173


>gi|319786673|ref|YP_004146148.1| lipopolysaccharide transport periplasmic protein LptA
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465185|gb|ADV26917.1| lipopolysaccharide transport periplasmic protein LptA
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 174

 Score = 86.9 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/146 (14%), Positives = 51/146 (34%), Gaps = 6/146 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQ-KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                 N+ + I +   E       +  F GNV + Q    + A +  I       +   
Sbjct: 29  GKSSDRNQPMTIDSGASECSQGGNMQCVFTGNVEIVQGSLRINAARAEIIQRGEQIEQVI 88

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
              +    +        +N  A     + +K +L L G+      ++    +  G +++ 
Sbjct: 89  LTGKQATMQQDMDDGSTMNARADRIVYEPKKELLTLTGNYQ----VESPRGSNSGQRMVY 144

Query: 155 NIDTSFASLQGCESDQVQSIIRYDGR 180
           N+ +      G +  +V+++I+   +
Sbjct: 145 NMASGQMQ-SGGDGTRVRTVIQPRAQ 169


>gi|315121908|ref|YP_004062397.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495310|gb|ADR51909.1| OstA family protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 155

 Score = 86.9 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 70/154 (45%), Positives = 108/154 (70%), Gaps = 7/154 (4%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           LS+A +SY + FK+  +++I+I +D L+V+D ++KA F+G V +TQ D ++QA+++ + Y
Sbjct: 5   LSRAESSYFSSFKIGRDQEIYIHSDTLDVQDDLKKASFRGGVTVTQGDTNMQAEEIILHY 64

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
            +     S++++RMD+  N+ I S +   +A NGY DFQK+ILVL GD   KVI +E +N
Sbjct: 65  TD----SSDQLSRMDMRNNVIINSDKNKAMAKNGYCDFQKKILVLYGD---KVIFQEGMN 117

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           TFLGC+L V +D   A LQGC S QV+SII+Y+ 
Sbjct: 118 TFLGCRLTVKLDVGTAYLQGCGSQQVKSIIKYNK 151


>gi|317153185|ref|YP_004121233.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943436|gb|ADU62487.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 315

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 63/151 (41%), Gaps = 7/151 (4%)

Query: 28  QAAASYMTRFKVLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY- 85
            +      +  V  ++  + I +D +   +  +   F GNV     + +L A++++  + 
Sbjct: 160 ASTPPEPIQVGVDPSQVPVKITSDRMTYDENGKVVSFVGNVVAVHGELTLWANRLSAFFS 219

Query: 86  -NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
             +  +   + I+R+  E ++  Q G+            +++IL +  D     ILK+  
Sbjct: 220 SRSGKKFAVDSIDRIVAEGDVRAQKGKTEGSCGKLTYLVEEQILKMEEDP----ILKDGP 275

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           N+  G  +   +  + + +   +  +VQ+I 
Sbjct: 276 NSLTGNVINFFVRENRSEVVSGQGKRVQAIF 306


>gi|269960368|ref|ZP_06174742.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834979|gb|EEZ89064.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 164

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNK 95
           K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +           
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPKTESIKQIQA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +      +      ++  A+          L + G       L +  NT  G  +   
Sbjct: 82  FGKPAKFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDGNTIKGSSIRYQ 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I          + ++V +I++ +
Sbjct: 138 IGQQKLVADSSKDERVTTILQPN 160


>gi|90408213|ref|ZP_01216380.1| hypothetical protein PCNPT3_11434 [Psychromonas sp. CNPT3]
 gi|90310659|gb|EAS38777.1| hypothetical protein PCNPT3_11434 [Psychromonas sp. CNPT3]
          Length = 177

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 62/176 (35%), Gaps = 18/176 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  I + +   AL+F L    L           +    + IH+ +     K       F 
Sbjct: 1   MKKIKIGLISSALLFSLSAWAL-----------ESDYVKPIHVSSISQHAKMKNNSITFV 49

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDF 123
            +V +TQ    ++ADK+ +                        + G   N  A++ + D 
Sbjct: 50  DDVLLTQGSIIIKADKLIVTRTAQPNHEQMLAKGNVATFYQTQEDGRPFNAQANSIHYDV 109

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY 177
            K  + L G+      +K+  +   G K+I  ++T    +   ++   +V+++   
Sbjct: 110 AKSKITLTGNAQ----VKQLDSRINGAKIIYYLNTEELIVMSDKNNEKRVKTVFLP 161


>gi|294341474|emb|CAZ89891.1| conserved hypothetical protein OstA-like protein [Thiomonas sp.
           3As]
          Length = 211

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 63/178 (35%), Gaps = 21/178 (11%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           + L+ +L    L+      +   +   N+ IHI+AD +   D  Q + F GNV +T+   
Sbjct: 9   ILLLTLLCAPSLAL----PVLAAQTDRNQPIHIEADAMRYDDVHQTSVFTGNVVVTKGSL 64

Query: 75  SLQADKMTIDYNNTNRD--------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
            L+A  + +                      +  ++      +  ++  A     D +  
Sbjct: 65  VLRAATVDVRQAPDGYQYATAIAAPGQLATFQQQLDTAPGQPTQTMDGAAQRIEYDGKTD 124

Query: 127 ILVLNGDRADKVILKEK-LNTFLGCKLIVNIDTSFASLQGC--------ESDQVQSII 175
           ++ L G      ++  K  +   G  +  N  T   +++G            +V+ ++
Sbjct: 125 VVTLRGQAMLSRLIDGKLADRSQGNVIAYNQITDVFTVEGGAQGATATNPGGRVRVML 182


>gi|21243697|ref|NP_643279.1| hypothetical protein XAC2970 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109278|gb|AAM37815.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 186

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 24  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 83

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 84  NGKQATLKQEMDDGATMHGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMVYN 139

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 140 TKTGNMQ-SGGDGSRVRTIIQP 160


>gi|330807556|ref|YP_004352018.1| hypothetical protein PSEBR_a848 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375664|gb|AEA67014.1| Conserved hypothetical protein; putative exported protein,
           OstA-like protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 182

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 59/179 (32%), Gaps = 14/179 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L   + +LL    +  +AS         N+ I I+AD  ++ D    A +KG+V +TQ
Sbjct: 1   MKLAKTLPILLSLGAALGSASAW-ALPDDRNQPIRIQADDAQLDDKNGVATYKGDVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN---VIASNGYVDFQKRIL 128
               +  + +TI    +                    +G+                +  +
Sbjct: 60  GSMKVTGNTVTITRTPSGDIDVVTSVGNLAYFEQLQTAGDTKPVQGYGVTIQYHAAQDRV 119

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDGR 180
           VL        ++ +  N   G K++ +     AS       +V         +I+   +
Sbjct: 120 VLIDRAK---VVDKDNNVTQGEKIVYDTVKKLASAGRATGSKVTESRPRIDMVIQPKKK 175


>gi|289667912|ref|ZP_06488987.1| hypothetical protein XcampmN_05253 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 183

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 81  NGKQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 137 TKTGNMQ-SGGDGSRVRTIIQP 157


>gi|289664523|ref|ZP_06486104.1| putative secreted protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 183

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 81  NGKQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 137 TKTGNMQ-SGGDGSRVRTIIQP 157


>gi|167844253|ref|ZP_02469761.1| hypothetical protein BpseB_03109 [Burkholderia pseudomallei B7210]
          Length = 193

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/164 (13%), Positives = 57/164 (34%), Gaps = 14/164 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
              A      K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  + 
Sbjct: 3   AGLAPAAHAEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDP 62

Query: 88  TNRD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LK 141
                    ++        +        I+  A     D ++ +  L  +   + +  + 
Sbjct: 63  QGYQYATATASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVS 122

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
              +T  G  +  +    F + +G +          +V++++  
Sbjct: 123 TVADTVHGSVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 166


>gi|237755600|ref|ZP_04584215.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692227|gb|EEP61220.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 144

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 55/143 (38%), Gaps = 10/143 (6%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +    E + I AD LE  +  + A + G V   + +  L AD M I  ++        ++
Sbjct: 11  ETNKKEPVVITADKLEYFNKDKIAIYTGKVEAIKGNIKLNADMMKIFLDDK-----GDVS 65

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           ++    N++ +                K +++L  D      + +  N   G ++   ID
Sbjct: 66  KIIATGNVYFEQENKWGKGKEAEYYKDKNLIILRKDAE----VHQDKNVVEGDEIYYYID 121

Query: 158 TSFASLQGCESDQVQSIIRYDGR 180
              A     ++ +V+SII    +
Sbjct: 122 EEKAIATS-KTKRVRSIIFPKEK 143


>gi|118579408|ref|YP_900658.1| OstA family protein [Pelobacter propionicus DSM 2379]
 gi|118502118|gb|ABK98600.1| OstA family protein [Pelobacter propionicus DSM 2379]
          Length = 174

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/143 (23%), Positives = 62/143 (43%), Gaps = 7/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           K   N  I IKA  L   +  +KA F G V   Q D ++ +DK+TI Y        N++ 
Sbjct: 32  KDRSNLPITIKASQLTADNKGKKAVFTGKVVAKQGDITIFSDKLTIHYGTN----KNEVE 87

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +++ + N+ I        A++   D ++  + L+G       + +  ++  G  +   ID
Sbjct: 88  KIEADGNVRIVQENRVGSAAHAVYDSKEGKITLSG---GTPRVTQGADSTTGKIITYLID 144

Query: 158 TSFASLQGCESDQVQSIIRYDGR 180
              +++ G     V +II    R
Sbjct: 145 DERSTVTGDAGAPVVTIIHPRER 167


>gi|91225584|ref|ZP_01260658.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           12G01]
 gi|269968003|ref|ZP_06182041.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           40B]
 gi|91189704|gb|EAS75978.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           12G01]
 gi|269827360|gb|EEZ81656.1| putative ABC superfamily transport protein [Vibrio alginolyticus
           40B]
          Length = 164

 Score = 86.5 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 50/143 (34%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNK 95
           K    + ++I +D  +V     +  F+G+V + Q   ++ AD++ +  +           
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVVFEGDVSLKQGSINIDADRIVVTRDPKTEAIKQIQA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +      +      ++  A+          L + G       L +  NT  G  +   
Sbjct: 82  FGKPAKFSQLMDDGKTLSGQATELDYRISTDELTMKGQAQ----LAQDNNTIKGSSIRYQ 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I          + ++V +I++ +
Sbjct: 138 IGKQKLVADSSKEERVTTILQPN 160


>gi|332704275|ref|ZP_08424363.1| OstA family protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332554424|gb|EGJ51468.1| OstA family protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 184

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 67/186 (36%), Gaps = 28/186 (15%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++  HL + L+      +    +QAA   +            + AD L       +A F+
Sbjct: 1   MHPSHLIVFLI-CAMAWILPITAQAAEENLV--------PTKVTADRLTYSQEGNRAVFE 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER---------------NIFIQS 109
           G V + ++D  L AD++ ID        S                         N+ ++ 
Sbjct: 52  GKVHVVRQDMELWADRIEIDLRPNGDGKSGASGPDMAFATTEGASRINRIIALGNVRMRR 111

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
           G+             K +++L GD     +LKE  NT  G ++ + I+ + + + G    
Sbjct: 112 GQSEGKCRKATYLADKSMIILEGDP----VLKEGENTLQGKEIRIYINENRSEVIGNTKR 167

Query: 170 QVQSII 175
            V+ I 
Sbjct: 168 PVEMIF 173


>gi|308051146|ref|YP_003914712.1| lipopolysaccharide transport periplasmic protein LptA [Ferrimonas
           balearica DSM 9799]
 gi|307633336|gb|ADN77638.1| lipopolysaccharide transport periplasmic protein LptA [Ferrimonas
           balearica DSM 9799]
          Length = 183

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 52/159 (32%), Gaps = 5/159 (3%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            L         ++          + I + +D            + GNV + Q    ++AD
Sbjct: 6   FLALLMTGALLSAPALALDDDYRQPIKVTSDNSSADIQSYTLIYSGNVRIVQGSMEIKAD 65

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKV 138
           ++ +  +    +               +++G      A     + + R L L+GD     
Sbjct: 66  ELKVISSAEKGNEVMIATGKPATYTQMMENGLPAEAQAKEIRYEVRTRQLTLSGDAQ--- 122

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            L +  +   G  +  N++      +G E +Q+ +I   
Sbjct: 123 -LSQAGSLMRGNTISYNVEKQQLIAEGKEDEQITTIFLP 160


>gi|158520525|ref|YP_001528395.1| OstA family protein [Desulfococcus oleovorans Hxd3]
 gi|158509351|gb|ABW66318.1| OstA family protein [Desulfococcus oleovorans Hxd3]
          Length = 198

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 61/177 (34%), Gaps = 17/177 (9%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L  +  L+   L  +A +          + IHI AD L  +     A F GNV    E F
Sbjct: 18  LLTICFLVFPALFASADTPPP--PQDDAKAIHISADRLVSESRADYAEFTGNVRAVGEKF 75

Query: 75  SLQADKMTIDYNNTNRDV------------SNKINRMDVERNIFIQSGEINVIASNGYVD 122
            +QAD + + Y+                     +  +    N+ I   +           
Sbjct: 76  DIQADTLQVFYSPAPDTQAPGTANRLDTGTGKTVREIIATGNVTILFDDKVAKTDQAVYS 135

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            +   +VL G  +    +  K     G  + ++ +T   ++      +VQ++I  DG
Sbjct: 136 RESGRVVLMGPGS---TVTGKSGRISGDTITLHTETESVTVISGGETRVQAVIHPDG 189


>gi|221236651|ref|YP_002519088.1| protein yhbN [Caulobacter crescentus NA1000]
 gi|220965824|gb|ACL97180.1| protein yhbN precursor [Caulobacter crescentus NA1000]
          Length = 186

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 68/174 (39%), Gaps = 14/174 (8%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +    L    LS A A      +    +  + + AD  E  ++     F GNV + Q   
Sbjct: 4   STAAALTALILSGAGAGGAAYAQQGNSSAPVDVSADNQETINSKCLIIFTGNVEILQNRS 63

Query: 75  SLQADKMTIDYNN----TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
            L+A+K+TI         N +      RM+ E  +++ + + N         F     VL
Sbjct: 64  RLRAEKVTIYNAKRPTAENANACGNAQRMEAEGGVYLVNEQQNARGDRAVYTFSNNTAVL 123

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-----QVQSIIRYDG 179
            GD    VIL +  +   G +L VN  T+ A L+   +      +V+++   D 
Sbjct: 124 TGD----VILVKGNDVARGDRLTVNTKTNDAKLESTSTGRTATRRVRAVFYQDD 173


>gi|300021931|ref|YP_003754542.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523752|gb|ADJ22221.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 640

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 68/161 (42%), Gaps = 18/161 (11%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY- 85
           S     +   FK   N    + +D L+V D  + A F GNV   Q +F++Q+ +MT  Y 
Sbjct: 440 SAEGIPFGQAFKTDPNAPYDVTSDRLDVDDNAKTALFTGNVVTVQGNFTIQSGEMTAYYT 499

Query: 86  -------NNTNRDVSNKINRMDVERNIFIQSGE-INVIASNGYVDFQKRILVLNGDRADK 137
                  ++        +  +  ++++ + S +          VD +  +  L G+    
Sbjct: 500 GRSGLGMSDDKAKSGASLTHIRAKKDVTVVSKDGQKASGDWAEVDVKTNLAKLGGN---- 555

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQ-----GCESDQVQS 173
           V+L +  N   G KL++++ T  A+++       ES  V +
Sbjct: 556 VVLTQGKNVVRGTKLLIDMTTGQATIKTEPTASSESSMVSA 596



 Score = 59.9 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 54/204 (26%), Gaps = 52/204 (25%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             S    +  T       E I + +  L+V D  + A F G V  TQ   +L A +M + 
Sbjct: 228 APSADQTAQPTLPFGKSGEPIDVASSRLDVDDNKKVALFTGQVTATQGGSTLVAPEMAVT 287

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSG---------------------------------- 110
           Y       +              +                                    
Sbjct: 288 YEGQVTPEAGADESKQTPAEGGTKVKQVVAKESVTLTQASGETATSRTATFDTAAQLAVL 347

Query: 111 ----------EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
                     +   +      D   + L L G     V++ +  N   G +L+ +  TS 
Sbjct: 348 EGDVVLTQGADKKAVGDRAEYDEANQKLTLTGP----VVVTQGQNVLKGRRLVYHRATSK 403

Query: 161 ASLQGC---ESDQVQSII-RYDGR 180
             L       + ++ +   +  G+
Sbjct: 404 MQLTAETETSAGRITAHFTKPAGK 427



 Score = 44.1 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 32/119 (26%), Gaps = 5/119 (4%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQS 109
           D  E  +A QK    G V +TQ    L+  ++      +   ++ +              
Sbjct: 364 DRAEYDEANQKLTLTGPVVVTQGQNVLKGRRLVYHRATSKMQLTAETETSAGRITAHFTK 423

Query: 110 GEINVIASNGYVDFQKRILVLNGDRADKVILKEKL--NTFLGCKLIVNIDTSFASLQGC 166
                 A N   D         G    +    +          +L V+ +   A   G 
Sbjct: 424 PAGKQPAKNADSD---ETGSAEGIPFGQAFKTDPNAPYDVTSDRLDVDDNAKTALFTGN 479


>gi|78048672|ref|YP_364847.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037102|emb|CAJ24847.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 186

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 24  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 83

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 84  NGKQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMVYN 139

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 140 TKTGNMQ-SGGDGSRVRTIIQP 160


>gi|166711213|ref|ZP_02242420.1| putative secreted protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 183

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 81  NGKQATLKQEMDDGAMMHGQADNIEYKVADDIIILTGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 137 TKTGNMQ-SGGDGSRVRTIIQP 157


>gi|188578112|ref|YP_001915041.1| hypothetical protein PXO_02229 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188522564|gb|ACD60509.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 179

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 81  NGKQATLKQEMDDGAMMHGQADNIEYKVADDIIILTGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 137 TKTGNMQ-SGGDGSRVRTIIQP 157


>gi|255318177|ref|ZP_05359416.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SK82]
 gi|262379614|ref|ZP_06072770.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SH164]
 gi|255304723|gb|EET83901.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SK82]
 gi|262299071|gb|EEY86984.1| lipopolysaccharide transport periplasmic protein LptA
           [Acinetobacter radioresistens SH164]
          Length = 188

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 57/186 (30%), Gaps = 16/186 (8%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           MS  LN       L   V   L    S AA           N+ I + AD     +    
Sbjct: 1   MSQALNYNRTSTFLRQAVLTALLGVTSVAAL----ALPSDRNQPISLVADRATYNEKTGI 56

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIF--IQSGEINVIASN 118
             + GNV + Q    LQA+ +    N + +  +        +         G     A  
Sbjct: 57  TTYTGNVIIEQGTMKLQANSIVAQLNKSRQISTITATGKPAKFQQQLDTNKGLARGEAQK 116

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL------QGCESDQVQ 172
              + +  I+ L+G       L +   +  G  L  +++             G  + +VQ
Sbjct: 117 IVYNAETGIITLSGGAY----LYQNGASIRGNTLRYSMNKGDIEAVGSSNSTGSSTGRVQ 172

Query: 173 SIIRYD 178
            II   
Sbjct: 173 IIIPPS 178


>gi|262393178|ref|YP_003285032.1| LptA protein [Vibrio sp. Ex25]
 gi|262336772|gb|ACY50567.1| LptA protein [Vibrio sp. Ex25]
          Length = 164

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 49/143 (34%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNK 95
           K    + ++I +D  +V     +  FKG+V + Q   ++ AD++ +  +           
Sbjct: 22  KSDTQQPVYINSDTQQVDMKSNQVIFKGDVSLKQGSINIDADRIVVTRDPKTEAIKQIQA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +      +      ++  A           L + G       L +  NT  G  +   
Sbjct: 82  FGKPAKFSQLMDDGKTLSGQAVELDYRISTDELTMKGQAQ----LAQDNNTIKGSSIRYQ 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I          + ++V +I++ +
Sbjct: 138 IGKQKLVADSSKEERVTTILQPN 160


>gi|16127831|ref|NP_422395.1| hypothetical protein CC_3601 [Caulobacter crescentus CB15]
 gi|13425347|gb|AAK25563.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 189

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/174 (22%), Positives = 68/174 (39%), Gaps = 14/174 (8%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKV-LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +    L    LS A A      +    +  + + AD  E  ++     F GNV + Q   
Sbjct: 7   STAAALTALILSGAGAGGAAYAQQGNSSAPVDVSADNQETINSKCLIIFTGNVEILQNRS 66

Query: 75  SLQADKMTIDYNN----TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
            L+A+K+TI         N +      RM+ E  +++ + + N         F     VL
Sbjct: 67  RLRAEKVTIYNAKRPTAENANACGNAQRMEAEGGVYLVNEQQNARGDRAVYTFSNNTAVL 126

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-----QVQSIIRYDG 179
            GD    VIL +  +   G +L VN  T+ A L+   +      +V+++   D 
Sbjct: 127 TGD----VILVKGNDVARGDRLTVNTKTNDAKLESTSTGRTATRRVRAVFYQDD 176


>gi|222055371|ref|YP_002537733.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. FRC-32]
 gi|221564660|gb|ACM20632.1| lipopolysaccharide transport periplasmic protein LptA [Geobacter
           sp. FRC-32]
          Length = 172

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 69/180 (38%), Gaps = 19/180 (10%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
            +N I        ++ VL     +   +  +       N+ I IK+D L    A + A F
Sbjct: 1   MINKIS---SAFTILLVLTATVFASGLSGSLR-----SNQPIKIKSDELFTDTANRTATF 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            G V   Q D  + ++K+ I Y+  ++     ++ ++   N+ +  G+    A +   D 
Sbjct: 53  VGKVSARQGDLIIYSEKLIIKYSEKDQ----DVDSVEASGNVRVIQGDRQATAGHAVYDN 108

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD---QVQSIIRYDGR 180
           +   +V          + +  N   G  +   ++   + + G  +    +V++ I   GR
Sbjct: 109 KAGKIVF----DVSPKVFQGNNIVSGKVITYFVEEQRSVVTGGGNGADARVEAEIHPRGR 164


>gi|52841073|ref|YP_094872.1| hypothetical protein lpg0837 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54296858|ref|YP_123227.1| hypothetical protein lpp0899 [Legionella pneumophila str. Paris]
 gi|52628184|gb|AAU26925.1| hypothetical protein lpg0837 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750643|emb|CAH12050.1| hypothetical protein lpp0899 [Legionella pneumophila str. Paris]
          Length = 169

 Score = 86.1 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 56/181 (30%), Gaps = 18/181 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  + +   +L L+ +   +                  + + + +D  ++     +  + 
Sbjct: 1   MTQLKVKYIILLLLMLCSISG---------NALPFDKEKMVQVVSDSADLNQKNHQGVYI 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI-----QSGEINVIASNG 119
           GNV   Q   +L+A+K     +  N+           ++  +           +  A   
Sbjct: 52  GNVEFVQGSTNLRAEKAITQGDAKNQLTLAVAEGSKDKQAHYWTTTAPDKPPFHAYADTI 111

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
                K ++ L G+      +++  N+    K+  +           E  +   II  + 
Sbjct: 112 KYYPLKHLIELIGNAR----IEQGPNSLSAAKISYDTQEQHVLSHSDEKTRTTIIIYPEK 167

Query: 180 R 180
           +
Sbjct: 168 K 168


>gi|156975896|ref|YP_001446803.1| hypothetical protein VIBHAR_03662 [Vibrio harveyi ATCC BAA-1116]
 gi|156527490|gb|ABU72576.1| hypothetical protein VIBHAR_03662 [Vibrio harveyi ATCC BAA-1116]
          Length = 164

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/143 (15%), Positives = 51/143 (35%), Gaps = 6/143 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR--DVSNK 95
           K    + ++I +D  +V     +  FKGNV + Q   ++ AD++ +  +           
Sbjct: 22  KSDTQQPVYINSDTQQVDMQSNQVTFKGNVSLKQGSINIDADRVVVTRDPKTESIKQIQA 81

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +      +      ++  A+          L + G       LK+  NT     +   
Sbjct: 82  FGKPATFSQLMDDGKTLSGQANELDYRISTDELTMKGQAQ----LKQDGNTIQSSSIRYQ 137

Query: 156 IDTSFASLQGCESDQVQSIIRYD 178
           I          ++++V +I++ +
Sbjct: 138 IGQQKLVADSSDNERVTTILQPN 160


>gi|119776218|ref|YP_928958.1| OstA-like protein [Shewanella amazonensis SB2B]
 gi|119768718|gb|ABM01289.1| OstA-like protein [Shewanella amazonensis SB2B]
          Length = 184

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 65/169 (38%), Gaps = 15/169 (8%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            +L L+       L+          K   ++++ I A         ++  ++G V +TQ 
Sbjct: 7   LILVLLCTCSAVALANT--------KFDLSQEVKIAAANSYADLKNKRIVYEGPVTLTQG 58

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLN 131
              L+A +++   +  +              +  ++ G  ++  A+    +   R++ L 
Sbjct: 59  SLVLKAGELSSFTDEKSGKRILLAKGNPATYSQQVEDGRTVHASATEISYNIDSRVMSLK 118

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTS--FASLQGCESDQVQSIIRYD 178
           G+      +++  +      ++ +I+     +   G + D+V +II+ +
Sbjct: 119 GNAK----VEQDGSQVSADSIVYDIEKQQLTSQSSGKKDDRVITIIKPE 163


>gi|148555813|ref|YP_001263395.1| OstA family protein [Sphingomonas wittichii RW1]
 gi|148501003|gb|ABQ69257.1| OstA family protein [Sphingomonas wittichii RW1]
          Length = 173

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 73/166 (43%), Gaps = 7/166 (4%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L+ VL        A +     +   +  +   AD +E++D V +A   GNV + Q D  
Sbjct: 10  LLIAVLAGTAGLAGAQTVNALKQHDSSAPVDFAADRIELQDRVDRAVLTGNVDVKQGDMR 69

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L++ ++TI Y +       ++ RMD    + + +   N  +     D + R++ + GD  
Sbjct: 70  LRSARLTIAYTS---AAQTEVTRMDASGGVVLTTSTENARSQYAIYDLRTRLVTMIGDV- 125

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQ-GCESDQVQSIIRYDGR 180
             VI++       G +L++N+++  ASL+ G    +V        R
Sbjct: 126 --VIVRAGKGETRGNRLVLNLNSGAASLEGGGAGGRVTGRFTPPPR 169


>gi|170723422|ref|YP_001751110.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida W619]
 gi|169761425|gb|ACA74741.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida W619]
          Length = 174

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 52/153 (33%), Gaps = 12/153 (7%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ I I+AD   + D    A + G+V +TQ    ++ + +T+            
Sbjct: 24  ALPTDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTMTRAANGDIDVVT 83

Query: 96  INRMDVERNIFI---QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
                          +  ++   A       QK  ++L         ++ + NT  G K+
Sbjct: 84  SVGNLAYFEQQQSAAKPDKMKGWAVTIQYQAQKDTVILTDRAK----VENEGNTTEGEKI 139

Query: 153 IVNIDTSFASLQGCES-----DQVQSIIRYDGR 180
           + N  +  A+     +      ++  +I+   +
Sbjct: 140 VYNTKSQVATAGRGGNVTQPRQRIDMVIQPKKK 172


>gi|197103639|ref|YP_002129016.1| hypothetical protein PHZ_c0173 [Phenylobacterium zucineum HLK1]
 gi|196477059|gb|ACG76587.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 175

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 61/151 (40%), Gaps = 14/151 (9%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN-- 97
             +  I + AD LEV+ +   + ++GN    Q D  L+A  M +    ++    +  +  
Sbjct: 27  SSDGPIDVTADELEVQQSECVSIWRGNAEALQGDTRLRASVMRMYMAKSSSRPGSGSSCG 86

Query: 98  ---RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
              R++ E  ++  + +  V    G  D  K  +VL GD    V+  +  N   G +++ 
Sbjct: 87  ELLRLEAEGGVYYVTPQQRVRGDRGVYDAVKETVVLTGD----VVAVQGQNVLRGSRMVF 142

Query: 155 NIDTSFASLQGCESD-----QVQSIIRYDGR 180
           N  T    ++G  +      + + +     +
Sbjct: 143 NTRTGEGKMEGQATGRNATARPRGVFYPSKK 173


>gi|307293722|ref|ZP_07573566.1| OstA family protein [Sphingobium chlorophenolicum L-1]
 gi|306879873|gb|EFN11090.1| OstA family protein [Sphingobium chlorophenolicum L-1]
          Length = 183

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 67/153 (43%), Gaps = 8/153 (5%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            ++  L  A L  A A          N  ++  AD +EV+D   +    G+V +TQ   +
Sbjct: 5   LILLSLGAAGLVYAGAGAQVLKNHDSNAPVNFTADRIEVQDRADRVIVSGHVEVTQAGMT 64

Query: 76  LQADKMTIDYNNTNRDVSN----KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
           L A +MT+ Y N     +     +I+R+D   N+ +   +     +    D   R++ + 
Sbjct: 65  LNAARMTVAYRNQPGGGTGTNGVEIDRIDASGNVVVTKADQTAKGNVAIYDLNSRLITML 124

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           G+    V L +  N   G +L++++ +  +++ 
Sbjct: 125 GN----VSLTQGTNRLTGGRLVIDLTSGRSTVD 153


>gi|149185093|ref|ZP_01863410.1| hypothetical protein ED21_18607 [Erythrobacter sp. SD-21]
 gi|148831204|gb|EDL49638.1| hypothetical protein ED21_18607 [Erythrobacter sp. SD-21]
          Length = 183

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 66/166 (39%), Gaps = 7/166 (4%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
               +          F L  A L     S         N  +   AD +E++D   +   
Sbjct: 1   MKKHLPAMAKSALFGFALTAAALGGIQLSAQAIAAHNSNAPVSYAADRIELQDRQNRVVL 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            GNV +TQ + +L A +  ++Y++     S +I R+     + +  G           DF
Sbjct: 61  SGNVQITQAELNLNAARTIVNYSD---AGSLRIQRIIATGGVDVSRGNERARGDTAVYDF 117

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD 169
            +R++ + G+    V L    +T  G +L++++ +  +S+ G  S 
Sbjct: 118 NRRVITMAGN----VRLNRGGDTLNGGRLVIDLASGVSSIDGQASG 159


>gi|51244292|ref|YP_064176.1| hypothetical protein DP0440 [Desulfotalea psychrophila LSv54]
 gi|50875329|emb|CAG35169.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 166

 Score = 85.7 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 67/168 (39%), Gaps = 13/168 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L+ +L    L Q   +     K   +  I+I+A+ +   +     FF+G+V   Q+D  +
Sbjct: 6   LLSILFCYTLLQTLIASTAFAK---DAPIYIEANHMTSTENTNTVFFEGDVDAKQDDVRI 62

Query: 77  QADKMTIDYNN-TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           +++KMT+ Y+  +  + S ++ ++    N  +  GE            + + +VL G+  
Sbjct: 63  RSNKMTVFYSKASKGEKSQQVKKIICTGNTEVTRGEWLGTGQRMVYTTKDKKIVLTGNAK 122

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-----QVQSIIRYD 178
                 +  N   G  +   +D   + + G         +V   I  +
Sbjct: 123 A----WQNQNMVSGETITYFLDQKRSEVVGTPQKNKKPSRVNMTIIQN 166


>gi|296137176|ref|YP_003644418.1| lipopolysaccharide transport periplasmic protein LptA [Thiomonas
           intermedia K12]
 gi|295797298|gb|ADG32088.1| lipopolysaccharide transport periplasmic protein LptA [Thiomonas
           intermedia K12]
          Length = 211

 Score = 85.7 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 64/178 (35%), Gaps = 21/178 (11%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           + L+ +L    L+      +   ++  N+ IHI+AD +   D  Q + F GNV +T+   
Sbjct: 9   ILLLTLLCAPSLAL----PVLAAQIDRNQPIHIEADAMRYDDVHQTSVFTGNVVVTKGSL 64

Query: 75  SLQADKMTIDYNNTNRD--------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
            L+A  + +                      +  ++      +  ++  A     D +  
Sbjct: 65  VLRAATVDVRQAPDGYQYATAIAAPGQLATFQQQLDGAPGQPAQTMDGAAQRIEYDGKTD 124

Query: 127 ILVLNGDRADKVILKEK-LNTFLGCKLIVNIDTSFASLQGC--------ESDQVQSII 175
           ++ L G      ++  K  +   G  +  N  T   +++G            +V+ ++
Sbjct: 125 VVTLRGQAMLSRLIDGKLADRSQGNVIAYNQITDVFTVEGGAQGATATNPGGRVRVML 182


>gi|58580909|ref|YP_199925.1| hypothetical protein XOO1286 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622842|ref|YP_450214.1| hypothetical protein XOO_1185 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58425503|gb|AAW74540.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366782|dbj|BAE67940.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 182

 Score = 85.7 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 24  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 83

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 84  NGKQATLKQEMDDGAMMHGQADNIEYKVADDIIILTGNYK----VDSPKGTNAGQRMVYN 139

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 140 TKTGNMQ-SGGDGSRVRTIIQP 160


>gi|54293812|ref|YP_126227.1| hypothetical protein lpl0868 [Legionella pneumophila str. Lens]
 gi|53753644|emb|CAH15102.1| hypothetical protein lpl0868 [Legionella pneumophila str. Lens]
          Length = 169

 Score = 85.7 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 56/181 (30%), Gaps = 18/181 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  + +   +L L+ +   +                  + + + +D  ++     +  + 
Sbjct: 1   MTQLKVKYIILLLLMLCSISG---------NALPFDKEKMVQVVSDSADLNQKNHQGVYI 51

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI-----QSGEINVIASNG 119
           GNV   Q   +L+A+K     +  N+           ++  +           +  A   
Sbjct: 52  GNVEFVQGSTNLRAEKAITQGDAKNQLTLAIAEGSKDKQAHYWTTTAPDKPPFHAYADTI 111

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
                K ++ L G+      +++  N+    K+  +           E  +   II  + 
Sbjct: 112 KYYPLKHLIELIGNAR----IEQGPNSLSAAKISYDTQEQHVLSHSDEKTRTTIIIYPEK 167

Query: 180 R 180
           +
Sbjct: 168 K 168


>gi|117926611|ref|YP_867228.1| OstA family protein [Magnetococcus sp. MC-1]
 gi|117610367|gb|ABK45822.1| OstA family protein [Magnetococcus sp. MC-1]
          Length = 179

 Score = 85.4 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 17/176 (9%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +LA + VL+ A +     +              I AD LE+ D  Q A FKGNV   +  
Sbjct: 9   MLATLVVLISAMMVVEGHAQQGAL--------TITADALEMNDLKQIAVFKGNVQAEEGA 60

Query: 74  FSLQADKMTIDYNNTNRDVSNK--INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
             L +D+M + Y  +    + +  I  +    N+ ++ G+    A         R L L 
Sbjct: 61  MQLFSDRMVVTYRPSQAGGTKQDRIREIVANGNVVLRQGDHIGRADKAVYSVSSRALSLE 120

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDT----SFASLQGCESDQVQSIIRYDG--RP 181
           G+     +++   +   G K+++ +D         ++G    +V ++I  DG  +P
Sbjct: 121 GNNR-TAVVQHNKDRLEGQKIVLQMDENRQIQNVKVEGGRKGRVSAVITPDGDIKP 175


>gi|260222574|emb|CBA32271.1| hypothetical protein Csp_D31300 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 219

 Score = 85.4 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/187 (11%), Positives = 58/187 (31%), Gaps = 11/187 (5%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
           +S      +  ++F L         A  +   K   N+ +++++D L   D  Q + F G
Sbjct: 11  SSSKFRALMKKILFSLSVLLALCGVAEGIRAEKADRNKPMNVESDALRYDDLKQVSVFSG 70

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRD----VSNKINRMDVERNIFIQSGEINVIASNGYV 121
           NV +T+    ++  ++ +  +               +    +        I         
Sbjct: 71  NVVLTKGSILIRGAQIEVRQDPEGYQYGLVTGAPGKQAFFRQKRDGLDEFIEGEGDTIEY 130

Query: 122 DFQKRILVLNGDRADKVIL-KEKLNTFLGCKLIVNIDTSFASLQGCES------DQVQSI 174
           D +   +        + +      +   G  ++    T   ++ G          +V+++
Sbjct: 131 DGKADTVRFIKKAQMRRLRGATVADEVTGAVIVYENLTDRFTVDGTPKTAAAPAGRVRAM 190

Query: 175 IRYDGRP 181
           +     P
Sbjct: 191 LTPKADP 197


>gi|59801934|ref|YP_208646.1| hypothetical protein NGO1606 [Neisseria gonorrhoeae FA 1090]
 gi|194099432|ref|YP_002002534.1| hypothetical protein NGK_1909 [Neisseria gonorrhoeae NCCP11945]
 gi|239999670|ref|ZP_04719594.1| hypothetical protein Ngon3_09347 [Neisseria gonorrhoeae 35/02]
 gi|240014847|ref|ZP_04721760.1| hypothetical protein NgonD_09444 [Neisseria gonorrhoeae DGI18]
 gi|240017293|ref|ZP_04723833.1| hypothetical protein NgonFA_09052 [Neisseria gonorrhoeae FA6140]
 gi|240081067|ref|ZP_04725610.1| hypothetical protein NgonF_07107 [Neisseria gonorrhoeae FA19]
 gi|240113277|ref|ZP_04727767.1| hypothetical protein NgonM_06831 [Neisseria gonorrhoeae MS11]
 gi|240118657|ref|ZP_04732719.1| hypothetical protein NgonPID_09413 [Neisseria gonorrhoeae PID1]
 gi|240121366|ref|ZP_04734328.1| hypothetical protein NgonPI_06299 [Neisseria gonorrhoeae PID24-1]
 gi|254494386|ref|ZP_05107557.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268595483|ref|ZP_06129650.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597178|ref|ZP_06131345.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599357|ref|ZP_06133524.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268604370|ref|ZP_06138537.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|293398420|ref|ZP_06642598.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           gonorrhoeae F62]
 gi|59718829|gb|AAW90234.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934722|gb|ACF30546.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226513426|gb|EEH62771.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548872|gb|EEZ44290.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550966|gb|EEZ45985.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583488|gb|EEZ48164.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268588501|gb|EEZ53177.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|291610891|gb|EFF39988.1| lipopolysaccharide transport periplasmic protein LptA [Neisseria
           gonorrhoeae F62]
 gi|317164933|gb|ADV08474.1| hypothetical protein NGTW08_1514 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 176

 Score = 85.4 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 51/159 (32%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A S     +      I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  ATSPAFALQSDSRRPIQIEADQGSLDQANQSTTFSGNVIIRQGTLNISASRVNVTRGGKG 75

Query: 90  RDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            +                   G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----VQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          ++ +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSTKSGAKSASKTGRVSVVIQPS 170


>gi|91791855|ref|YP_561506.1| OstA-like protein [Shewanella denitrificans OS217]
 gi|91713857|gb|ABE53783.1| OstA-like protein [Shewanella denitrificans OS217]
          Length = 184

 Score = 85.4 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/161 (15%), Positives = 51/161 (31%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L   L  A    +   +    +++ ++A   +      +  F G V + Q   ++ AD+
Sbjct: 6   ILLIGLLMATCHSVHAKQGDLQQELKVEAVSQKADIKNNQIIFFGPVKVVQGSINIHADE 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +       +              +  +  G      A     D   R L L G+      
Sbjct: 66  LRAFSTAKSPSKVMLAIGNPATFSQELDDGSTGTASAKEIRYDLASRTLTLTGEAK---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESD--QVQSIIRYD 178
           L +  N   G  +  NI       +       +V +II+ +
Sbjct: 122 LDQAGNQVTGNSIRYNIKDQQLIAESTGKGQDRVITIIQPE 162


>gi|110833415|ref|YP_692274.1| hypothetical protein ABO_0554 [Alcanivorax borkumensis SK2]
 gi|110646526|emb|CAL16002.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 199

 Score = 85.4 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 65/178 (36%), Gaps = 17/178 (9%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
              + +H   +L  L  ++      QAA    T         I + AD    + +     
Sbjct: 2   NLKHRLHSTCNLAVLALLIAFPLGVQAAPMEGT---------IQVTADNGRFEQSAGSGV 52

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           + GNV + Q    L AD+M +   N+                   +   +N  A N   +
Sbjct: 53  YSGNVELIQGKRKLFADEMRMFTQNSELVRVEATG----TPVRMEEGEGLNAHAENLVYN 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            + R LVL GD      ++ + NTF G K+  ++D+           +V+ +I  + +
Sbjct: 109 IKARTLVLTGDAY----IEHQGNTFEGAKVEYSLDSKRVDASSEGDQRVRLVIPAENQ 162


>gi|94266462|ref|ZP_01290155.1| OstA-like protein [delta proteobacterium MLMS-1]
 gi|93452940|gb|EAT03445.1| OstA-like protein [delta proteobacterium MLMS-1]
          Length = 211

 Score = 85.4 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/169 (15%), Positives = 66/169 (39%), Gaps = 18/169 (10%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +  +  L+   +S   A+            I I+AD +E  +      F G V   Q+  
Sbjct: 21  MRYLLFLIFGSISLLLAATAAAS------PIQIEADRMESVEGTNAILFTGQVVAQQQGL 74

Query: 75  SLQADKMTIDYNNTNRDV------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           ++ +D+MT+ Y +             ++ ++    N+ ++S + +           +R++
Sbjct: 75  TVYSDEMTVHYFSDEEQAALADDDQRRLKKLFATGNVRVESDDFSGTGQRMDYFEVERVV 134

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ--GCESDQVQSII 175
            L+G+        ++ N   G K+ + +D   +  +  G    +V++  
Sbjct: 135 HLSGNARA----WQEGNLVTGDKITMYLDEGKSIAEYDGKSDQRVRAFF 179


>gi|66047372|ref|YP_237213.1| OstA-like protein [Pseudomonas syringae pv. syringae B728a]
 gi|63258079|gb|AAY39175.1| OstA-like protein [Pseudomonas syringae pv. syringae B728a]
          Length = 182

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 49/155 (31%), Gaps = 14/155 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N         
Sbjct: 24  SLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRNAQGEVDVFT 83

Query: 96  INRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
                          +      A        +  +VL     DK  +    NT  G K++
Sbjct: 84  SVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVINDGNTSEGEKIV 139

Query: 154 VNIDTSFASLQGCESD--------QVQSIIRYDGR 180
            +      +               ++  +I+   +
Sbjct: 140 YDTVRQVVTAGRANGGAKVTTPRPRIDMVIQPKKK 174


>gi|312797342|ref|YP_004030264.1| protein yhbN precursor [Burkholderia rhizoxinica HKI 454]
 gi|312169117|emb|CBW76120.1| Protein yhbN precursor [Burkholderia rhizoxinica HKI 454]
          Length = 232

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 64/174 (36%), Gaps = 15/174 (8%)

Query: 20  VLLKADLSQAAASYMT-RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQA 78
           ++    ++ A +  +    +   ++ ++I+AD +   D  Q   F G+V  T+    ++A
Sbjct: 32  IVSTLAVALALSLPVAHAERADRDKPLNIEADNMTYDDLKQLTVFTGHVVATKGTILIRA 91

Query: 79  DKMTIDYNNTNRDV----SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           D++ +  +          SN        +     +  I   A     D ++ +  L    
Sbjct: 92  DRVEVKQDPQGYQHATGTSNGNTPSYFRQKRDGMNEYIEGNAVRIDYDGKQDLTTLTTRA 151

Query: 135 ADKVI--LKEKLNTFLGCKLIVNIDTSFASLQ--------GCESDQVQSIIRYD 178
             + +  L + ++   G  +  +    F + Q        G  S +V++++   
Sbjct: 152 VVRRLQGLSKLVDEVRGSVITYDGQKDFYTAQSGKDVAGPGNPSGRVRAMLTPS 205


>gi|76809285|ref|YP_332180.1| OstA-like family protein [Burkholderia pseudomallei 1710b]
 gi|121599216|ref|YP_991426.1| hypothetical protein BMASAVP1_A0074 [Burkholderia mallei SAVP1]
 gi|124385531|ref|YP_001027498.1| hypothetical protein BMA10229_A1516 [Burkholderia mallei NCTC
           10229]
 gi|126441057|ref|YP_001057635.1| hypothetical protein BURPS668_0583 [Burkholderia pseudomallei 668]
 gi|126448763|ref|YP_001082464.1| hypothetical protein BMA10247_2944 [Burkholderia mallei NCTC 10247]
 gi|126454453|ref|YP_001064881.1| hypothetical protein BURPS1106A_0599 [Burkholderia pseudomallei
           1106a]
 gi|167001032|ref|ZP_02266833.1| cell envelope biogenesis protein YhbN [Burkholderia mallei PRL-20]
 gi|167822679|ref|ZP_02454150.1| hypothetical protein Bpseu9_03314 [Burkholderia pseudomallei 9]
 gi|167901258|ref|ZP_02488463.1| hypothetical protein BpseN_03199 [Burkholderia pseudomallei NCTC
           13177]
 gi|167909475|ref|ZP_02496566.1| hypothetical protein Bpse112_03214 [Burkholderia pseudomallei 112]
 gi|167917504|ref|ZP_02504595.1| hypothetical protein BpseBC_03061 [Burkholderia pseudomallei
           BCC215]
 gi|217419608|ref|ZP_03451114.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           576]
 gi|226199491|ref|ZP_03795048.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810785|ref|YP_002895236.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           pseudomallei MSHR346]
 gi|238561324|ref|ZP_00442171.2| cell envelope biogenesis protein YhbN [Burkholderia mallei GB8
           horse 4]
 gi|242315123|ref|ZP_04814139.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           1106b]
 gi|254174780|ref|ZP_04881441.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254181853|ref|ZP_04888450.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254187786|ref|ZP_04894298.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196562|ref|ZP_04902986.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254201680|ref|ZP_04908044.1| cell envelope biogenesis protein YhbN [Burkholderia mallei FMH]
 gi|254207012|ref|ZP_04913363.1| cell envelope biogenesis protein YhbN [Burkholderia mallei JHU]
 gi|254258758|ref|ZP_04949812.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           1710a]
 gi|254296096|ref|ZP_04963553.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|254357491|ref|ZP_04973765.1| cell envelope biogenesis protein YhbN [Burkholderia mallei
           2002721280]
 gi|76578738|gb|ABA48213.1| OstA-like protein family [Burkholderia pseudomallei 1710b]
 gi|121228026|gb|ABM50544.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293551|gb|ABN02820.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126220550|gb|ABN84056.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126228095|gb|ABN91635.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           1106a]
 gi|126241633|gb|ABO04726.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|147747574|gb|EDK54650.1| cell envelope biogenesis protein YhbN [Burkholderia mallei FMH]
 gi|147752554|gb|EDK59620.1| cell envelope biogenesis protein YhbN [Burkholderia mallei JHU]
 gi|148026555|gb|EDK84640.1| cell envelope biogenesis protein YhbN [Burkholderia mallei
           2002721280]
 gi|157805725|gb|EDO82895.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157935466|gb|EDO91136.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160695825|gb|EDP85795.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|169653305|gb|EDS85998.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|184212391|gb|EDU09434.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|217396912|gb|EEC36928.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           576]
 gi|225928372|gb|EEH24402.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           Pakistan 9]
 gi|237503258|gb|ACQ95576.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           pseudomallei MSHR346]
 gi|238524777|gb|EEP88208.1| cell envelope biogenesis protein YhbN [Burkholderia mallei GB8
           horse 4]
 gi|242138362|gb|EES24764.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           1106b]
 gi|243063103|gb|EES45289.1| cell envelope biogenesis protein YhbN [Burkholderia mallei PRL-20]
 gi|254217447|gb|EET06831.1| cell envelope biogenesis protein YhbN [Burkholderia pseudomallei
           1710a]
          Length = 221

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 56/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +         
Sbjct: 39  AEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATA 98

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            ++        +        I+  A     D ++ +  L  +   + +  +    +T  G
Sbjct: 99  TASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVSTVADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +          +V++++  
Sbjct: 159 SVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 194


>gi|71734892|ref|YP_276271.1| OstA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257483490|ref|ZP_05637531.1| OstA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|298488493|ref|ZP_07006523.1| Protein yhbN precursor [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|71555445|gb|AAZ34656.1| OstA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298156834|gb|EFH97924.1| Protein yhbN precursor [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320322491|gb|EFW78584.1| OstA family protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|330869983|gb|EGH04692.1| OstA family protein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330987093|gb|EGH85196.1| OstA family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 182

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 49/155 (31%), Gaps = 14/155 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N         
Sbjct: 24  SLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRNAQGEVDVFT 83

Query: 96  INRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
                          +      A        +  +VL     DK  +    NT  G K++
Sbjct: 84  SVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVINDGNTSEGEKIV 139

Query: 154 VNIDTSFASLQGCESD--------QVQSIIRYDGR 180
            +      S               ++  +I+   +
Sbjct: 140 YDTVRQVVSAGRANGGAKVTTPRPRIDMVIQPKKK 174


>gi|53718174|ref|YP_107160.1| OstA-like protein [Burkholderia pseudomallei K96243]
 gi|167814156|ref|ZP_02445836.1| OstA-like protein [Burkholderia pseudomallei 91]
 gi|52208588|emb|CAH34524.1| OstA-like protein [Burkholderia pseudomallei K96243]
          Length = 221

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 56/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +         
Sbjct: 39  AEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATA 98

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            ++        +        I+  A     D ++ +  L  +   + +  +    +T  G
Sbjct: 99  TASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +          +V++++  
Sbjct: 159 SVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 194


>gi|161870714|ref|YP_001599887.1| hypothetical protein NMCC_1787 [Neisseria meningitidis 053442]
 gi|161596267|gb|ABX73927.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 156

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 56/152 (36%), Gaps = 14/152 (9%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY-NNTNRDVSNK 95
            +    + I I+AD   +  A Q   F GNV + Q   ++ A ++ +   +   + +   
Sbjct: 3   LQSDSRQPIQIEADQGSLNQANQSTTFSGNVVIRQGTLNISAARVNVTRNDKGEQFMKAD 62

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
            + +   + +    G +   A+N         +VL G+      ++   +   G  +  N
Sbjct: 63  GSPVRFSQTLDGGKGTVRGQANNVAYSSAGSTVVLTGNAK----VQRGGDVAEGAVITYN 118

Query: 156 IDTSFASLQG---------CESDQVQSIIRYD 178
             T   ++ G          +S +V  II+  
Sbjct: 119 TKTEVYTISGSTKSGAKSASKSGRVSVIIQPS 150


>gi|28871586|ref|NP_794205.1| ostA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213966610|ref|ZP_03394761.1| ostA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301383119|ref|ZP_07231537.1| ostA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|28854838|gb|AAO57900.1| ostA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213928460|gb|EEB62004.1| ostA family protein [Pseudomonas syringae pv. tomato T1]
          Length = 182

 Score = 85.0 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 49/155 (31%), Gaps = 14/155 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N         
Sbjct: 24  SLPNDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTITRNAQGEVDVFT 83

Query: 96  INRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
                          +      A        +  +VL     DK  +    NT  G K++
Sbjct: 84  SVGNLAYYEQKPAVDKPIVQAYAITIQYYAGQDRIVLI----DKAKVVNDGNTSEGEKIV 139

Query: 154 VNIDTSFASLQGCESD--------QVQSIIRYDGR 180
            +      S               ++  +I+   +
Sbjct: 140 YDTVRQVVSAGRANGGAKVTTPRPRIDMVIQPKKK 174


>gi|92114346|ref|YP_574274.1| OstA-like protein [Chromohalobacter salexigens DSM 3043]
 gi|91797436|gb|ABE59575.1| OstA-like protein [Chromohalobacter salexigens DSM 3043]
          Length = 174

 Score = 84.6 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 51/154 (33%), Gaps = 13/154 (8%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                +   ++ I I AD L++ D    A + G+V M Q    L A ++ I+ N      
Sbjct: 21  AALALESDASQPIEIAADQLDLDDNAGTAVYTGDVDMQQGSMRLTAARVEIERNAQGEVS 80

Query: 93  S-----NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
           +     +   R  +E+                     +R + L     D+  L +  +TF
Sbjct: 81  TVTAHGSGSERAYLEQKPSPDEPVAKGWGDTVIYHAGERRVELI----DRAQLHQGGDTF 136

Query: 148 LGCKLIVNIDTSFASL----QGCESDQVQSIIRY 177
            G  +   +D           G    +V+  +  
Sbjct: 137 NGAYVEYFLDRRQVQARSDDDGEGDQRVRMTLTP 170


>gi|237798600|ref|ZP_04587061.1| OstA-like protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021453|gb|EGI01510.1| OstA-like protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 182

 Score = 84.6 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 49/155 (31%), Gaps = 14/155 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                 ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI  N         
Sbjct: 24  SLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKVTGNTVTITRNAQGEVDVFT 83

Query: 96  INRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
                          +      A        +  +VL     DK  +    NT  G K++
Sbjct: 84  SVGNLAYYEQKPAPDKPIVQAYAVTIQYYAGQDRIVLI----DKAKVINDGNTSEGEKIV 139

Query: 154 VNIDTSFASLQGCESD--------QVQSIIRYDGR 180
            +      +               ++  +I+   +
Sbjct: 140 YDTVRQVVTAGRANGGTKLTTPRPRIDMVIQPKKK 174


>gi|325916423|ref|ZP_08178695.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325537343|gb|EGD09067.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 181

 Score = 84.6 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 52/142 (36%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        +N  A N        I++L+G+      +     T  G +++ N
Sbjct: 81  TGKQATLKQQMDDGAMMNGQADNIEYKVADEIIILSGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V++II+ 
Sbjct: 137 TKTGNMQ-SGGDGSRVRTIIQP 157


>gi|240124201|ref|ZP_04737157.1| hypothetical protein NgonP_09739 [Neisseria gonorrhoeae PID332]
 gi|240126403|ref|ZP_04739289.1| hypothetical protein NgonSK_09399 [Neisseria gonorrhoeae SK-92-679]
 gi|268682827|ref|ZP_06149689.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684988|ref|ZP_06151850.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268623111|gb|EEZ55511.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268625272|gb|EEZ57672.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
          Length = 176

 Score = 84.6 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 51/159 (32%), Gaps = 14/159 (8%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A S     +      I I+AD   +  A Q   F GNV + Q   ++ A ++ +      
Sbjct: 16  ATSPAFALQSDSRRPIQIEADQGSLDQANQSTTFSGNVIIRQGTLNISASRVNVTRGGKG 75

Query: 90  RDVSNKINRMDVERNIFI-QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
            +                   G +   A+N         +VL G+      ++   +   
Sbjct: 76  GESVRAEGSPVRFSQTLDGGKGTVRGQANNVTYSSAGSTVVLTGNAK----MQRGGDVAE 131

Query: 149 GCKLIVNIDTSFASLQG---------CESDQVQSIIRYD 178
           G  +  N  T   ++ G          ++ +V  +I+  
Sbjct: 132 GAVITYNTKTEVYTINGSTKSGAKSASKTGRVSVVIQPS 170


>gi|88704066|ref|ZP_01101781.1| OstA-like protein [Congregibacter litoralis KT71]
 gi|88701893|gb|EAQ98997.1| OstA-like protein [Congregibacter litoralis KT71]
          Length = 239

 Score = 84.6 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/170 (14%), Positives = 53/170 (31%), Gaps = 8/170 (4%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           + +  L  +       +    +           + I I A      +      + G+V M
Sbjct: 20  VLLRRLCAILARCAMIIGALGSYPALALPEDRLQSIEITAARAVRDERAGFTVYSGDVVM 79

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDV-ERNIFIQSGEINVIASNGYVDFQKRIL 128
            Q    ++ADK+TI +++   D    +       +   I  G +   A     +  +  +
Sbjct: 80  KQGSLHIRADKITIFHDSEAADRIIAVGEPATLRQQPEIDKGFVTASAGRIVYEKSREWV 139

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG---CESDQVQSII 175
            L     +  ++++      G  +   +              S +VQ II
Sbjct: 140 QL----REAAVIEQDGAVVSGDSIDYFMAEQRVRADAAPEDASGRVQVII 185


>gi|289207553|ref|YP_003459619.1| lipopolysaccharide transport periplasmic protein LptA
           [Thioalkalivibrio sp. K90mix]
 gi|288943184|gb|ADC70883.1| lipopolysaccharide transport periplasmic protein LptA
           [Thioalkalivibrio sp. K90mix]
          Length = 174

 Score = 84.6 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 54/137 (39%), Gaps = 7/137 (5%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I AD  E+ D    + + G+V + + D +L+ADK+ +   +                
Sbjct: 37  PVEITADRAEMDDRRGVSTYTGDVVVIRGDMTLEADKVYVRSRDRRPYEMEAHGEPARLE 96

Query: 104 NIFIQSGEI-NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
           +   ++GE+    A        +  ++L     D+  +        G +++ +++T    
Sbjct: 97  SPDPETGEMRIATALRIDYLLNEDRVILT----DQAHVITAAEEARGKRIVYDLETDVIE 152

Query: 163 LQGCE--SDQVQSIIRY 177
            +  E   ++V+  I+ 
Sbjct: 153 AERGEADDERVRIRIQP 169


>gi|258544361|ref|ZP_05704595.1| lipopolysaccharide transport periplasmic protein LptA/YhbN
           [Cardiobacterium hominis ATCC 15826]
 gi|258520441|gb|EEV89300.1| lipopolysaccharide transport periplasmic protein LptA/YhbN
           [Cardiobacterium hominis ATCC 15826]
          Length = 160

 Score = 84.6 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 20/140 (14%), Positives = 45/140 (32%), Gaps = 9/140 (6%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
               I++KAD  E       A + GNV +TQ + +L+ DK+ I              +  
Sbjct: 30  QQLPINLKADSGEYDANAGIATYTGNVVVTQGEMNLKGDKIVIRLQEGKIHSIESWGKPT 89

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
               +  +   I+              + ++ +      +K+  N      +  ++    
Sbjct: 90  TFHYVPAKEPPIDGSGQYMKYTVPTSTVEIDKNA----HVKQDKNETRADHITYDLKREH 145

Query: 161 ASLQGCESDQVQSIIRYDGR 180
            + +G     V    +   +
Sbjct: 146 VTGRG-----VNMTFQPKTK 160



 Score = 37.6 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 18/67 (26%), Gaps = 4/67 (5%)

Query: 115 IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSI 174
            A +G  D    I    G+    V++ +      G K+++ +                  
Sbjct: 37  KADSGEYDANAGIATYTGN----VVVTQGEMNLKGDKIVIRLQEGKIHSIESWGKPTTFH 92

Query: 175 IRYDGRP 181
                 P
Sbjct: 93  YVPAKEP 99


>gi|187922605|ref|YP_001894247.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           phytofirmans PsJN]
 gi|187713799|gb|ACD15023.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           phytofirmans PsJN]
          Length = 223

 Score = 84.2 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 66/178 (37%), Gaps = 18/178 (10%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L ALV  L  A  +  A +     +   ++ ++I+AD +   D  Q   F G+V  T+  
Sbjct: 23  LAALVVALPLAGFAPLAHAD----RADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGT 78

Query: 74  FSLQADKMTIDYNNTNRD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
             ++AD++ +  +          S+  N     +        I   A     D ++ +  
Sbjct: 79  IVIKADRVEVTQDPQGYQYATGTSSGGNLSYFRQKREGLDEYIEGTAVRIDYDGKQDLTT 138

Query: 130 LNGDRADKVI--LKEKLNTFLGCKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
           L  +   K +  L   ++   G  +  +    F + +        G  + +V++++  
Sbjct: 139 LTTNATVKRLQGLSTVVDQVHGSVITYDGQNDFYTAKAGKDVAGPGNPTGRVRAMLSP 196


>gi|296161542|ref|ZP_06844347.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. Ch1-1]
 gi|295888186|gb|EFG67999.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. Ch1-1]
          Length = 223

 Score = 84.2 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 67/178 (37%), Gaps = 18/178 (10%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L AL+  L  A  +  A +     +   ++ ++I+AD +   D  Q   F G+V  T+  
Sbjct: 23  LAALIVALPLAGFAPLAHAD----RADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGT 78

Query: 74  FSLQADKMTIDYNNTNRD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
             ++AD++ +  +          S+  N     +        I   A     D ++ +  
Sbjct: 79  IVIKADRVEVTQDPQGYQYATGTSSGGNLSYFRQKREGLDEYIEGTAIRIDYDGKQDLTT 138

Query: 130 LNGDRADKVI--LKEKLNTFLGCKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
           L  +   K +  L   ++   G  +  +  + F + +        G  + +V++++  
Sbjct: 139 LTTNATVKRLQGLSTVMDQVHGSVITYDGQSDFYTAKAGKDVAGPGNPTGRVRAMLAP 196


>gi|167031976|ref|YP_001667207.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida GB-1]
 gi|166858464|gb|ABY96871.1| lipopolysaccharide transport periplasmic protein LptA [Pseudomonas
           putida GB-1]
          Length = 174

 Score = 84.2 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 54/151 (35%), Gaps = 12/151 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I I+AD   + D    A + G+V +TQ    ++ + +TI  + +         
Sbjct: 26  PNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTITRSASGDIDVVTSV 85

Query: 98  RMDVERNIFI---QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                        +  ++           QK +++L         ++ + NT  G K++ 
Sbjct: 86  GNLAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVILTDRAK----VENEGNTTEGEKIVY 141

Query: 155 NIDTSFASLQGCES-----DQVQSIIRYDGR 180
           N  T  A+     +      ++  +I+   +
Sbjct: 142 NTQTQVATAGRGGNVTTPRQRIDMVIQPKKK 172


>gi|313673392|ref|YP_004051503.1| osta family protein [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940148|gb|ADR19340.1| OstA family protein [Calditerrivibrio nitroreducens DSM 19672]
          Length = 176

 Score = 84.2 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 71/166 (42%), Gaps = 19/166 (11%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           + ++F +L + L  A               ++I+AD ++     Q + F GNV  T +D 
Sbjct: 6   VFVLFFILFSVLVFA----------DEKFPVNIEADSVKYFGKEQYSLFTGNVKATYKDT 55

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            + +D M + +++       ++  +    N+ +    +  ++    +  ++ ILVL GD 
Sbjct: 56  KVYSDSMKVVFDSK-----KEVEFIYCSGNVKMVKEGMYSLSKEAELKMKENILVLKGDA 110

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
                + +  N   G ++IV  + +   +   E+ +V+ I   D +
Sbjct: 111 K----VWQGENYLEGEEVIVYNNDNRVVVNRAENKRVKVIFYPDNK 152


>gi|91781726|ref|YP_556932.1| hypothetical protein Bxe_A4120 [Burkholderia xenovorans LB400]
 gi|91685680|gb|ABE28880.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 223

 Score = 83.8 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 67/178 (37%), Gaps = 18/178 (10%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L AL+  L  A  +  A +     +   ++ ++I+AD +   D  Q   F G+V  T+  
Sbjct: 23  LAALIVALPLAGFAPLAHAD----RADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGT 78

Query: 74  FSLQADKMTIDYNNTNRD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
             ++A+++ +  +          S+  N     +        I   A     D ++ +  
Sbjct: 79  IVIKAERVEVTQDPQGYQYATGTSSGGNLSYFRQKREGLDEYIEGTAVRIDYDGKQDLTT 138

Query: 130 LNGDRADKVI--LKEKLNTFLGCKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
           L  +   K +  L   ++   G  +  +  + F + +        G  + +V++++  
Sbjct: 139 LTTNATVKRLQGLSTVMDQVHGSVITYDGQSDFYTAKAGKDVAGPGNPTGRVRAMLAP 196


>gi|325922181|ref|ZP_08183969.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           gardneri ATCC 19865]
 gi|325547351|gb|EGD18417.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           gardneri ATCC 19865]
          Length = 184

 Score = 83.8 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 52/141 (36%), Gaps = 7/141 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
           + +    +        +N  A N        ++VL G+      +     T  G +++ N
Sbjct: 81  VGKQATLKQQMDDGAMMNGQADNIEYQVANEVIVLTGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSIIR 176
             T      G +  +V++II+
Sbjct: 137 TKTGNMQ-SGGDGSRVRTIIQ 156


>gi|89075687|ref|ZP_01162082.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
 gi|89048550|gb|EAR54124.1| hypothetical protein yhbN precursor [Photobacterium sp. SKA34]
          Length = 163

 Score = 83.8 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 59/161 (36%), Gaps = 6/161 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L  A      +S     K      I ++A   +V          GNV +TQ    ++ADK
Sbjct: 5   LFAAGCMLLLSSSTWAEKTDTQLPIQLEATTQDVDVINNVTTLTGNVDITQGGVQIKADK 64

Query: 81  MTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
             I  +   + + +     +      +      ++  +  G     K ++VL     DK 
Sbjct: 65  AVIKLDTKTKALKSVEVYGKPAYFHRVMEDGKVVDGESLYGIYTPTKNMMVL----KDKA 120

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            + +  +T    ++  N+ +     +G +S QV +++  + 
Sbjct: 121 KITQNGSTIQAAEISYNLASEVMKAKGSKSRQVNTVLLPEK 161


>gi|163783705|ref|ZP_02178692.1| hypothetical protein HG1285_15099 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881030|gb|EDP74547.1| hypothetical protein HG1285_15099 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 146

 Score = 83.8 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 65/174 (37%), Gaps = 30/174 (17%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
              L++ L AL   LL A                  + I  +A  LE      +  + GN
Sbjct: 2   RFRLFLSLAALFTSLLWA------------------QPITGEAKSLEF--KKDRIIYTGN 41

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           V +T+ +  L+ADK+ I  +        K  +M    N+     +    +     D +  
Sbjct: 42  VKLTRGESVLKADKVVILLDEK-----GKPTKMIATGNVRYYEPKRKSFSEYAEYDLRNE 96

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           I+VL G+      ++E  N     +++ +        +G +S  V++I   + +
Sbjct: 97  IIVLKGNAR----VEEDKNLLEAEEIVYDRKNGTLQAKGDKSK-VRTIYIEEEK 145


>gi|167892762|ref|ZP_02480164.1| hypothetical protein Bpse7_03286 [Burkholderia pseudomallei 7894]
          Length = 196

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 56/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +         
Sbjct: 14  AEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATA 73

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            ++        +        I+  A     D ++ +  L  +   + +  +    +T  G
Sbjct: 74  TASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVSTVADTVHG 133

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +          +V++++  
Sbjct: 134 SVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 169


>gi|167737047|ref|ZP_02409821.1| hypothetical protein Bpse14_03226 [Burkholderia pseudomallei 14]
          Length = 184

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 56/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +         
Sbjct: 2   AEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATA 61

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            ++        +        I+  A     D ++ +  L  +   + +  +    +T  G
Sbjct: 62  TASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVSTVADTVHG 121

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +          +V++++  
Sbjct: 122 SVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 157


>gi|167718032|ref|ZP_02401268.1| OstA-like protein [Burkholderia pseudomallei DM98]
          Length = 194

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 56/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +         
Sbjct: 12  AEKADRDKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGYQYATA 71

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            ++        +        I+  A     D ++ +  L  +   + +  +    +T  G
Sbjct: 72  TASGKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTNATVRRLQGVSTVADTVHG 131

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +          +V++++  
Sbjct: 132 SVITYDGQRDFYTARGGKDVAGPGNPGGRVRAMLTP 167


>gi|120602551|ref|YP_966951.1| OstA family protein [Desulfovibrio vulgaris DP4]
 gi|120562780|gb|ABM28524.1| OstA family protein [Desulfovibrio vulgaris DP4]
 gi|311233963|gb|ADP86817.1| OstA family protein [Desulfovibrio vulgaris RCH1]
          Length = 196

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 69/188 (36%), Gaps = 17/188 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M++ L    L + + A V   +    +Q  A+     K        + A  ++     Q 
Sbjct: 1   MASRLVPFLLSLTMAAAVAFPVPTACAQPKATANPAQKS---VPTTVTAQRMQYDANKQS 57

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS----------NKINRMDVERNIFIQSG 110
             F+G+V++ + DF L + K+T+    +    S           +I R+  E+N+ +   
Sbjct: 58  VVFEGDVYVKRPDFELWSVKLTLHLGKSKEGKSGGDVPGGMDAGEIERIVAEKNVRMVRE 117

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
             N             ++++ G      +L +K N   G  +      + + + G  S  
Sbjct: 118 GRNGTCQKATYTTNDGLMIMEGSP----VLFDKENVVKGEVIYFYTRENRSEVHGGTSRP 173

Query: 171 VQSIIRYD 178
           V+++    
Sbjct: 174 VEAVFTSS 181


>gi|124265343|ref|YP_001019347.1| OstA-like protein [Methylibium petroleiphilum PM1]
 gi|124258118|gb|ABM93112.1| OstA-like protein [Methylibium petroleiphilum PM1]
          Length = 209

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/158 (12%), Positives = 46/158 (29%), Gaps = 10/158 (6%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
               K    + +   AD   V +  Q     GNV +T+    ++AD++ +  +      +
Sbjct: 40  FAAEKADRTQPLAFTADSARVDEVKQLNILSGNVEITKGSIVIRADRVEVRQSPEGYQSA 99

Query: 94  NKINRMDVERNIFIQSGEI----NVIASNGYVDFQKRILVLNGDR-ADKVILKEKLNTFL 148
                 +       + G         A     D +   + L       +       +   
Sbjct: 100 VATGWPNKRAYFRQKRGSNDEYIEGEAERLEYDGRGDTVRLVNQAVLRRFRGSTLADEVA 159

Query: 149 GCKLIVNIDTSFASLQGCES-----DQVQSIIRYDGRP 181
           G  +  +  T    + G  +      +V+ ++     P
Sbjct: 160 GNTISYDNVTEVFQVLGGPASAAAPGRVRGVLTPRENP 197


>gi|26987690|ref|NP_743115.1| hypothetical protein PP_0954 [Pseudomonas putida KT2440]
 gi|148546236|ref|YP_001266338.1| cell envelope biogenesis YhbN [Pseudomonas putida F1]
 gi|24982376|gb|AAN66579.1|AE016286_3 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148510294|gb|ABQ77154.1| Cell envelope biogenesis YhbN [Pseudomonas putida F1]
          Length = 174

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 54/151 (35%), Gaps = 12/151 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I I+AD   + D    A + G+V +TQ    ++ + +TI  + +         
Sbjct: 26  PNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTITRSASGDIDVVTSV 85

Query: 98  RMDVERNIFI---QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                        +  ++           QK +++L         ++ + NT  G K++ 
Sbjct: 86  GNLAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVILTDRAK----VESEGNTTEGEKIVY 141

Query: 155 NIDTSFASLQGCES-----DQVQSIIRYDGR 180
           N  T  A+     +      ++  +I+   +
Sbjct: 142 NTQTQVATAGRGGNVTTPRQRIDMVIQPKKK 172


>gi|332674379|gb|AEE71196.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Helicobacter pylori 83]
          Length = 185

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV  L    +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCLSVLSVMSAQKTDNKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTKDNREISGSADKLIYNVLNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|114564536|ref|YP_752050.1| OstA family protein [Shewanella frigidimarina NCIMB 400]
 gi|114335829|gb|ABI73211.1| OstA family protein [Shewanella frigidimarina NCIMB 400]
          Length = 193

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 62/179 (34%), Gaps = 13/179 (7%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           + +N +H   +++ L  +L    L        T  +    +++ I +          +  
Sbjct: 2   SHINRLHTRANVVLLSSILCILSL------PATAKQGDLKQELKIASASQSADIKNNQIV 55

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYV 121
           F G V + Q   ++ AD++       +              +  +  G+I    A+    
Sbjct: 56  FNGPVTIVQGTININADQLRAFTPENSTSKRLIATGTPATFSQELDDGKIGTASANEISY 115

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS--FASLQGCESDQVQSIIRYD 178
           D     L L G+      L +  +   G K+  NI      A   G   D+V +II+ +
Sbjct: 116 DLATTTLTLTGNAK----LDQSGSQVTGNKIKYNISAQELIAESTGTGQDRVITIIQPE 170


>gi|317015005|gb|ADU82441.1| hypothetical protein HPGAM_08385 [Helicobacter pylori Gambia94/24]
          Length = 185

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV  L    +  A        K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCLSVLSVMSAQKLENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGK--FNVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|325926075|ref|ZP_08187438.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           perforans 91-118]
 gi|325543533|gb|EGD14953.1| lipopolysaccharide transport periplasmic protein LptA [Xanthomonas
           perforans 91-118]
          Length = 183

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 50/140 (35%), Gaps = 7/140 (5%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F GNV +TQ    + AD   I   N   D    
Sbjct: 21  TSDRNQPMAIDSNANDCNMLDDSGKCRFSGNVVITQGTLEIHADTADIFQKNGQTDRVVL 80

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++  A N        I++L G+      +     T  G +++ N
Sbjct: 81  NGKQATLKQEMDDGAMMHGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMVYN 136

Query: 156 IDTSFASLQGCESDQVQSII 175
             T      G +  +V++II
Sbjct: 137 TKTGNMQ-SGGDGSRVRTII 155


>gi|21232231|ref|NP_638148.1| hypothetical protein XCC2800 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767640|ref|YP_242402.1| hypothetical protein XC_1313 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188990756|ref|YP_001902766.1| hypothetical protein xccb100_1360 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113990|gb|AAM42072.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572972|gb|AAY48382.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732516|emb|CAP50710.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 178

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/141 (19%), Positives = 50/141 (35%), Gaps = 7/141 (4%)

Query: 38  KVLGNEKIHIKADMLEVK--DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + I ++  +    D   K  F G V +TQ    + AD   I   N   D    
Sbjct: 24  TSDRNQPMTIDSNSNDCNMLDDSGKCRFSGKVVITQGTLEIHADTADIFQKNGQTDRVVL 83

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        +N  A N        I++L G+      +     T  G +++ N
Sbjct: 84  NGKQATLKQEMDDGAMMNGQADNIEYKVADEIIILTGNYK----VDSPKGTNAGQRMVYN 139

Query: 156 IDTSFASLQGCESDQVQSIIR 176
             T      G +  +V++II+
Sbjct: 140 TKTGNMQ-SGGDGSRVRTIIQ 159


>gi|330818339|ref|YP_004362044.1| OstA-like protein [Burkholderia gladioli BSR3]
 gi|327370732|gb|AEA62088.1| OstA-like protein [Burkholderia gladioli BSR3]
          Length = 222

 Score = 83.4 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/166 (15%), Positives = 55/166 (33%), Gaps = 16/166 (9%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
             A S     K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  + 
Sbjct: 31  PGAVSLAHAEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDP 90

Query: 88  TNR------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI-- 139
                                +        I+  A     D ++ +  L  +   + +  
Sbjct: 91  QGYQYATATMAPGSKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTRNATVRRLQG 150

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCES--------DQVQSIIRY 177
           L    +T  G  +  +    F + +G            +V++++  
Sbjct: 151 LTTVSDTVHGSVITYDGQRDFYTAKGGNDVAAPGNPTGRVRAMLSP 196


>gi|116749502|ref|YP_846189.1| OstA family protein [Syntrophobacter fumaroxidans MPOB]
 gi|116698566|gb|ABK17754.1| OstA family protein [Syntrophobacter fumaroxidans MPOB]
          Length = 199

 Score = 83.1 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID--- 84
           Q   +     K      +HI +D +EV+   +   F+G+V + Q+D ++  +++ +    
Sbjct: 44  QGTPAGERLMKSDS--PLHIASDRMEVRQRDRTIVFQGHVVVRQDDLTITGNQLKVTAAR 101

Query: 85  ----YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
                 N    +  KI+R++VE  + I   E    A       Q++ +VL G+     ++
Sbjct: 102 VDPSIRNDQSAIVEKIDRIEVEGGVKITQREKQATADKAVYYHQEQKIVLLGNP----VV 157

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            + L+   G  + + I    + ++G E   VQ+++    +
Sbjct: 158 SQGLDKVQGRLITLYIAEGKSVVEGGEQTPVQALLHPSRK 197


>gi|317181270|dbj|BAJ59056.1| hypothetical protein HPF32_1474 [Helicobacter pylori F32]
          Length = 185

 Score = 83.1 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV  L    +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCLSVLSVMSAQKTDDKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|313497323|gb|ADR58689.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 165

 Score = 83.1 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 54/151 (35%), Gaps = 12/151 (7%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
               ++ I I+AD   + D    A + G+V +TQ    ++ + +TI  + +         
Sbjct: 17  PNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQGSMMIKGNTVTITRSASGDIDVVTSV 76

Query: 98  RMDVERNIFI---QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                        +  ++           QK +++L         ++ + NT  G K++ 
Sbjct: 77  GNLAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVILTDRAK----VESEGNTTEGEKIVY 132

Query: 155 NIDTSFASLQGCES-----DQVQSIIRYDGR 180
           N  T  A+     +      ++  +I+   +
Sbjct: 133 NTQTQVATAGRGGNVTTPRQRIDMVIQPKKK 163


>gi|332305023|ref|YP_004432874.1| lipopolysaccharide transport periplasmic protein LptA [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172352|gb|AEE21606.1| lipopolysaccharide transport periplasmic protein LptA [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 197

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 66/177 (37%), Gaps = 13/177 (7%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             +I+L   +  +     S  + +     K    + I + +         +K+ F+ +V 
Sbjct: 3   KPFINLSLSLVAIATLSFSPLSMAG----KEDFTQAIKVDSKFQFGDGKTKKSIFREDVH 58

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRI 127
           + Q   ++ AD++ +D +    +          + +   + G  I   A+       +R 
Sbjct: 59  INQGSLNVYADEVEVDASKGEGNEIFIATGNPAKYSQEQEQGGSIEASANRIEYRRDQRT 118

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE----SDQVQSIIRYDGR 180
           L L GD      LK+  ++  G  ++ N++      QG      S +V +I +   +
Sbjct: 119 LTLEGDAQ----LKQNNSSVKGESIVFNMELEQIVAQGEGENQDSGRVTTIFQPSKK 171


>gi|33591886|ref|NP_879530.1| hypothetical protein BP0698 [Bordetella pertussis Tohama I]
 gi|33571530|emb|CAE41008.1| putative exported protein [Bordetella pertussis Tohama I]
 gi|332381303|gb|AEE66150.1| hypothetical protein BPTD_0704 [Bordetella pertussis CS]
          Length = 206

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 64/187 (34%), Gaps = 11/187 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH-IKADMLEVKDAVQKAFF 63
           +  + L +  L L  +LL A    A A   +       E    I +D L   D  +++ F
Sbjct: 1   MTHLRLSLAPLRLCSILLLAAAGAAQAQAQSGQAAPAEEPSTLILSDTLHYDDIKRQSIF 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNG 119
            GNV +T+   +L +DK+ ++ +                + + ++       I       
Sbjct: 61  TGNVILTRGLMTLTSDKLEVNEDAAGNQFGVATADKGKIVTIRQDRPETFELIEGKGLRA 120

Query: 120 YVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCE-----SDQVQS 173
             +  K    L G       +  K  +T  G ++  N  T     QG         +V+S
Sbjct: 121 EYESSKSQFDLIGQAIVTRYICGKPFDTIRGDRVRYNEKTGIYQAQGGPNSSAAGGRVRS 180

Query: 174 IIRYDGR 180
           +     +
Sbjct: 181 LAEPRAK 187


>gi|33598533|ref|NP_886176.1| hypothetical protein BPP4031 [Bordetella parapertussis 12822]
 gi|33574662|emb|CAE39314.1| putative exported protein [Bordetella parapertussis]
          Length = 206

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 63/187 (33%), Gaps = 11/187 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH-IKADMLEVKDAVQKAFF 63
           +  + L +  L L  +LL A    A A   +       E    I +D L   D  +++ F
Sbjct: 1   MTHLRLSLAPLRLCSILLLAAAGAAQAQAQSGQAAPAEEPSTLILSDTLHYDDIKRQSIF 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNG 119
            GNV +T+   +L +DK+ ++ +                + + +        I       
Sbjct: 61  TGNVILTRGLMTLTSDKLEVNEDAAGNQFGVATADKGKIVTIRQGRPETFELIEGKGLRA 120

Query: 120 YVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCE-----SDQVQS 173
             +  K    L G       +  K  +T  G ++  N  T     QG         +V+S
Sbjct: 121 EYESSKSQFDLIGQAIVTRYICGKPFDTIRGDRVRYNEKTGIYQAQGGPNSSAAGGRVRS 180

Query: 174 IIRYDGR 180
           +     +
Sbjct: 181 LAEPRAK 187


>gi|167648911|ref|YP_001686574.1| OstA family protein [Caulobacter sp. K31]
 gi|167351341|gb|ABZ74076.1| OstA family protein [Caulobacter sp. K31]
          Length = 196

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 66/170 (38%), Gaps = 22/170 (12%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A +         +  + I AD  EV  +  K  F+G V + Q+   ++A  MT+      
Sbjct: 27  AQTPAAGGGNNSSAPVDISADEQEVITSQCKTIFRGAVEVLQDKARMRAATMTVYNRRKA 86

Query: 90  RDVS----------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
              +            ++ ++ + N+F  + E  V   +   D+    +V+ GD    V+
Sbjct: 87  PGKASSAPGGNNDCGDVDHVEADGNVFYVTPEQTVRGDHAVYDYATDTIVVTGD----VV 142

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQ----GCESDQVQSIIRY----DGRP 181
             +  +   G ++ +   T+   ++    G    +V++++      D +P
Sbjct: 143 AVQGQDVARGDRMTIKTKTNDVKMESNATGRGKTRVRAVLYPDQTKDKKP 192


>gi|254426833|ref|ZP_05040540.1| cell envelope biogenesis protein YhbN, putative [Alcanivorax sp.
           DG881]
 gi|196193002|gb|EDX87961.1| cell envelope biogenesis protein YhbN, putative [Alcanivorax sp.
           DG881]
          Length = 199

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 52/137 (37%), Gaps = 8/137 (5%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            I + AD    +       ++GNV + Q    L AD+M +   N +              
Sbjct: 32  PIQVTADSGRFEQDAGSGLYRGNVELIQGKRKLFADEMRLFTKNGDLVRVEATGSP---- 87

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
               +   +N  A N   D   R LVL GD      ++ + NTF G K+  ++D+     
Sbjct: 88  VRMEEGEGLNAHAENLVYDINARTLVLTGDAY----IEHQGNTFEGAKVEYSLDSKRVDA 143

Query: 164 QGCESDQVQSIIRYDGR 180
                 +V+ +I  + +
Sbjct: 144 SSEGDQRVRLVIPAENQ 160


>gi|296106416|ref|YP_003618116.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
 gi|295648317|gb|ADG24164.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
          Length = 155

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/151 (11%), Positives = 47/151 (31%), Gaps = 9/151 (5%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                   + + + +D  ++     +  + GNV   Q   +L+A+K     +  N+    
Sbjct: 8   NALPFDKEKMVQVVSDSADLNQKNHQGVYIGNVEFVQGSTNLRAEKAITQGDAKNQLTLA 67

Query: 95  KINRMDVERNIFI-----QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                  ++  +           +  A        K ++ L G+      +++  N+   
Sbjct: 68  IAKGSKGKQAHYWTTTAPDKPPFHAYADTIKYYPLKHLIELIGNAR----IEQGPNSLSA 123

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            K+  +           E  +   II  + +
Sbjct: 124 AKISYDTQEQHVLSHSDEKTRTTIIIYPEKK 154


>gi|323697962|ref|ZP_08109874.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio sp. ND132]
 gi|323457894|gb|EGB13759.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio desulfuricans ND132]
          Length = 265

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 56/138 (40%), Gaps = 7/138 (5%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDV 101
            + I +D +   +  +   F GNV  T  + +L ADK++         +  ++ ++R+  
Sbjct: 128 PVRITSDRMTYDETGKVIAFVGNVVATHGELTLWADKLSAYLSARTDKKFSADSVDRIVA 187

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           E N+  + G               ++L +  +      L++  N+  G  +  +I    +
Sbjct: 188 EGNVRAKKGTTEGTCGKLTYLVGPQLLKMERNPK----LQDGPNSLTGEVINFHIKDDRS 243

Query: 162 SLQGCESDQVQSIIRYDG 179
            + G E  +V++I    G
Sbjct: 244 EVIGGE-QRVKAIFMTPG 260


>gi|77457086|ref|YP_346591.1| OstA-like protein [Pseudomonas fluorescens Pf0-1]
 gi|77381089|gb|ABA72602.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 181

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 58/179 (32%), Gaps = 14/179 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L+  + +LL    +  + S          + I I+AD  ++ D    A +KG+V +TQ
Sbjct: 1   MRLVKTLPILLSLGAALGSVSAW-ALPNDSQQPIRIQADDAQLDDKNGIATYKGDVIITQ 59

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN---VIASNGYVDFQKRIL 128
               ++ + +T+                          G+               Q+  +
Sbjct: 60  GSMIVKGNTVTMTRAPNGDIDVVTSVGNLAYFEQLQTQGDAKPVQGYGVTIQYHAQQNRV 119

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ-------SIIRYDGR 180
           VL        ++ +  N   G K++ +     AS       +V         +I+   +
Sbjct: 120 VLIDKAK---VVDKDNNVTQGEKIVYDTVKKLASAGRATGSKVTEARPRIDMVIQPKKK 175


>gi|103487822|ref|YP_617383.1| OstA-like protein [Sphingopyxis alaskensis RB2256]
 gi|98977899|gb|ABF54050.1| OstA-like protein [Sphingopyxis alaskensis RB2256]
          Length = 191

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 74/177 (41%), Gaps = 16/177 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAA----ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
              + L    FVL    +        A+         N  +   A  +EV+D   +    
Sbjct: 7   RRSLMLAGAGFVLTSLAILSVGGGDRAAAQALANHNSNAPVDFAAGSIEVQDRADRVVLA 66

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +TQ    + A +MT+ Y    R     +NR+D    + +  G+ +   +    D  
Sbjct: 67  GNVRVTQAGLVVTAPRMTVAYT---RAGGTDVNRLDATGGVTVVKGDESARGNVAIYDLD 123

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           +R++ + G+    V L+++ N   G +L++++++  A++ G  + +       DG P
Sbjct: 124 RRLITMVGN----VELRQRGNNLRGGRLVIDLNSGRATVDGRGAAR-----GPDGNP 171


>gi|261838855|gb|ACX98621.1| hypothetical protein KHP_1437 [Helicobacter pylori 51]
          Length = 185

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFSVLSVMSAQKTDNKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|217033820|ref|ZP_03439245.1| hypothetical protein HP9810_877g24 [Helicobacter pylori 98-10]
 gi|216943718|gb|EEC23161.1| hypothetical protein HP9810_877g24 [Helicobacter pylori 98-10]
          Length = 185

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFSVLSVMSAQKTDNKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|71909033|ref|YP_286620.1| OstA-like protein [Dechloromonas aromatica RCB]
 gi|71848654|gb|AAZ48150.1| OstA-like protein [Dechloromonas aromatica RCB]
          Length = 200

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 63/181 (34%), Gaps = 21/181 (11%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
            I  LA + + L A L           K   ++ + ++A  + + DA +    +G+V +T
Sbjct: 1   MIIRLATLTLCLFATL------PAHAEKADRDKPMLLEASRVSIDDAKKIQILEGDVVIT 54

Query: 71  QEDFSLQADKMTIDYN----NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           +    L+AD++ I  +          + K       +    +   +   A     +    
Sbjct: 55  KGTMILKADRVVITEDQYGFQKGTAFNGKNGLAYFRQKREGKEEYVEGEAERIEYNTNSE 114

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-------QVQSIIRYDG 179
           I  L      +  +K   +   G  +  +  +    +   E+        +V+++I+   
Sbjct: 115 IAELF----HRAWVKSGEDLVRGDYIWYDAVSEKYLVTAGETRDPKGPAPRVRAVIQPKN 170

Query: 180 R 180
           +
Sbjct: 171 K 171


>gi|325998439|gb|ADZ50647.1| hypothetical protein hp2017_1522 [Helicobacter pylori 2017]
          Length = 185

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 52/160 (32%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A        K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMSAQKLENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|126668777|ref|ZP_01739725.1| hypothetical protein MELB17_07229 [Marinobacter sp. ELB17]
 gi|126626760|gb|EAZ97409.1| hypothetical protein MELB17_07229 [Marinobacter sp. ELB17]
          Length = 193

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 55/153 (35%), Gaps = 10/153 (6%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           ++    F +  N  I++ A+   + DA   A + G+V + Q D  L A ++ +  +    
Sbjct: 32  STPGLAFDLDSNIPINVAANSARLDDAKGVATYTGDVELVQGDTKLFAQEVVLYRDINGL 91

Query: 91  DVSNKINRMDVERNIFIQ-SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
           +                   GE +  A        ++ L    D     ++++  N F G
Sbjct: 92  NRIEATGTPAHYVQPTANGKGETDAKALTITWSAAEKQLTFERDA----VIRQTGNIFRG 147

Query: 150 CKLIVNIDTSFASLQ-----GCESDQVQSIIRY 177
             ++ +      + Q     G  S +V+  I+ 
Sbjct: 148 ELILYDTVNRVVTAQGSTEAGSGSGRVEMTIQP 180


>gi|114048836|ref|YP_739386.1| OstA family protein [Shewanella sp. MR-7]
 gi|113890278|gb|ABI44329.1| OstA family protein [Shewanella sp. MR-7]
          Length = 183

 Score = 82.7 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 53/162 (32%), Gaps = 8/162 (4%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           +LL   +   + S   +      +++ IKA          +  F G V +TQ    + AD
Sbjct: 6   ILLAGLMLMTSMSAFAKV-GDLQQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHAD 64

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKV 138
           ++       +              +  +  G   +  A     +   R L L G      
Sbjct: 65  QLRAFSAEGDNSKILVATGNPATYSQILDDGRPASASAKEIRYEMATRTLTLTGSA---- 120

Query: 139 ILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
            L +  +   G  +  NI      A   G   D+V +II+ D
Sbjct: 121 TLDQAGSQVTGNLIRYNIIQQKLIAESTGSGDDRVITIIQPD 162


>gi|114769795|ref|ZP_01447405.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|114549500|gb|EAU52382.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|161170291|gb|ABX59261.1| uncharacterized protein conserved in bacteria [uncultured marine
           bacterium EB000_55B11]
 gi|297183819|gb|ADI19942.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 160

 Score = 82.3 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 67/154 (43%), Gaps = 12/154 (7%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             +Q A+  ++      N  + I A+ L +  +   A F+G  ++ Q    L ADK+ + 
Sbjct: 19  VFAQNASLSLSGANHDINLPVEITANNLSINQSSNSAIFEGTAYVGQGSLRLSADKIVVR 78

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
           YN      + K+  ++    +   +GE    A +        +L ++G+    V+L +  
Sbjct: 79  YNQD----TGKVTSVEATGKVVFTNGEDIAEAESAIYKIDSGLLSMSGN----VLLVQGK 130

Query: 145 NTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +T  G  L ++I  + A+L G     V++ +  +
Sbjct: 131 STISGNYLDMDILKNIANLSGN----VKTTLAPN 160


>gi|117919126|ref|YP_868318.1| OstA family protein [Shewanella sp. ANA-3]
 gi|117611458|gb|ABK46912.1| OstA family protein [Shewanella sp. ANA-3]
          Length = 183

 Score = 82.3 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/161 (18%), Positives = 50/161 (31%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A L    +           +++ IKA          +  F G V +TQ    + AD+
Sbjct: 6   ILLAGLMLITSMSAFAKVGDLQQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHADQ 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +                      +  +  G   +  A     +   R L L G       
Sbjct: 66  LRAFSAEGENSKILVATGNPATYSQILDDGRPASASAKEIRYEMATRTLTLTGSA----T 121

Query: 140 LKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
           L +  +   G  +  +I      A   G   D+V +II+ D
Sbjct: 122 LDQAGSQVTGNLIRYDIIQQKLIAESTGSGDDRVITIIQPD 162


>gi|330964013|gb|EGH64273.1| ostA family protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 155

 Score = 82.3 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 46/148 (31%), Gaps = 6/148 (4%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
              +   ++         ++ IHI++D  ++ D    A +KGNV +TQ    +  + +TI
Sbjct: 3   GLSAALGSASAWSLPNDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQGSMKITGNTVTI 62

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEIN--VIASNGYVDFQKRILVLNGDRADKVILK 141
             N                        +      A        +  +VL     DK  + 
Sbjct: 63  TRNAQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAITIQYYAGQDRIVLI----DKAKVI 118

Query: 142 EKLNTFLGCKLIVNIDTSFASLQGCESD 169
              NT  G K++ +      S       
Sbjct: 119 NDGNTSEGEKIVYDTVRQVVSAGRANGG 146


>gi|317010259|gb|ADU80839.1| hypothetical protein HPIN_08315 [Helicobacter pylori India7]
          Length = 185

 Score = 82.3 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTDSKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|319791175|ref|YP_004152815.1| lipopolysaccharide transport periplasmic protein lpta [Variovorax
           paradoxus EPS]
 gi|315593638|gb|ADU34704.1| lipopolysaccharide transport periplasmic protein LptA [Variovorax
           paradoxus EPS]
          Length = 238

 Score = 82.3 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 59/175 (33%), Gaps = 17/175 (9%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           + + A L    AS +       ++ ++I++D +   D  Q + F GNV +T+    ++  
Sbjct: 19  LAIGALLLAGLASGVLAETADRSKPMNIESDAMRYDDLKQTSVFTGNVLVTKGTIIIRGA 78

Query: 80  KMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           ++ +  +               R   ++        I   +     D +   +    +  
Sbjct: 79  RLDVRQDAEGYQYGVVTAAPGKRAYYKQKRNAPDEWIEGESEVIEYDSRADNVKFIRNAT 138

Query: 136 DKVIL-KEKLNTFLGCKLIVNIDTSFASLQGC------------ESDQVQSIIRY 177
            + +L     +   G  ++ +      ++ G              + +V++I+  
Sbjct: 139 MRRLLGATPNDESQGALIVYDQSNDTYTVNGSTVPPNTAVNASTPTGRVKTILTP 193


>gi|210135746|ref|YP_002302185.1| hypothetical protein HPP12_1559 [Helicobacter pylori P12]
 gi|210133714|gb|ACJ08705.1| hypothetical protein HPP12_1559 [Helicobacter pylori P12]
          Length = 185

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|113969019|ref|YP_732812.1| OstA family protein [Shewanella sp. MR-4]
 gi|113883703|gb|ABI37755.1| OstA family protein [Shewanella sp. MR-4]
          Length = 183

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 54/162 (33%), Gaps = 8/162 (4%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           +LL   +   + S  T+      +++ IKA          +  F G V +TQ    + AD
Sbjct: 6   ILLAGLMLMTSMSAFTKV-GDLQQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHAD 64

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKV 138
           ++       +              +  +  G   +  A     +   R L L G      
Sbjct: 65  QLRAFSAEGDNSKILVATGNPATYSQILDDGRPASASAKEIRYEMATRTLTLTGSA---- 120

Query: 139 ILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
            L +  +   G  +  NI      A   G   D+V +II+ D
Sbjct: 121 TLDQAGSQVTGNLIRYNIIQQKLIAESTGSGDDRVITIIQPD 162


>gi|307609629|emb|CBW99133.1| hypothetical protein LPW_09181 [Legionella pneumophila 130b]
          Length = 155

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 18/151 (11%), Positives = 47/151 (31%), Gaps = 9/151 (5%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                   + + + +D  ++     +  + GNV   Q   +L+A+K     +  N+    
Sbjct: 8   NALPFDKEKMVQVVSDSADLNQKNHQGVYIGNVEFVQGSTNLRAEKAITQGDAKNQLTLA 67

Query: 95  KINRMDVERNIFI-----QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                  ++  +           +  A        K ++ L G+      +++  N+   
Sbjct: 68  IAEGSKDKQAHYWTTTAPDKPPFHAYADTIKYYPLKHLIELIGNAR----IEQGPNSLSA 123

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            K+  +           E  +   II  + +
Sbjct: 124 AKISYDTQEQHVLSHSDEKTRTTIIIYPEKK 154


>gi|217031723|ref|ZP_03437227.1| hypothetical protein HPB128_155g36 [Helicobacter pylori B128]
 gi|298737140|ref|YP_003729670.1| hypothetical protein HPB8_1649 [Helicobacter pylori B8]
 gi|216946570|gb|EEC25170.1| hypothetical protein HPB128_155g36 [Helicobacter pylori B128]
 gi|298356334|emb|CBI67206.1| conserved hypothetical protein [Helicobacter pylori B8]
          Length = 185

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMSAQKTENRGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|119897082|ref|YP_932295.1| hypothetical protein azo0791 [Azoarcus sp. BH72]
 gi|119669495|emb|CAL93408.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 190

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/152 (10%), Positives = 49/152 (32%), Gaps = 18/152 (11%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS----NK 95
             ++ ++I+A+ + V D  +   F+G+V +TQ    ++ DK+ +  +           + 
Sbjct: 29  DRDQPVNIEANKVTVDDRNKVHIFEGDVVLTQGTLVIKGDKLVVTQDAGGFQNGVATASN 88

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
                  +     +  +   A       +     L      +  +    +   G  +  +
Sbjct: 89  PRLATFRQKREGSNEYVYGEAERIEYSSRTEKAKLF----VRAKVTSGGDEVRGHFIEYD 144

Query: 156 IDTSFA----------SLQGCESDQVQSIIRY 177
             +             +       +V+++I+ 
Sbjct: 145 SMSENYLVTNAPGAAPAATSGGDGRVRAVIQP 176


>gi|308062851|gb|ADO04739.1| hypothetical protein HPCU_08030 [Helicobacter pylori Cuz20]
          Length = 185

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV  L    +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCLGILSVMSAQKTDNKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|261840261|gb|ACY00027.1| hypothetical protein HPKB_1491 [Helicobacter pylori 52]
          Length = 185

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV  L    +  A        K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCLSVLSVMDAKKLENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|307638255|gb|ADN80705.1| OstA family organic solvent tolerance protein [Helicobacter pylori
           908]
 gi|325996847|gb|ADZ52252.1| hypothetical protein hp2018_1528 [Helicobacter pylori 2018]
          Length = 185

 Score = 82.3 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 52/160 (32%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A        K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMSAQKLENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|308185355|ref|YP_003929488.1| hypothetical protein HPSJM_08105 [Helicobacter pylori SJM180]
 gi|308061275|gb|ADO03171.1| hypothetical protein HPSJM_08105 [Helicobacter pylori SJM180]
          Length = 185

 Score = 81.9 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMSAQKTDNKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|237746785|ref|ZP_04577265.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes HOxBLS]
 gi|229378136|gb|EEO28227.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes HOxBLS]
          Length = 184

 Score = 81.9 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 61/185 (32%), Gaps = 20/185 (10%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
                LLAL+F +  A  +          +   N+  +I+AD +   D  Q   F GNV 
Sbjct: 3   KTSFKLLALLFCIGLASNAA-------AERADANKPTNIEADQMTSDDVKQITTFTGNVV 55

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-----EINVIASNGYVDF 123
           +T+    ++A K  I  +                 ++  +        I         D 
Sbjct: 56  VTKGTLLIKAGKAVIVEDPEGYQFITLYAAPGKLASLRQKQDAGPDIWIEGYGEKIEYDN 115

Query: 124 QKRILVLNGDRADKVIL-KEKLNTFLGCKLIVNIDTSFAS-------LQGCESDQVQSII 175
           +K +         K +   +  +   G  +  +  T + S       +    + +V+++I
Sbjct: 116 KKEVAKFFTRARVKRLQGTKITDDITGEFISYDGKTEYYSVYNTNEGVSKPGAGRVKAVI 175

Query: 176 RYDGR 180
           +   +
Sbjct: 176 QPREK 180


>gi|73540063|ref|YP_294583.1| OstA-like protein [Ralstonia eutropha JMP134]
 gi|72117476|gb|AAZ59739.1| OstA-like protein [Ralstonia eutropha JMP134]
          Length = 213

 Score = 81.9 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/157 (12%), Positives = 50/157 (31%), Gaps = 17/157 (10%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             +   ++ + ++AD     D  Q     GNV +T+    L++D   I  +         
Sbjct: 34  AERADRDKPLVLEADNASYDDVKQIYTLTGNVVLTKGTMVLKSDAAEIRTDPEGYQYAVA 93

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL---NTFL 148
            +    +  + +        ++        D ++ +  L G      +  +     +   
Sbjct: 94  TAKGGKQAYIRQKRDGVDEYMDGWGDRIEYDGKQELSKLIGHARMARL--QGAKLVDEIR 151

Query: 149 GCKLIVNIDTSFASLQGC--------ESDQVQSIIRY 177
           G  L  +    F +  G          S +V++++  
Sbjct: 152 GAVLTYDSRNEFYTAAGGGDNTSAGNPSGRVRAVLSP 188


>gi|317179769|dbj|BAJ57557.1| hypothetical protein HPF30_1460 [Helicobacter pylori F30]
 gi|317182793|dbj|BAJ60577.1| hypothetical protein HPF57_1503 [Helicobacter pylori F57]
          Length = 185

 Score = 81.9 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTDNKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|188528360|ref|YP_001911047.1| hypothetical protein HPSH_08170 [Helicobacter pylori Shi470]
 gi|308183723|ref|YP_003927850.1| hypothetical protein HPPC_08010 [Helicobacter pylori PeCan4]
 gi|188144600|gb|ACD49017.1| hypothetical protein HPSH_08170 [Helicobacter pylori Shi470]
 gi|308064350|gb|ADO06237.1| hypothetical protein HPSAT_07685 [Helicobacter pylori Sat464]
 gi|308065908|gb|ADO07800.1| hypothetical protein HPPC_08010 [Helicobacter pylori PeCan4]
          Length = 185

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTDDKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|317013383|gb|ADU83991.1| hypothetical protein HPLT_08100 [Helicobacter pylori Lithuania75]
          Length = 185

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTDNKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|325295349|ref|YP_004281863.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065797|gb|ADY73804.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 170

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 73/173 (42%), Gaps = 18/173 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + L + LL     +  + L +         K   +  I I++  L        A + GNV
Sbjct: 1   MRLVVSLLIFFMSISLSALGET--------KEKTSTPIVIESQKLIYIQKKHMATYIGNV 52

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
              +E   ++ DK+ + ++ T+      I +++V  +++I+        +  Y    +  
Sbjct: 53  IAQREKTIMKGDKLIVYFDPTD----RYIEKIEVIGHVYIKDPRGEGWCNKLYYYPVQEK 108

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            VL G+      LK+K N  +G ++I        +++G +  +V+++I  + +
Sbjct: 109 AVLIGNAK----LKQKENLVVGDEIIAY-KDGRVTVEGIK-QRVKTVIFPEEK 155


>gi|209966460|ref|YP_002299375.1| hypothetical protein RC1_3201 [Rhodospirillum centenum SW]
 gi|209959926|gb|ACJ00563.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 279

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 56/154 (36%), Gaps = 8/154 (5%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q A       K+   + +    D LE       A  +G+    + D  ++AD++ +    
Sbjct: 122 QVAVLTGQGLKLETEQDVVTARDSLEYWREQNLAVARGDAVAVRGDNRVRADRL-VGLLQ 180

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
            N      + R+D E ++ I +         G  D  +R+ VL G+    V +    N  
Sbjct: 181 ENDQGDLDLTRIDAEGSVVITTPTDVARGDQGTYDMTERVAVLTGN----VKITRGRNQL 236

Query: 148 LGCKLIVNIDTSFASLQGCE---SDQVQSIIRYD 178
            G    V+++T  + +         +V+ +    
Sbjct: 237 NGNAAEVDLETGISRILSGPEGGKGRVRGLFVPG 270



 Score = 64.6 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 56/150 (37%), Gaps = 11/150 (7%)

Query: 31  ASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A   T     G   + I AD  LE     Q    +GN   T+ D S++AD +T  Y    
Sbjct: 27  ARAQTARLDEGKAPVAIDADQALEWHKEQQAYVARGNAVATRGDLSVRADTLTAYYRE-L 85

Query: 90  RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                +I R+  E  + I++         G  +  +++ VL G       L+ + +    
Sbjct: 86  PAGGTEIYRLAAEGGVVIKAPRQTAYGDRGVYEVDRQVAVLTGQGLK---LETEQDVVTA 142

Query: 150 -CKLIVNIDTSFASLQGC-----ESDQVQS 173
              L    + + A  +G        ++V++
Sbjct: 143 RDSLEYWREQNLAVARGDAVAVRGDNRVRA 172



 Score = 38.4 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/104 (11%), Positives = 25/104 (24%), Gaps = 7/104 (6%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIK-------ADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L   L +     +   ++     + I         D        + A   GNV +T+   
Sbjct: 175 LVGLLQENDQGDLDLTRIDAEGSVVITTPTDVARGDQGTYDMTERVAVLTGNVKITRGRN 234

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
            L  +   +D       + +               G+       
Sbjct: 235 QLNGNAAEVDLETGISRILSGPEGGKGRVRGLFVPGQEAGQGVK 278


>gi|56459509|ref|YP_154790.1| hypothetical protein IL0398 [Idiomarina loihiensis L2TR]
 gi|56178519|gb|AAV81241.1| Uncharacterized conserved membrane protein [Idiomarina loihiensis
           L2TR]
          Length = 180

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 57/181 (31%), Gaps = 16/181 (8%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
            L      +  L LV ++  A ++Q         K   ++ + +++   E+     +   
Sbjct: 1   MLKRFSSLLSKLILVALIPSAVMAQG--------KSDFSKPMEVESSKEELDIKNNRLVL 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYV 121
             NV + Q    ++AD++    + +                        EIN  A     
Sbjct: 53  TDNVIIRQGTLLIRADRLEASASESAEQADIFIAEGTPATYSQTLDDGNEINAEAKKITY 112

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL--QGCESDQVQSIIRYDG 179
              ++ L L+GD            +     +  +++    +    G E  +V +I     
Sbjct: 113 FQSEQRLELSGDARISQGSSSSSGSL----ITYDLNKQTVTASSSGEEDSRVITIFTPKP 168

Query: 180 R 180
           +
Sbjct: 169 K 169


>gi|90578115|ref|ZP_01233926.1| hypothetical protein yhbN precursor [Vibrio angustum S14]
 gi|90441201|gb|EAS66381.1| hypothetical protein yhbN precursor [Vibrio angustum S14]
          Length = 163

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 59/161 (36%), Gaps = 6/161 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L  A      +S     K      IH++A   +V          G V +TQ    ++ADK
Sbjct: 5   LFAAGCMLLLSSSTWAEKADTQLPIHLEAITQDVDVINNVTTLTGKVDITQGGVQIKADK 64

Query: 81  MTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
             I  ++  + + +     +      +      ++  +  G       ++VL     DK 
Sbjct: 65  AVIKLDSKTKALKSVEVYGKPAYFHRVMEDGKVVDGESLYGIYTPTNNMMVL----KDKA 120

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            + +  +T    ++  N+ +     +G +S QV +++  + 
Sbjct: 121 KIAQNGSTIQAAEISYNLASQVMKAKGSKSRQVNTVLLPEK 161


>gi|71277840|ref|YP_271189.1| OstA family protein [Colwellia psychrerythraea 34H]
 gi|71143580|gb|AAZ24053.1| OstA family protein [Colwellia psychrerythraea 34H]
          Length = 201

 Score = 81.9 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/182 (12%), Positives = 60/182 (32%), Gaps = 18/182 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M   L    + +  +A   + +   L+               ++I I A+  +     + 
Sbjct: 1   MKVNLIKKTVSVLAVASSLLFVSNALAAI---------KDLEQEIIIVAESQDADLKNKI 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTID-----YNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
             +  NV + Q   S+ AD + +       N+   +      +  +          I + 
Sbjct: 52  ISYLDNVIIRQGSISITADVVKVFSQVNKKNDEKNETYLAKGKPAIFEQQLEDGSLITLQ 111

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           A           ++++G+     ++K+  +   G ++  N  +     +   +  V +I+
Sbjct: 112 ADEITYSPNSNTIIISGNA----LVKQAGSEVSGNEITYNTVSEKLQARSANNQPVTTIL 167

Query: 176 RY 177
           + 
Sbjct: 168 QP 169


>gi|328953772|ref|YP_004371106.1| OstA family protein [Desulfobacca acetoxidans DSM 11109]
 gi|328454096|gb|AEB09925.1| OstA family protein [Desulfobacca acetoxidans DSM 11109]
          Length = 207

 Score = 81.5 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 55/181 (30%), Gaps = 27/181 (14%)

Query: 23  KADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
                    S            ++I A  LEV  + Q   F   V    +D  L  D + 
Sbjct: 19  SFAAPPLCYSQTDNVPGQEQLPLNITAARLEVDHSQQVISFLTKVEARYKDLILYTDLLK 78

Query: 83  IDYNNTNRDVSNKIN-----------------------RMDVERNIFIQSGEINVIASNG 119
           I Y         K +                       R++   N+ I   +        
Sbjct: 79  IFYQAKTETPGGKTSAGQKDDSKGAASPLGAVGIEKILRIEALGNVRIVQQDRVATGEKA 138

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
               Q+  +VL G+      L    ++  G +++  +  + A ++G    +V+++I    
Sbjct: 139 IYYTQEEKIVLLGNPQ----LWRGESSLKGREIVFFLKDNRAVVEGDPEKRVEAVIYPSS 194

Query: 180 R 180
           +
Sbjct: 195 K 195


>gi|317178290|dbj|BAJ56079.1| hypothetical protein HPF16_1482 [Helicobacter pylori F16]
          Length = 185

 Score = 81.5 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMNAQKTDNKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|315585974|gb|ADU40355.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, permease protein [Helicobacter pylori 35A]
          Length = 185

 Score = 81.5 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTDNKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|254780099|ref|YP_003058206.1| hypothetical protein HELPY_1571 [Helicobacter pylori B38]
 gi|254002012|emb|CAX30271.1| Conserved hypothetical protein [Helicobacter pylori B38]
          Length = 183

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMDAQKTDNKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|288819046|ref|YP_003433394.1| hypothetical protein HTH_1749 [Hydrogenobacter thermophilus TK-6]
 gi|288788446|dbj|BAI70193.1| hypothetical protein HTH_1749 [Hydrogenobacter thermophilus TK-6]
 gi|308752629|gb|ADO46112.1| lipopolysaccharide transport periplasmic protein LptA
           [Hydrogenobacter thermophilus TK-6]
          Length = 149

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 60/160 (37%), Gaps = 25/160 (15%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           ++  + ++L   ++              ++ I  +AD L  +    +  + G+V +++ +
Sbjct: 1   MIIFLMLILLGGIAL-------------SQPILGEADSLTYEKD--RIIYTGHVKLSRGN 45

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             + ADK+ I  +   +    +      E ++    G     A     DFQ  ++ L G+
Sbjct: 46  AIITADKVVIYLDENRKAKKAE-----AEGHVKYVEGNRRASADRAEYDFQSDVIKLFGN 100

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
                 ++E  N     +++       A     E  +V++
Sbjct: 101 AK----VEEGKNFVEADQIVYYRKEDRAVAMS-EGKRVRT 135



 Score = 36.4 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 8/63 (12%), Positives = 17/63 (26%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI 107
            AD  E           GN  + +    ++AD++            ++  R+        
Sbjct: 82  SADRAEYDFQSDVIKLFGNAKVEEGKNFVEADQIVYYRKEDRAVAMSEGKRVRTFYVEEK 141

Query: 108 QSG 110
              
Sbjct: 142 GEK 144


>gi|238028655|ref|YP_002912886.1| OstA-like protein [Burkholderia glumae BGR1]
 gi|237877849|gb|ACR30182.1| OstA-like protein [Burkholderia glumae BGR1]
          Length = 223

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/163 (15%), Positives = 53/163 (32%), Gaps = 16/163 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      K   N+ I ++AD L   D  Q     GNV +T+    ++ D++ +  +    
Sbjct: 34  APVAHAEKADQNKPIQVEADNLTYDDLKQVTVATGNVVITKGTILIKGDRVEVRQDPQGY 93

Query: 91  ------DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKE 142
                             +        I+  A     D ++ +  L  D   + +  L  
Sbjct: 94  QYATATMAPGSKKHASFRQKREGLDEYIDGDAERIDYDGKQDLTTLTRDATVRRLQGLST 153

Query: 143 KLNTFLGCKLIVNIDTSFASLQGCES--------DQVQSIIRY 177
             +T  G  +  +    F + +G            +V++++  
Sbjct: 154 VADTVHGSVITYDGQHDFYTAKGGSDVSAPGNPTGRVRAMLSP 196


>gi|297380743|gb|ADI35630.1| cell envelope biogenesis protein YhbN [Helicobacter pylori v225d]
          Length = 185

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   VLVCCFGILSVMSAQKTDDKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|78356812|ref|YP_388261.1| hypothetical protein Dde_1769 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219217|gb|ABB38566.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 179

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 74/188 (39%), Gaps = 24/188 (12%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N I +  H++ ++   L    + A A+         +    I +  +      Q   F+
Sbjct: 1   MNRISITGHMIMVLLACLVLQAAPATAAE--------DIPTSITSKTMTYDANAQLIIFE 52

Query: 65  GNVFMTQEDFSLQADKMTIDYNNT------------NRDVSNKINRMDVERNIFIQSGEI 112
            +V++ + +F L AD +++  +                  + +INR+  E N+ ++    
Sbjct: 53  QDVYVQRGEFELWADSISVYLDKNASAAAKQNDAEGPAIDAGQINRLVAEGNVRMKQLTK 112

Query: 113 NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
           +           + +LV+ GD     +L+++ N+  G ++   ++ + + + G     V 
Sbjct: 113 SGECRKATYKVSEGLLVMEGDP----VLRDEGNSIGGQEIRFYVNENRSEVLGAPGKPVN 168

Query: 173 SIIRYDGR 180
           ++     R
Sbjct: 169 AVFSAPKR 176


>gi|217971900|ref|YP_002356651.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS223]
 gi|217497035|gb|ACK45228.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS223]
          Length = 184

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 57/170 (33%), Gaps = 16/170 (9%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + L++L+ ++  +  ++              +++ IKA          +  F G V +TQ
Sbjct: 6   VLLVSLMLIMSMSAFAKV---------DDLKQEVKIKAVSQTADIKNNQIIFFGPVEVTQ 56

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVL 130
               + AD++                      +  +  G   +  A     D   R L L
Sbjct: 57  GSIKIHADQLRAFSAEGENSKILVATGNPATYSQVLDDGRPASASAKEIRYDMASRTLTL 116

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
            G  +    L +  +   G  +  NI      A   G   D+V +II+ +
Sbjct: 117 KGKAS----LDQAGSQVTGNLIRYNIIQQKLIAESTGSGDDRVITIIQPE 162


>gi|207092004|ref|ZP_03239791.1| hypothetical protein HpylHP_02888 [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 183

 Score = 81.5 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 55/162 (33%), Gaps = 3/162 (1%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           ++ LV       +  A  +     K      + I  +     D  + A  +GNV + +  
Sbjct: 2   VVFLVCCFGILSVMSAQKTENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGK 60

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             L ADK+++  N+  +    +             + EI+  A     +       L  +
Sbjct: 61  DRLFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQN 120

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
              + + K   N   G ++I+N    +A + G      + + 
Sbjct: 121 AVVREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 160


>gi|94309250|ref|YP_582460.1| OstA-like protein [Cupriavidus metallidurans CH34]
 gi|93353102|gb|ABF07191.1| conserved hypothetical protein; OstA-like protein [Cupriavidus
           metallidurans CH34]
          Length = 214

 Score = 81.1 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/162 (13%), Positives = 49/162 (30%), Gaps = 15/162 (9%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      +    + + ++AD     D  Q     GNV +T+    L++D   +  +    
Sbjct: 29  AQPAFAERADQTKPLVLEADNASYDDVKQIYTLTGNVVLTKGTMVLKSDAAELRTDPEGY 88

Query: 91  D----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-- 144
                 S    +  + +        I+        D +  I  L G+     +       
Sbjct: 89  QYAIATSKPGRQAYIRQKRDGVDEYIDGWGDRIEYDGKSEINKLIGNARAARVSGVGAKI 148

Query: 145 -NTFLGCKLIVNIDTSFASLQGC--------ESDQVQSIIRY 177
            +   G  +  +    F +  G          S +V++++  
Sbjct: 149 LDEIRGAVITYDSRNEFYTATGGDNNASAGNPSGRVRAVLSP 190


>gi|152992814|ref|YP_001358535.1| hypothetical protein SUN_1224 [Sulfurovum sp. NBC37-1]
 gi|151424675|dbj|BAF72178.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 157

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 56/140 (40%), Gaps = 4/140 (2%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI--NRMD 100
           EK+ + +D ++ +D  ++  F GNV + Q D  L  DK+ + ++  N     +       
Sbjct: 19  EKVEVTSDSMKAEDLKKEVHFIGNVKIKQLDSWLHGDKVIVYFDENNETRMYEAVGKDNV 78

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
           V   +  + G     A N          VL G      +L        G  +++++ T  
Sbjct: 79  VTFEVKEKKGFYKGSALNVKYYPLTSKYVLTGKAVIDDLL--NKRHIDGDVIVLDMTTGN 136

Query: 161 ASLQGCESDQVQSIIRYDGR 180
           A+++G     V+ I   + +
Sbjct: 137 ATVKGSRKKPVKFIFDMEEK 156


>gi|126175861|ref|YP_001052010.1| OstA family protein [Shewanella baltica OS155]
 gi|152999227|ref|YP_001364908.1| cell envelope biogenesis YhbN [Shewanella baltica OS185]
 gi|160873840|ref|YP_001553156.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS195]
 gi|125999066|gb|ABN63141.1| OstA family protein [Shewanella baltica OS155]
 gi|151363845|gb|ABS06845.1| Cell envelope biogenesis YhbN [Shewanella baltica OS185]
 gi|160859362|gb|ABX47896.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS195]
 gi|315266067|gb|ADT92920.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS678]
          Length = 184

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 51/161 (31%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A L    +           +++ IKA          +  F G V +TQ    + AD+
Sbjct: 6   VLLASLMLIMSMSAFAKVDDLKQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHADQ 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +                      +  +  G   +  A     D   R L L G  +    
Sbjct: 66  LRAFSAEGENSKILVATGNPATYSQVLDDGRPASASAKEIRYDMASRTLTLKGKAS---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
           L +  +   G  +  NI      A   G   D+V +II+ +
Sbjct: 122 LDQAGSQVTGNLIRYNIIQQKLIAESTGSGDDRVITIIQPE 162


>gi|119946513|ref|YP_944193.1| OstA family protein [Psychromonas ingrahamii 37]
 gi|119865117|gb|ABM04594.1| OstA family protein [Psychromonas ingrahamii 37]
          Length = 173

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 60/173 (34%), Gaps = 16/173 (9%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
            I+    +++ + +   +             +    + IH+ +    V     +  F+ +
Sbjct: 2   KINKLSLIISTLLISFASI----------ALESDFTQPIHVSSVSQHVTMKNDRVVFQDD 51

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQK 125
           V +TQ    L ADK+T+     +                  + G+     A+    D  K
Sbjct: 52  VLLTQGTIKLTADKLTVIQGKQSNQEIMIAEGSVATFYQTQEDGKPIDAEANVIRYDVAK 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD-QVQSIIRY 177
             + L G+      +K+  +   G K+I  ++T   ++     + +V ++   
Sbjct: 112 AQVTLTGNAQ----VKQLKSQINGSKIIYFMETEELTVSNDGKETRVTTVFLP 160


>gi|317401283|gb|EFV81923.1| exported protein [Achromobacter xylosoxidans C54]
          Length = 213

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 59/195 (30%), Gaps = 15/195 (7%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH-----IKADMLEVK 55
           M+ F   I     LL  V ++  A     AA                    I +D L   
Sbjct: 1   MTDFRIRIAPTTRLLGAVLLMASAVAPALAADPKPAAGASKTAPAEEPTTTILSDTLHYD 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGE 111
           D  +++ F GNV MT+   +L +D + +  +                + + +        
Sbjct: 61  DVKKQSVFTGNVNMTRGLMTLTSDNLEMREDAAGNQYGTATANKGKVVTIRQERPENFEL 120

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCE--- 167
           I         D  K    L G       +  K  +T  G ++  N  +     QG     
Sbjct: 121 IEGKGLRAEYDGTKSTFDLIGQAVVVRYVCGKPFDTIRGDRVRYNEKSGTYEAQGGPNSS 180

Query: 168 --SDQVQSIIRYDGR 180
               +V+S+     +
Sbjct: 181 AAGGRVRSVAEPRAK 195


>gi|330828003|ref|YP_004390955.1| protein YhbN [Aeromonas veronii B565]
 gi|328803139|gb|AEB48338.1| Protein YhbN [Aeromonas veronii B565]
          Length = 180

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 57/148 (38%), Gaps = 6/148 (4%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRD 91
            +T  +    EK+++ A     +    +  F+ +V + Q    ++ADK+ +  +     +
Sbjct: 21  AVTAKESDFAEKVYVDAVKQVAEMQDNRITFEEDVTINQGTIRIKADKVVVTRSGEKGAE 80

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
           V     +      I      +N   +    + + R++ + G+      LK++ +   G  
Sbjct: 81  VMTAYGKPATFFQILDNGKPVNAHGNTIRYELKNRLVTITGNGQ----LKQEDSQVNGDL 136

Query: 152 LIVNIDTSFASLQG-CESDQVQSIIRYD 178
           +  +I       +    S +V+++   D
Sbjct: 137 IRYDIVKQKMIAESKSPSQRVKTVFLPD 164


>gi|153869737|ref|ZP_01999271.1| OstA-like protein [Beggiatoa sp. PS]
 gi|152073793|gb|EDN70725.1| OstA-like protein [Beggiatoa sp. PS]
          Length = 161

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/154 (12%), Positives = 51/154 (33%), Gaps = 4/154 (2%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           +++         + I I AD  ++ +    A ++GNV ++Q    + A+ +TI Y+  + 
Sbjct: 7   SNHALALSTDREQPIEIAADRAQIDNMKGIAIYEGNVIVSQGSIRIDAETLTIKYSKQHD 66

Query: 91  DVSNKINRMDV-ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL- 148
                        +       +I   A     +  + +L L  +   +   K   N    
Sbjct: 67  IEKAIAIGKPAHFKQRLDSGEDIKAKAKEMEYNALENMLNLRINAELRKGNKGIDNYISL 126

Query: 149 GCKLIVNIDTSFASLQGC--ESDQVQSIIRYDGR 180
              +  +      +      ++ ++    +   +
Sbjct: 127 APFISYDTQRGIITADKGKEKNGRITMTFKPKPK 160


>gi|152990527|ref|YP_001356249.1| hypothetical protein NIS_0780 [Nitratiruptor sp. SB155-2]
 gi|151422388|dbj|BAF69892.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 152

 Score = 81.1 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 62/173 (35%), Gaps = 21/173 (12%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +   I LL++ F+L                     ++I I +   E  +    + F GNV
Sbjct: 1   MKKIIFLLSISFILFA-------------------QEIEITSQKFEASEKELISKFFGNV 41

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
           F+ +    L ADK+ + +N   + +               ++ E     +       K++
Sbjct: 42  FVKRGTNRLWADKLFVYFNKQKKPIKFIATGNVRFDLFDQKNKEYKGKCNKLVYFPNKKV 101

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
             L  D    ++         G K+ +++  S  ++ G +   V+ I+  + +
Sbjct: 102 YQLFED--VHIVTYPDKKEVYGDKIYLDLIASKVNVAGTKKRPVKMILNIEEK 152


>gi|163794943|ref|ZP_02188912.1| hypothetical secreted protein [alpha proteobacterium BAL199]
 gi|159179762|gb|EDP64289.1| hypothetical secreted protein [alpha proteobacterium BAL199]
          Length = 273

 Score = 80.7 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 55/138 (39%), Gaps = 8/138 (5%)

Query: 47  IKA-DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           I A D LE +   + A  +G+    +E+  ++AD +   +       ++ +  ++   N+
Sbjct: 140 ITARDSLEYRQGQRVAIARGDATAIRENQRIRADTLVARF-EERTKGASTLAVVEANGNV 198

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL-- 163
            I + +       G  +  K    L GD    V +    N   G + +VN+ T  + L  
Sbjct: 199 VITTPQEVARGREGVYNADKETATLTGD----VRITRGKNQLNGERAVVNLKTGISRLLP 254

Query: 164 QGCESDQVQSIIRYDGRP 181
            G   ++V+ +      P
Sbjct: 255 AGKGGERVKGLFTPGKAP 272



 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 61/176 (34%), Gaps = 11/176 (6%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFF 63
           +   H    L+A V ++        A + + +        + ++AD  +E          
Sbjct: 1   MLPRHPLAILIACVALVGFTAAVAPARAQLLQGSGDDQVPVTVEADQGIEWIRDSSTYVA 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           +GN   T+ D  + AD +T  Y       + +I R++ + ++ I +            D 
Sbjct: 61  RGNAKATRGDTRVNADTLTARYREKPD-GTTEIFRLEADGHVVITTPRERATGDRAVYDL 119

Query: 124 QKRILVLNGDRADKVILKEKLNTFLG-CKLIVNIDTSFASLQGC-----ESDQVQS 173
            K  +VL G     +  +   +       L        A  +G      E+ ++++
Sbjct: 120 DKANVVLTG---RDLRFQNAGDVITARDSLEYRQGQRVAIARGDATAIRENQRIRA 172


>gi|208435447|ref|YP_002267113.1| hypothetical protein HPG27_1505 [Helicobacter pylori G27]
 gi|208433376|gb|ACI28247.1| hypothetical protein HPG27_1505 [Helicobacter pylori G27]
          Length = 185

 Score = 80.7 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMSAQKTENKGLKKEREL-LEITGNKFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGGEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|15612541|ref|NP_224194.1| hypothetical protein jhp1476 [Helicobacter pylori J99]
 gi|4156096|gb|AAD07048.1| putative [Helicobacter pylori J99]
          Length = 185

 Score = 80.7 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 52/160 (32%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV  L    +  A        K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCLSVLSVMDAKKLENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+        +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSTDKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|108563942|ref|YP_628258.1| hypothetical protein HPAG1_1517 [Helicobacter pylori HPAG1]
 gi|107837715|gb|ABF85584.1| hypothetical protein HPAG1_1517 [Helicobacter pylori HPAG1]
          Length = 185

 Score = 80.7 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 52/160 (32%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A        K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMDAKKLENKGLKKEREL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|332286596|ref|YP_004418507.1| hypothetical protein PT7_3343 [Pusillimonas sp. T7-7]
 gi|330430549|gb|AEC21883.1| hypothetical protein PT7_3343 [Pusillimonas sp. T7-7]
          Length = 212

 Score = 80.4 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 63/196 (32%), Gaps = 19/196 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQA----AASYMTRFKVLGNEK-----IHIKADM 51
           M+   +S      L A +  +    L+Q       S          +        I +D 
Sbjct: 1   MTTQRSSSCAAWLLTAAMACMTLPTLAQTSQPSTQSNAAAPAGSSEQPAAEPDTLILSDT 60

Query: 52  LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVERNIFI 107
           L+  D  +++ F GNV MT+   +L ADK+ +  +                + + +    
Sbjct: 61  LDYDDIKKESIFTGNVIMTRGLMTLHADKLIMREDAEGFQHGTATVEQGKLVHIRQENPE 120

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGC 166
           +   I      G  + +   L + G       +  K  +   G ++I    T      G 
Sbjct: 121 EFEVIEAQGLRGEYNGKTEDLEMIGKAVITRYICGKPFDNIRGERVIYKQKTDTYQAFGG 180

Query: 167 E-----SDQVQSIIRY 177
                   +V+S+ + 
Sbjct: 181 PNSAAAGGRVRSLAKP 196


>gi|197364177|ref|YP_002143814.1| hypothetical protein SSPA2973 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197095654|emb|CAR61222.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 138

 Score = 80.4 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 44/125 (35%), Gaps = 6/125 (4%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEIN 113
                  F GNV MTQ    + ADK+ +        ++V +          +      + 
Sbjct: 1   MQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKPVK 60

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
             AS+ + +  K  +VL G+      L++  +   G K+   +          +  +V +
Sbjct: 61  GHASHMHYELAKDFVVLTGNAY----LEQLDSNITGDKITYLVKEQKMQAFSEKGKRVTT 116

Query: 174 IIRYD 178
           ++   
Sbjct: 117 VLVPS 121


>gi|319779021|ref|YP_004129934.1| Protein yhbN precursor [Taylorella equigenitalis MCE9]
 gi|317109045|gb|ADU91791.1| Protein yhbN precursor [Taylorella equigenitalis MCE9]
          Length = 209

 Score = 80.4 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 61/180 (33%), Gaps = 6/180 (3%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEK-IHIKADMLEVKDAVQKAFFKG 65
            +     + A +     A          ++      E    I +D L+  +  +   F G
Sbjct: 2   KLRFNKFVFATLLFAGIAKGQSLGDLMKSQQNKNEEEPKTTILSDSLQYNNNTKATVFSG 61

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNGYV 121
           NV + +    L AD++ +            I     ++++          +   +     
Sbjct: 62  NVILQRGSMKLLADELRVSEKPDGTQTGTAIVNGDKKVELYNERLDLYELLKGTSKTAIY 121

Query: 122 DFQKRILVLNGDRADKVILKEK-LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           D +   + L GD      +    +++  G ++I +   S       ++D+V+S+++   +
Sbjct: 122 DGKTERVFLRGDAVITRSICGTVVDSIRGEEIIFDNAKSTYRANRSKTDRVRSVLQPRSK 181


>gi|126641285|ref|YP_001084269.1| putative transport protein [Acinetobacter baumannii ATCC 17978]
          Length = 139

 Score = 80.4 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 45/132 (34%), Gaps = 6/132 (4%)

Query: 49  ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ 108
           AD     +      + GNV + Q    LQAD +    N+     +        +    I 
Sbjct: 2   ADRATYNEKTGLTTYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGRPSKFQQQIS 61

Query: 109 SGEINV--IASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           + +            +    I+ L+G       L +  ++  G  L  +++      QG 
Sbjct: 62  ADKGIARGEGQTIVYNADTGIITLSGGAY----LYQDGSSIRGNTLKYSMNKGDVEAQGS 117

Query: 167 ESDQVQSIIRYD 178
            S++VQ II   
Sbjct: 118 SSNRVQIIIPPS 129


>gi|85709985|ref|ZP_01041050.1| hypothetical protein NAP1_13908 [Erythrobacter sp. NAP1]
 gi|85688695|gb|EAQ28699.1| hypothetical protein NAP1_13908 [Erythrobacter sp. NAP1]
          Length = 183

 Score = 80.4 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 68/181 (37%), Gaps = 9/181 (4%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQA-AASYMTRFKVLGNEKIHIKADMLEVKDAVQ 59
           M+A   ++       A+  + L    +     S            +   A  +   D   
Sbjct: 1   MTAMTKNLGKVALSWAVGGLALGLVAAGGMTLSAQGIASHNTRAPVSFDAGNIAFDDRAN 60

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
           +    G V + Q    +++ +M   Y +     S  + R+    N+ +  G         
Sbjct: 61  RVVLTGGVTVDQAGLRVRSQRMLASYTDD---GSLDVQRITANGNVVVTRGNERASGDVA 117

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             DF +RI+ + G+    V L+   +T  G +L++N+DT  +++ G  S   Q+    DG
Sbjct: 118 VYDFNRRIITMAGN----VSLRRGTDTLNGGRLVINLDTGLSTMDGRASG-AQTTTNSDG 172

Query: 180 R 180
           R
Sbjct: 173 R 173


>gi|145297404|ref|YP_001140245.1| hypothetical protein ASA_0313 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850176|gb|ABO88497.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 175

 Score = 80.4 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 59/147 (40%), Gaps = 6/147 (4%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDV 92
           ++  +    EK+++ A     +    +  F  +V +TQ    ++ADK+ +  + +   +V
Sbjct: 17  VSAKESDFAEKVYVDAVRQVAEMQDNRITFSDDVIITQGTIKIKADKVVVIRSGDKGAEV 76

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
                +      I      +N   ++   + + R++ + G+      LK++ +   G  +
Sbjct: 77  MTAYGKPATFFQILDNGKPVNAHGNSIRYELKNRLVTITGNGQ----LKQEDSQVNGDLI 132

Query: 153 IVNIDTSFASLQG-CESDQVQSIIRYD 178
             +I       +    + +V+++   D
Sbjct: 133 RYDIVKQKMIAESKGPTQRVKTVFLPD 159


>gi|254420969|ref|ZP_05034693.1| OstA-like protein [Brevundimonas sp. BAL3]
 gi|196187146|gb|EDX82122.1| OstA-like protein [Brevundimonas sp. BAL3]
          Length = 172

 Score = 80.4 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 61/156 (39%), Gaps = 16/156 (10%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
            A       +   N+ I   AD  E   + ++   +G   +TQ    L+A+ +T+  N  
Sbjct: 26  PAVGDAQSARTSSNQPIAFGADTGE--QSAERISLRGRAEVTQGQNRLRAEAITLFRNA- 82

Query: 89  NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL 148
               +    R++    ++  +   ++             LV+ G+    VIL +  N   
Sbjct: 83  ----AGDPERVEATGTVYFVTPTQSMRGDRAVYTLSNGELVVTGN----VILNQGKNVLT 134

Query: 149 GCKLIVNIDTSFASLQGCE-----SDQVQSIIRYDG 179
           G +L+ N++T  A++ G         ++Q +   +G
Sbjct: 135 GGRLVYNVNTDAANMSGAPRGGTAGSRIQGVFYPNG 170


>gi|119477366|ref|ZP_01617557.1| possible OstA-like protein [marine gamma proteobacterium HTCC2143]
 gi|119449292|gb|EAW30531.1| possible OstA-like protein [marine gamma proteobacterium HTCC2143]
          Length = 182

 Score = 80.4 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 57/159 (35%), Gaps = 9/159 (5%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKD--AVQKAFFKGNVFMTQEDFSLQADKMTI 83
            S   +S++        + I+I++D   +K     +   + GNV MTQ    +  + +TI
Sbjct: 12  FSLLVSSHVAALPDDNEKPINIQSDSASLKTLANGKTTEYFGNVQMTQGSLKITGEHITI 71

Query: 84  DYNNTNRDVSNKINRMDVE-RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
             NN             +  +    +S  I   A       +  ++VL  +      +K+
Sbjct: 72  YSNNREITSITATGTPAIFEQQPDSESSPIEAQAETLDYQLKDEVVVLLINAC----VKQ 127

Query: 143 KLNTFLGCKLIVNIDTSFASLQGC--ESDQVQSIIRYDG 179
             +   G ++   I +           S +V  I+  +G
Sbjct: 128 NGSVVTGGRIEYGIASEKIKASRGDTNSSRVNMILPPEG 166


>gi|323524685|ref|YP_004226838.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. CCGE1001]
 gi|323381687|gb|ADX53778.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. CCGE1001]
          Length = 223

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 57/156 (36%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             +   ++ ++I+AD +   D  Q   F G+V  T+    ++AD++ +  +         
Sbjct: 41  ADRADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTIVIKADRVEVTQDPQGYQYATG 100

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            S+  N     +        I   A     D ++ +  L  +   K +  L   ++   G
Sbjct: 101 TSSGGNLSYFRQKREGLDEYIEGTAVRIDYDGKQDLTTLTTNATVKRLQGLSTVMDQVHG 160

Query: 150 CKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
             +  +    F + +        G  S +V++++  
Sbjct: 161 SVITYDGQKDFYTAKAGKDVAGPGNPSGRVRAMLSP 196


>gi|146329290|ref|YP_001209444.1| OstA-like family protein [Dichelobacter nodosus VCS1703A]
 gi|146232760|gb|ABQ13738.1| OstA-like family protein [Dichelobacter nodosus VCS1703A]
          Length = 151

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 49/172 (28%), Gaps = 21/172 (12%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
              I L+ +++++                +    ++I + AD  E       A + G+V 
Sbjct: 1   MRLIFLVLMLWIMPIYA------------QNKIQDEISLSADQGEYDAEKGIATYTGHVA 48

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           + Q +  L  DK+ + ++           R             I               +
Sbjct: 49  IAQANMKLTGDKVVVHFDKGAVTKIEAWGRRVTFHYQPNNEPAITGQGDFMVYVIHTATV 108

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            + GD +    + +  N     +L   +             ++Q  +    +
Sbjct: 109 EIEGDAS----VMQGDNETKAERLTYQLKQQRLR-----GKRIQMTLNPKTK 151



 Score = 37.2 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 28/84 (33%), Gaps = 4/84 (4%)

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
            +           EI++ A  G  D +K I    G     V + +      G K++V+ D
Sbjct: 11  WIMPIYAQNKIQDEISLSADQGEYDAEKGIATYTG----HVAIAQANMKLTGDKVVVHFD 66

Query: 158 TSFASLQGCESDQVQSIIRYDGRP 181
               +       +V    + +  P
Sbjct: 67  KGAVTKIEAWGRRVTFHYQPNNEP 90


>gi|333000024|gb|EGK19607.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-218]
 gi|333014562|gb|EGK33909.1| lipopolysaccharide transport periplasmic protein LptA [Shigella
           flexneri K-304]
          Length = 139

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 44/125 (35%), Gaps = 6/125 (4%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEIN 113
                  F GNV +TQ    + ADK+ +        ++V +   +      +      + 
Sbjct: 1   MQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVE 60

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
             AS  + +  K  +VL G+      L++  +   G K+   +          +  +V +
Sbjct: 61  GHASQMHYELAKDFVVLTGNAY----LQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTT 116

Query: 174 IIRYD 178
           ++   
Sbjct: 117 VLVPS 121



 Score = 36.4 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 25/80 (31%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               + +   A  +  + A       GN ++ Q D +++ DK+T           +   +
Sbjct: 53  QDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGK 112

Query: 99  MDVERNIFIQSGEINVIASN 118
                 +  Q  + N     
Sbjct: 113 RVTTVLVPSQLQDKNNKGQT 132


>gi|91790319|ref|YP_551271.1| OstA-like protein [Polaromonas sp. JS666]
 gi|91699544|gb|ABE46373.1| OstA-like protein [Polaromonas sp. JS666]
          Length = 205

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/184 (11%), Positives = 63/184 (34%), Gaps = 19/184 (10%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
           H +  L+ L      A L+  A   +   +   ++ ++ +AD L   D  Q + F GNV 
Sbjct: 3   HPFFSLIVL------AALAVGAVFPVAAERADRDKPMNAEADALRYDDLKQTSVFTGNVV 56

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRM----DVERNIFIQSGEINVIASNGYVDFQ 124
           +T+    ++ +++ +  +      +  +          +        I         D +
Sbjct: 57  ITKGTTIVRGERVDVSQDPQGYQQALAVAAPGKLAFYRKKRDGVDEYIEGEGERIEYDSR 116

Query: 125 KRILVLNGDRADKVIL-KEKLNTFLGCKLIVNIDTSFASLQGC--------ESDQVQSII 175
              +        +       ++   G  ++ + +T   ++ G          + ++++++
Sbjct: 117 ADTVKFIKQAVVRRYNGATLVDETTGSLIVYDNNTDVFTVDGGAQNRTAVNPTGRIRAML 176

Query: 176 RYDG 179
              G
Sbjct: 177 SPRG 180


>gi|194364734|ref|YP_002027344.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas maltophilia R551-3]
 gi|194347538|gb|ACF50661.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas maltophilia R551-3]
          Length = 183

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 51/162 (31%), Gaps = 6/162 (3%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLE-VKDAVQKAFFKGNVFMTQEDFSLQA 78
                 L     S         NE +HI +     +     K      V +TQ    L++
Sbjct: 5   FAAVLALGLLVPSAAFAKSTDRNEDMHIDSGAQSGMLTGDGKTVLSQGVVITQGTLDLRS 64

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
            +  I   +          +    +        ++ +A     D +  I+ L G+     
Sbjct: 65  SEAEIYLKDGEAVRVVFTGKQAKMKQQLDDGTWMDALADRIDYDIKTEIITLTGNYK--- 121

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +     T  G +++ N  +   +  G +  +V+++I    +
Sbjct: 122 -VTSARGTNAGQRMVYNTRSGEMN-SGGDGSRVRTVIPPKNK 161


>gi|304411209|ref|ZP_07392824.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS183]
 gi|307306504|ref|ZP_07586247.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica BA175]
 gi|304350402|gb|EFM14805.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica OS183]
 gi|306910795|gb|EFN41223.1| lipopolysaccharide transport periplasmic protein LptA [Shewanella
           baltica BA175]
          Length = 184

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/161 (18%), Positives = 51/161 (31%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A L    +           +++ IKA          +  F G V +TQ    + AD+
Sbjct: 6   VLLASLMLIMSMSAFAKVDDLKQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIHADQ 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +                      +  +  G   +  A     D   R L L G  +    
Sbjct: 66  LRAFSAEGENSKILVATGNPATYSQVLDDGRPASASAKEIRYDMASRTLTLKGLAS---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQ--GCESDQVQSIIRYD 178
           L +  +   G  +  NI       +  G   D+V +II+ +
Sbjct: 122 LDQAGSQVTGNLIRYNIIQQKLIAESTGSGDDRVITIIQPE 162


>gi|149910595|ref|ZP_01899233.1| hypothetical protein PE36_14611 [Moritella sp. PE36]
 gi|149806323|gb|EDM66298.1| hypothetical protein PE36_14611 [Moritella sp. PE36]
          Length = 166

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 60/175 (34%), Gaps = 16/175 (9%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +     +L L  ++  + L+          +    E + + A   EV     +  F  NV
Sbjct: 1   MMKKYKILLLTLLMSNSALA---------LESDFAENVVVNAKRQEVFIKENRVIFYDNV 51

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKR 126
            +TQ    + ADK+T+                       +  G+     ++    +  K+
Sbjct: 52  VVTQGTILIHADKLTVLSPGGKGTEVMIATGNVATFYQELDDGKKINAESNEIRYELGKK 111

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC--ESDQVQSIIRYDG 179
            L L  +      L++  +   G K+I  ID      +    ESD+V +I   + 
Sbjct: 112 RLTLTKNAR----LRQADSEVKGNKIIYQIDKQEMIAESGNNESDRVITIFTPED 162


>gi|118474366|ref|YP_892344.1| OstA family protein [Campylobacter fetus subsp. fetus 82-40]
 gi|118413592|gb|ABK82012.1| OstA family protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 155

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/141 (13%), Positives = 53/141 (37%), Gaps = 4/141 (2%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF-SLQADKMTIDYNNTNRDVSNKINRM 99
             E++ + AD     +    +  KGNV + +  + +L ++ + I ++   + +       
Sbjct: 18  NAEQVEVTADNFFADEKSLTSDLKGNVVIKKGSYDTLTSNSVKIYFDIKRQPIKYVATG- 76

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
           + +    +     N   +    +  K+   L+GD       ++      G +++VN    
Sbjct: 77  NAKFKAILNKKNYNGSGNILIYEPLKKTYTLSGDAYLHE--EQTDKKVYGDEIVVNQGDG 134

Query: 160 FASLQGCESDQVQSIIRYDGR 180
              +   +   V+ I + + +
Sbjct: 135 TYKVSSKDKKPVKLIFQVEDK 155


>gi|319764737|ref|YP_004128674.1| lipopolysaccharide transport periplasmic protein lpta
           [Alicycliphilus denitrificans BC]
 gi|330826953|ref|YP_004390256.1| lipopolysaccharide transport periplasmic protein LptA
           [Alicycliphilus denitrificans K601]
 gi|317119298|gb|ADV01787.1| lipopolysaccharide transport periplasmic protein LptA
           [Alicycliphilus denitrificans BC]
 gi|329312325|gb|AEB86740.1| lipopolysaccharide transport periplasmic protein LptA
           [Alicycliphilus denitrificans K601]
          Length = 214

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/165 (12%), Positives = 52/165 (31%), Gaps = 20/165 (12%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD- 91
                K   N+ ++I+AD L   +  Q + F G+V MT+    L+ +++ +  +      
Sbjct: 21  GAHAEKADRNKPMNIEADALRHDELKQTSVFTGHVVMTKGTIVLRGEQLDVRQDPDGFQH 80

Query: 92  -------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK-EK 143
                        R   +         +         D +   +        +   + + 
Sbjct: 81  GVVTAEPGKRAFFRQKRDTPPGQPDEFVEGEGEVIEYDGRADTVKFTRRAELRRYREAQL 140

Query: 144 LNTFLGCKLIVNIDTSFASLQGCE-----------SDQVQSIIRY 177
            +   G  ++ N  T   ++ G +             +V++++  
Sbjct: 141 TDEVKGAVIVYNNLTDVFTVDGQKTAPAGTSAGTPGGRVRAVLSP 185


>gi|317011805|gb|ADU85552.1| hypothetical protein HPSA_08055 [Helicobacter pylori SouthAfrica7]
          Length = 185

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 53/160 (33%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            LV       +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLVCCFGILSVMGAQKTDNKGLKKEKEL-LEITGNQFIANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L ADK+++  N+  +    +             + EI+  A     +       L  +  
Sbjct: 65  LFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKAKGYADVLGSAKRPAKFVF 162


>gi|242309666|ref|ZP_04808821.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239523667|gb|EEQ63533.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 155

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/167 (14%), Positives = 57/167 (34%), Gaps = 17/167 (10%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
           +L  ++F +L    +               ++I + A  L   +  +    KGNV + + 
Sbjct: 3   YLFLILFFVLHPLFA---------------DEIVVNAQELIADEKSKITQLKGNVQVIRG 47

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           D  L+ D+  I  +  NR                  + +I   +         +   + G
Sbjct: 48  DDKLECDEAYIYLDKNNRPEKMHAIGKVHFWLTLKDNRKIQGNSDEVIYLPNTQEYQIIG 107

Query: 133 DRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           +   +   K   N   G K+I+  +  + ++ G  +   + I + + 
Sbjct: 108 NAFVEEPAKN--NKVKGNKIIIRYEDGYINVLGNNNSPARLIFKLEK 152


>gi|117620989|ref|YP_858364.1| protein YhbN [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562396|gb|ABK39344.1| protein YhbN [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 187

 Score = 80.0 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/147 (14%), Positives = 59/147 (40%), Gaps = 6/147 (4%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN-NTNRDV 92
           ++  +    EK+++ A     +    +  F+ +V +TQ    ++ADK+ +  +     +V
Sbjct: 29  VSAKESDFAEKVYVDAVKQVAEMQDNRITFEQDVTITQGTIKIKADKVVVIRSGEKGAEV 88

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
                +      I      +N   ++   + + R++ + G+      LK++ +   G  +
Sbjct: 89  MTAYGKPATFFQILDNGKPVNAHGNSIRYELKNRLVTITGNGQ----LKQEDSQVNGDLI 144

Query: 153 IVNIDTSFASLQGC-ESDQVQSIIRYD 178
             +I       +    + +V+++   D
Sbjct: 145 RYDIVKQKMIAESKTPNQRVKTVFLPD 171


>gi|254362691|ref|ZP_04978778.1| hypothetical protein MHA_2287 [Mannheimia haemolytica PHL213]
 gi|153094310|gb|EDN75174.1| hypothetical protein MHA_2287 [Mannheimia haemolytica PHL213]
          Length = 134

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/130 (12%), Positives = 42/130 (32%), Gaps = 4/130 (3%)

Query: 49  ADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ 108
           +    +        F  NV +TQ    + A  + I      ++  +        +     
Sbjct: 1   SGSQSLDMTNNIVTFSDNVVITQGSIKVTAANVKITRQEGKKETIDATGSPVTFQQTLDN 60

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
              +N   ++ + D     L L G+      LK++ +     K+  ++            
Sbjct: 61  GKPVNGKGNSVHYDLNSEFLTLIGNAE----LKQQGSFIKANKITYDVKKQQLKATSGGK 116

Query: 169 DQVQSIIRYD 178
            +V++++  +
Sbjct: 117 TRVKTVLIPN 126


>gi|315636941|ref|ZP_07892165.1| OstA family protein [Arcobacter butzleri JV22]
 gi|315478771|gb|EFU69480.1| OstA family protein [Arcobacter butzleri JV22]
          Length = 164

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 48/148 (32%), Gaps = 6/148 (4%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
           +      +E + I A   +  D    + F GNV +   +  L A ++ + +    +  + 
Sbjct: 12  SALLFAQSETLIIDAQDFQADDKKGISIFTGNVKIKMGEDKLNAQRVDVFFETDKKTNNK 71

Query: 95  KINRMDVERNIFI----QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGC 150
              R +           +               QK    + G+       +       G 
Sbjct: 72  TPLRYEATGKADFEIVTKDKHYIGNGDKIIYSPQKEEYTIIGNGFIHE--QNDDRKIYGD 129

Query: 151 KLIVNIDTSFASLQGCESDQVQSIIRYD 178
            + VN  +  A ++G E+  V+ II  D
Sbjct: 130 TIYVNQLSGEAKVKGSENKPVKFIINVD 157


>gi|120600248|ref|YP_964822.1| OstA family protein [Shewanella sp. W3-18-1]
 gi|120560341|gb|ABM26268.1| OstA family protein [Shewanella sp. W3-18-1]
          Length = 184

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 50/161 (31%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A L    +           +++ IKA          +  F G V +TQ    + A +
Sbjct: 6   ILLASLMLIMSMSTYAKVADLQQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKINAQE 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +     +                   +  G   +  A     +   R L L G  +    
Sbjct: 66  LRAFSADGETSKILVATGNPATYTQILDDGRPASASAKEIRYEMATRTLTLTGSAS---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
           L +  +   G  +  NI      A   G   D+V +II+ +
Sbjct: 122 LDQAGSQVTGNLIRYNIIQQKLIAESTGNGDDRVITIIQPE 162


>gi|296282121|ref|ZP_06860119.1| OstA-like protein [Citromicrobium bathyomarinum JL354]
          Length = 179

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 62/155 (40%), Gaps = 7/155 (4%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            L      + F L    L+              N  +   A+ +E++D   +    GNV 
Sbjct: 11  RLAARSGVVGFALAACTLTGIQLHAQAIAAHNSNAPVDYAANRIELQDRQNRVVLSGNVV 70

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           + Q D  + +    +DY++     S  I R+     + +  G  +   +    DF +R++
Sbjct: 71  IEQADLRMTSASTIVDYSD---AGSLSIQRISATGGVTVTRGNESARGNVAVYDFNRRVI 127

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
            + G+    V LK   +T  G +L +++ T  +S+
Sbjct: 128 TMTGN----VRLKRGSDTLNGGRLTIDLRTGLSSV 158


>gi|157737226|ref|YP_001489909.1| OstA family protein [Arcobacter butzleri RM4018]
 gi|157699080|gb|ABV67240.1| OstA family protein [Arcobacter butzleri RM4018]
          Length = 164

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 47/142 (33%), Gaps = 6/142 (4%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
            +E + I A   +  D    + F GNV +   +  L A ++ + +    +  +    R +
Sbjct: 18  QSETLIIDAQDFQADDKKGISIFTGNVKIKMGEDKLNAQRVDVFFETDKKTNNKTPLRYE 77

Query: 101 VERNIFI----QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
                      +               QK    + G+       +       G  + VN 
Sbjct: 78  ATGKADFEIVTKDKHYVGNGDKIIYSPQKEEYTIIGNGFIHE--QNDDRKIYGDTIYVNQ 135

Query: 157 DTSFASLQGCESDQVQSIIRYD 178
            +  A ++G E+  V+ II  D
Sbjct: 136 LSGEAKVKGSENKPVKFIINVD 157


>gi|134296985|ref|YP_001120720.1| OstA family protein [Burkholderia vietnamiensis G4]
 gi|134140142|gb|ABO55885.1| OstA family protein [Burkholderia vietnamiensis G4]
          Length = 221

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 63/180 (35%), Gaps = 19/180 (10%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
            +  L    L+  A +     K   N+ I+++AD L   D  Q     GNV +T+    +
Sbjct: 24  TLVALPLVGLAPLAHAE----KADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIKI 79

Query: 77  QADKMTIDYNNT--NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
             D++ +  +        S    +         +  +  +      +D+  +  +     
Sbjct: 80  TGDRVEVRQDPEGYQYATSFGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTT 139

Query: 135 ADKVILKEKLNTF----LGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
           A  V   +  +T      G  +  +    F + +G +        + +V++++   +G P
Sbjct: 140 AATVRRLQGTSTIADTVHGSVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGP 199


>gi|170691491|ref|ZP_02882656.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           graminis C4D1M]
 gi|170143696|gb|EDT11859.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           graminis C4D1M]
          Length = 223

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 57/156 (36%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             +   ++ ++I+AD +   D  Q   F G+V  T+    ++AD++ +  +         
Sbjct: 41  ADRADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTIVIKADRVEVTQDPQGYQYATG 100

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            S+  N     +        I   A     D ++ +  L  +   K +  L   ++   G
Sbjct: 101 TSSGGNLSYFRQKREGLDEYIEGTAIRIDYDGKQDLTTLTTNATVKRLQGLSTVIDQVHG 160

Query: 150 CKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
             +  +    F + +        G  S +V++++  
Sbjct: 161 SVITYDGQKDFYTAKAGKDVAGPGNPSGRVRAMLSP 196


>gi|114798835|ref|YP_758937.1| OstA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114739009|gb|ABI77134.1| OstA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 178

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 68/177 (38%), Gaps = 25/177 (14%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L L  ++     +Q ++             I+I ++  E  +  +K    GNV + Q   
Sbjct: 11  LVLGLLMGAPAFAQISSDGG---------PIYINSERTESLERERKVLLVGNVDIRQGTA 61

Query: 75  SLQADKMTIDYNNTNRDVS-----------NKINRMDVERNIFIQSGEINVIASNGYVDF 123
            L+AD +TI +     + +            ++  +  E N++  + E+      G  + 
Sbjct: 62  RLRADTVTIQFAPQQGETAAQPAQGVAGSFGQVESILAEGNVYYVTPELKAKGDRGNYEL 121

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
               +V+ G+    V L    +   G +L++ +      L+G    + + +I  +G+
Sbjct: 122 ATDTIVMTGN----VALMRDRDVAEGQRLVMEVTNRRTRLEGG-GGRTRMVIDPEGK 173


>gi|114778207|ref|ZP_01453079.1| possible OstA-like protein [Mariprofundus ferrooxydans PV-1]
 gi|114551454|gb|EAU54009.1| possible OstA-like protein [Mariprofundus ferrooxydans PV-1]
          Length = 166

 Score = 79.6 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 64/175 (36%), Gaps = 23/175 (13%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + S       L  +        + A               I I+A  + +     K  F 
Sbjct: 1   MKSNSKLTRYLPALLACFLPLSAWAGT-------------IQIEAKKMTLLQKESKVEFT 47

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           G V +T++   +  D +   Y++      +++   D + ++ I   +++  ++   +D  
Sbjct: 48  GKVHLTRDTMQMDCDHLVAYYSD------HQLTHADADGHVVIVQDKVHGHSNKARLDQI 101

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           K IL L G      +L+++ N   G  ++ N+++    +      ++   I  + 
Sbjct: 102 KGILTLTGQA----VLEQQGNRVEGETIVHNLNSQKTVVTPDTGGRIHMTIESED 152


>gi|293602381|ref|ZP_06684827.1| hypothetical protein HMPREF0004_0403 [Achromobacter piechaudii ATCC
           43553]
 gi|292819143|gb|EFF78178.1| hypothetical protein HMPREF0004_0403 [Achromobacter piechaudii ATCC
           43553]
          Length = 206

 Score = 79.2 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 56/175 (32%), Gaps = 10/175 (5%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L  VLL A +   A +     K        I +D L   D  +++ F GNV MT+   +
Sbjct: 14  LLGAVLLTASVFAPAHAAEPAAKPAEEPSTLILSDTLHYDDVKKQSVFTGNVNMTRGLMT 73

Query: 76  LQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
           L +D + +  +                + + +        I         D  K    L 
Sbjct: 74  LTSDTLEMHEDAQGGQYGTATANKGKVVTIRQERPETFELIEGKGLRAEYDGTKSTFDLI 133

Query: 132 GDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGC-----ESDQVQSIIRYDGR 180
           G       +  K  +T  G ++  N  T     QG         +V+S+     +
Sbjct: 134 GQAVVVRYVCGKPFDTIRGERVRYNEKTGTYEAQGGPNSAAPGGRVRSVAEPRAK 188


>gi|109948149|ref|YP_665377.1| hypothetical protein Hac_1675 [Helicobacter acinonychis str.
           Sheeba]
 gi|109715370|emb|CAK00378.1| conserved hypothetical protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 185

 Score = 79.2 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 52/160 (32%), Gaps = 3/160 (1%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L+  L    +  A  +     K      + I  +     D  + A  +GNV + +    
Sbjct: 6   FLMCCLGILSMMSAQKTDNKSLKKEKEL-LEITGNQFVANDKTKTAVIQGNVQIKKGKDR 64

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L A+K+ +  N+  +    +               EI+  A     +       L  +  
Sbjct: 65  LFANKVIVFLNDKRKPERYEAIGNTRFNIFTEDHREISGSADKLIYNALNGEYKLLQNAV 124

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            + + K   N   G ++I+N    +A + G      + + 
Sbjct: 125 VREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|190573140|ref|YP_001970985.1| putative OstA family protein [Stenotrophomonas maltophilia K279a]
 gi|190011062|emb|CAQ44671.1| putative OstA family protein [Stenotrophomonas maltophilia K279a]
          Length = 183

 Score = 79.2 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/159 (15%), Positives = 50/159 (31%), Gaps = 6/159 (3%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLE-VKDAVQKAFFKGNVFMTQEDFSLQA 78
                 L     S         NE +HI +     +     K      V +TQ    L++
Sbjct: 5   FAAVLALGLLVPSAAFAKSTDRNEDMHIDSGAQSGMLTGDGKTVLSQGVIITQGTLDLRS 64

Query: 79  DKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
            +  I   +          +    +        ++ +A     D +  I+ L G+     
Sbjct: 65  SEAEIYLKDGEAVRVVFTGKQAKMKQQLDDGTWMDALADRIDYDIKTEIITLTGNYK--- 121

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +     T  G +++ N  T   +  G +  +V+++I  
Sbjct: 122 -VTSARGTNAGQRMVYNTRTGEMN-SGGDGSRVRTVIPP 158


>gi|33603478|ref|NP_891038.1| hypothetical protein BB4504 [Bordetella bronchiseptica RB50]
 gi|33577602|emb|CAE34867.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 206

 Score = 79.2 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 64/187 (34%), Gaps = 11/187 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH-IKADMLEVKDAVQKAFF 63
           +  + L +  L L  +LL A    A A   +       E    I +D L   D  +++ F
Sbjct: 1   MTHLRLSLAPLRLCSILLLAAAGAAQAQAQSGPAAPAEEPSTLILSDTLHYDDIKRQSIF 60

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVERNIFIQSGEINVIASNG 119
            GNV +T+   +L +DK+ ++ +                + + ++       I       
Sbjct: 61  TGNVILTRGLMTLTSDKLEVNEDAAGNQFGVATADKGKIVTIRQDRPETFELIEGKGLRA 120

Query: 120 YVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGCE-----SDQVQS 173
             +  K    L G       +  K  +T  G ++  N  T     QG         +V+S
Sbjct: 121 EYESSKSQFDLIGQAIVTRYICGKPFDTIRGDRVRYNEKTGIYQAQGGPNSSAAGGRVRS 180

Query: 174 IIRYDGR 180
           +     +
Sbjct: 181 LAEPRAK 187


>gi|296273482|ref|YP_003656113.1| lipopolysaccharide transport periplasmic protein LptA [Arcobacter
           nitrofigilis DSM 7299]
 gi|296097656|gb|ADG93606.1| lipopolysaccharide transport periplasmic protein LptA [Arcobacter
           nitrofigilis DSM 7299]
          Length = 180

 Score = 78.8 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 55/138 (39%), Gaps = 6/138 (4%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           +EK+ I A   E  D    + F G+V M +    L++D++ +  +    +   +  +   
Sbjct: 16  SEKLIIDAKNFEAYDEKGLSIFTGDVKMVKSSDELESDRLEVYLSKKKPNTKREPLKYIA 75

Query: 102 ERNIFIQSGE----INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             N+  +                 + +K   V+ G+   K +   +     G K+++N  
Sbjct: 76  TGNVKFKVKTAGKSYEGKGDKVVYEPKKLKYVITGNGFLKEV--TEDKRLFGDKIVINQI 133

Query: 158 TSFASLQGCESDQVQSII 175
           T  A + G E+  V+ II
Sbjct: 134 TGEAKVTGSENKPVRFII 151


>gi|146291822|ref|YP_001182246.1| OstA family protein [Shewanella putrefaciens CN-32]
 gi|145563512|gb|ABP74447.1| OstA family protein [Shewanella putrefaciens CN-32]
 gi|319425057|gb|ADV53131.1| lipopolysaccharide transport, periplasmic binding component, LptA
           [Shewanella putrefaciens 200]
          Length = 184

 Score = 78.8 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/161 (18%), Positives = 51/161 (31%), Gaps = 7/161 (4%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A L    +           +++ IKA          +  F G V +TQ    +QA +
Sbjct: 6   ILLASLMLIMSMSAYAKVADLQQEVKIKAVSQTADIKNNQIIFFGPVEVTQGSIKIQAAQ 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSG-EINVIASNGYVDFQKRILVLNGDRADKVI 139
           +     +                   +  G   +  A     +   R L L G  +    
Sbjct: 66  LRAFSADGETSKILVATGNPATYTQILDDGRPASASAKEIRYEMATRTLTLTGSAS---- 121

Query: 140 LKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
           L +  +   G  +  NI      A   G   D+V +II+ +
Sbjct: 122 LDQAGSQVTGNLIRYNIIQQKLIAESTGSGDDRVITIIQPE 162


>gi|149925777|ref|ZP_01914041.1| OstA-like protein [Limnobacter sp. MED105]
 gi|149825894|gb|EDM85102.1| OstA-like protein [Limnobacter sp. MED105]
          Length = 193

 Score = 78.8 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 53/154 (34%), Gaps = 10/154 (6%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
               +    +   I A+ +   +      F GNV +T+    ++ DK+T+   +     +
Sbjct: 22  AQALESDKQQPTTIDANQMTYNEKSNVNVFTGNVLLTRGSLVIRGDKLTLTERSDGTQFA 81

Query: 94  NKINRMDVERNIFIQSGEI-----NVIASNGYVDFQKRILVLNGDRA-DKVILKEKLNTF 147
               +    +              N   +    D  K I+ L G  +  K    +   + 
Sbjct: 82  TVEGKPARFKQQRDSETPNEVLLINGTGNTIEFDGNKSIVTLTGAASIQKSTNGQLTESI 141

Query: 148 LGCKLIVNIDTSFASL----QGCESDQVQSIIRY 177
            G ++    +T F ++        S +VQ++I+ 
Sbjct: 142 SGTRITYEQNTEFLNVVGSPSSSGSSRVQAVIKP 175


>gi|308271828|emb|CBX28436.1| hypothetical protein N47_G37600 [uncultured Desulfobacterium sp.]
          Length = 164

 Score = 78.8 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 54/144 (37%), Gaps = 9/144 (6%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN------TNRDVSNKI 96
           EK  I ADML V     KA F G V   Q    + +D++ I Y         N      I
Sbjct: 22  EKTRITADMLIVDGNSDKAEFIGKVKAVQGTTVITSDRLNIFYQKVDTAAKDNPKEKESI 81

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNI 156
             +    N+ I   +   I  +       R+  L G  +    +    N+  G K+    
Sbjct: 82  KEIIATGNVKILFDDKIAITQHAVYATSTRVFTLTGVGSK---ITSGNNSITGSKITFFR 138

Query: 157 DTSFASLQGCESDQVQSIIRYDGR 180
           D     ++   S++V+++   DG+
Sbjct: 139 DDGHVKIESSRSNRVEAVFESDGK 162


>gi|285018902|ref|YP_003376613.1| osta-like protein [Xanthomonas albilineans GPE PC73]
 gi|283474120|emb|CBA16621.1| putative osta-like protein [Xanthomonas albilineans]
          Length = 198

 Score = 78.8 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 48/142 (33%), Gaps = 7/142 (4%)

Query: 38  KVLGNEKIHIKAD--MLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
               N+ + + +D     + D   K  F G+V + Q      AD   I   N   D    
Sbjct: 24  STDRNQLVDVNSDANNCNLTDDNGKCRFSGHVVIVQGTLEAHADTADIFRKNGQIDRVLL 83

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
             +    +        ++ +A          I++L G+      +     T  G +++ N
Sbjct: 84  NGKQATFKQEMDDGSIVDGMADTIDYSVPNDIVILTGNYK----MTSAKGTNAGQRMVYN 139

Query: 156 IDTSFASLQGCESDQVQSIIRY 177
             T      G +  +V ++I+ 
Sbjct: 140 TKTGDMQG-GGDGTRVHTVIQP 160


>gi|295675417|ref|YP_003603941.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. CCGE1002]
 gi|295435260|gb|ADG14430.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. CCGE1002]
          Length = 223

 Score = 78.8 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 58/156 (37%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             +   ++ ++I+AD +   D  Q + F G+V  T+    ++AD++ +  +         
Sbjct: 41  ADRADKDKPLNIEADNMTYDDLRQVSIFTGHVVATKGTILIKADRVEVSQDPQGYQFATG 100

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            S+  N     +        I   A     D ++ +  L  +   + +  +   L+   G
Sbjct: 101 TSSGNNLSYFRQKREGLDEYIEGTAIRIDYDGKQDLTTLTTNATVRRLQSMTTLLDQVHG 160

Query: 150 CKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
             +  +    F + +        G  + +V++++  
Sbjct: 161 SVITYDGQNDFYTAKAGKDVAGPGNPTGRVRAMLAP 196


>gi|329847150|ref|ZP_08262178.1| ostA-like family protein [Asticcacaulis biprosthecum C19]
 gi|328842213|gb|EGF91782.1| ostA-like family protein [Asticcacaulis biprosthecum C19]
          Length = 181

 Score = 78.4 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 66/174 (37%), Gaps = 13/174 (7%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
            LA +F +    L+   +      +  G   + +  D  +  +      + G V + Q +
Sbjct: 6   FLAAMFCVALGSLALTGSVGAQVAQEGG--PVMVGGDSWQADENALTQTWDGRVEVIQAN 63

Query: 74  FSLQADKMTIDYNNTNRDVSNKINR---MDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
             L+AD + I +       +        ++   N++  + E  V  +          +V+
Sbjct: 64  SRLRADHVVISHAPGGEGENKGWGEVVKIEATGNVYYVTPENTVKGNTAVYTKANDTMVI 123

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ----GCESDQVQSIIRYDGR 180
           +GD    V+LK+  N   G +L+  +     ++        + +V++++  D +
Sbjct: 124 SGD----VVLKQGKNVMTGTRLVAEVGAGTTTMDAAPGSTNNGRVRAVLYPDEK 173


>gi|188591124|ref|YP_001795724.1| hypothetical protein RALTA_A0333 [Cupriavidus taiwanensis LMG
           19424]
 gi|170938018|emb|CAP63002.1| conserved hypothetical protein, OstA domain; putative exported
           PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 214

 Score = 78.4 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 19/162 (11%), Positives = 48/162 (29%), Gaps = 18/162 (11%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
                 +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +     
Sbjct: 29  QPALAERADRDKPMVLEADNASYDDVKQIYTLTGNVVLTKGTMILKSDAAELRTDPEGYQ 88

Query: 92  ----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL--- 144
                S    +  + +        I+        D ++    L G+     +  +     
Sbjct: 89  FAVATSKPGRQAYIRQKREGVDEYIDGWGDRIEYDGKQEFSKLIGNARMARL--QGAKLL 146

Query: 145 NTFLGCKLIVNIDTSFAS---------LQGCESDQVQSIIRY 177
           +   G  L  +      +              S +V++++  
Sbjct: 147 DEIRGAVLTYDSRKELYTAAGGGSGDAAAANPSGRVRAVLSP 188


>gi|254515275|ref|ZP_05127336.1| putative lipopolysaccharide transport periplasmic protein LptA
           [gamma proteobacterium NOR5-3]
 gi|219677518|gb|EED33883.1| putative lipopolysaccharide transport periplasmic protein LptA
           [gamma proteobacterium NOR5-3]
          Length = 216

 Score = 78.4 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 47/146 (32%), Gaps = 8/146 (5%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
            T       + I I A      +      + G+V M Q    ++ADK+TI ++    D  
Sbjct: 34  ATALPDDRLQSIEITAARAVRDERAGFTVYSGDVIMQQGSLHIEADKITIFHDAEAADRI 93

Query: 94  NKINRMDV-ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
             +       +   I  G +   A     +  +  + L     +  ++++      G  +
Sbjct: 94  IAVGAPATLRQQPEIDKGFVTASAGRIVYEKSREWVQL----RESAVIEQDGAVVSGEYI 149

Query: 153 IVNIDTSFASLQGCE---SDQVQSII 175
              +              + +VQ II
Sbjct: 150 DYFMAEQRVRADAAPENANGRVQVII 175


>gi|119469167|ref|ZP_01612151.1| hypothetical protein ATW7_18765 [Alteromonadales bacterium TW-7]
 gi|119447419|gb|EAW28687.1| hypothetical protein ATW7_18765 [Alteromonadales bacterium TW-7]
          Length = 178

 Score = 78.0 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 58/168 (34%), Gaps = 10/168 (5%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           L+ +F++    L+    +      +  N+ I I AD  E +       F+ NV +   D 
Sbjct: 5   LSTLFIIPTFILALGTNAAEPTAPISANQ-ISISADKQEGQLKENVGIFEKNVEIIHGDR 63

Query: 75  SLQADKMTIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            + AD++ +   +   D                       ++  A+    D   R L L 
Sbjct: 64  KITADRLEVHKRDELGDNKQLLIATGTPAYFEEKQADGTIMSASANEVRYDVSTRFLTLI 123

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY 177
           GD      + +         +  +I+    S +  ES  D+V +I+  
Sbjct: 124 GDAE----ISQAGQKMNAKSITYDIEQQLISAEKDESSTDRVHTILVP 167


>gi|294013114|ref|YP_003546574.1| OstA-like protein [Sphingobium japonicum UT26S]
 gi|292676444|dbj|BAI97962.1| OstA-like protein [Sphingobium japonicum UT26S]
          Length = 183

 Score = 78.0 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 63/140 (45%), Gaps = 8/140 (5%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
           A A          N  ++  AD +EV+D   +    GNV +TQ   +L A +MT+ Y N 
Sbjct: 18  AGADAQVLKNHDSNAPVNFTADRIEVQDRADRVVVSGNVEVTQAGMTLNAARMTVAYRNQ 77

Query: 89  NRDVSN----KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
               +     +I+R+D   N+ ++  +     +    D   R++ + G+    V L +  
Sbjct: 78  PGGGTGPGGVEIDRIDASGNVVVRKADQTAKGNVAIYDLNSRLITMLGN----VSLTQGA 133

Query: 145 NTFLGCKLIVNIDTSFASLQ 164
           N   G +L++++ +  +++ 
Sbjct: 134 NRLTGGRLVIDLTSGRSTVD 153


>gi|113866418|ref|YP_724907.1| OstA-like protein [Ralstonia eutropha H16]
 gi|113525194|emb|CAJ91539.1| OstA-like protein [Ralstonia eutropha H16]
          Length = 216

 Score = 78.0 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 19/160 (11%), Positives = 51/160 (31%), Gaps = 14/160 (8%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
                 +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +     
Sbjct: 29  QPALAERADRDKPMVLEADNASYDDVKQIYTLTGNVVLTKGTMILKSDAAELRTDPEGYQ 88

Query: 92  ----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNT 146
                +    +  + +        I+        D ++    L G+     +   ++++ 
Sbjct: 89  FAVATAKPGKQAYIRQKREGVDEYIDGWGDRIEYDGKQEYSKLIGNARMARLQGAKQVDE 148

Query: 147 FLGCKLIVNIDTSFAS---------LQGCESDQVQSIIRY 177
             G  L  +    F +              S +V++++  
Sbjct: 149 IRGAVLTYDSRKEFYTAAGGGSGDAAAANPSGRVRAVLSP 188


>gi|83746570|ref|ZP_00943620.1| Protein yhbN precursor [Ralstonia solanacearum UW551]
 gi|83726704|gb|EAP73832.1| Protein yhbN precursor [Ralstonia solanacearum UW551]
          Length = 235

 Score = 78.0 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/158 (13%), Positives = 54/158 (34%), Gaps = 14/158 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  + 
Sbjct: 66  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAIALA 125

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 126 KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 185

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY-DGRP 181
             +    F +  G          S +V++++    G P
Sbjct: 186 TYDGQKEFYTASGGAENATAANPSGRVRAVLAPRSGTP 223


>gi|15646175|ref|NP_208359.1| hypothetical protein HP1568 [Helicobacter pylori 26695]
 gi|2314755|gb|AAD08611.1| predicted coding region HP1568 [Helicobacter pylori 26695]
          Length = 183

 Score = 77.7 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 52/164 (31%), Gaps = 2/164 (1%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +     +           A     +      E + I  +     D  + A  +GNV + +
Sbjct: 1   MRWWCFLVCCFGILSVMDAKKLENKNLKKERELLEITGNQFVANDKTKTAVIQGNVQIKK 60

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
               L ADK+++  N+  +    +             + EI+  A     +       L 
Sbjct: 61  GKDRLFADKVSVFLNDKRKPERYEATGNTHFNIFTEDNREISGSADKLIYNALNGEYKLL 120

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            +   + + K   N   G ++I+N    +A + G      + + 
Sbjct: 121 QNAVVREVGKS--NVITGDEIILNKTKGYADVLGSAKRPAKFVF 162


>gi|307728395|ref|YP_003905619.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. CCGE1003]
 gi|307582930|gb|ADN56328.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. CCGE1003]
          Length = 223

 Score = 77.7 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 57/156 (36%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             +   ++ ++I+AD +   D  Q   F G+V  T+    ++AD++ +  +         
Sbjct: 41  ADRADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTIMIKADRVEVTQDPQGYQYATG 100

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            S+  N     +        I   A     D ++ +  L  +   K +  L   ++   G
Sbjct: 101 TSSGGNLSYFRQKREGLDEYIEGTAVRIDYDGKQDLTTLTTNATVKRLQGLSTVMDQVHG 160

Query: 150 CKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
             +  +    F + +        G  + +V++++  
Sbjct: 161 SVITYDGQKDFYTAKAGKDVAGPGNPTGRVRAMLSP 196


>gi|317050778|ref|YP_004111894.1| OstA family protein [Desulfurispirillum indicum S5]
 gi|316945862|gb|ADU65338.1| OstA family protein [Desulfurispirillum indicum S5]
          Length = 157

 Score = 77.7 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 68/170 (40%), Gaps = 16/170 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
             Y  L  +V +     ++Q+                 I+++ LE+   + ++ F G+V 
Sbjct: 1   MKYTILAVVVALCWNFAMAQSNGVVY-----------TIESNHLEINAHIGESRFWGSVV 49

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
                + L AD + +           ++ R+    N+ +  G+    +   Y    ++ +
Sbjct: 50  FESPSYVLHADSLVVSAVQNAA-GRQELQRLHAWDNVELYYGDKRGFSDTLYYYHDRQTI 108

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           VL G+      L +  ++    ++ ++  T  A ++G ES++V+ I   D
Sbjct: 109 VLEGNAR----LIDSRSSLAAPRITIHEPTGEAFVEGDESERVKVIFEDD 154


>gi|254251392|ref|ZP_04944710.1| hypothetical protein BDAG_00577 [Burkholderia dolosa AUO158]
 gi|124894001|gb|EAY67881.1| hypothetical protein BDAG_00577 [Burkholderia dolosa AUO158]
          Length = 221

 Score = 77.7 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 55/163 (33%), Gaps = 14/163 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
             A      K   N+ I+++AD L   D  Q     GNV +T+    +  D++ +  +  
Sbjct: 32  GLAPAAHAEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIKITGDRVEVRQDPE 91

Query: 89  --NRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN- 145
                 S    +         +  +  +      +D+  +  +     A  V   +  + 
Sbjct: 92  GYQYATSFGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTST 151

Query: 146 ---TFLGCKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
              T  G  +  +    F + +G +        + +V++++  
Sbjct: 152 VADTVHGSVITYDGQRDFYTARGGKDVAAPGNPNGRVRAMLSP 194


>gi|186475097|ref|YP_001856567.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           phymatum STM815]
 gi|184191556|gb|ACC69521.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           phymatum STM815]
          Length = 225

 Score = 77.3 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 58/166 (34%), Gaps = 18/166 (10%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
              A      +   ++ ++I+AD +   D  Q   F G+V  T+    ++AD++ +  + 
Sbjct: 33  AGFAPLAHAERADKDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTILIRADRVEVTQDP 92

Query: 88  TNRD----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
                    S   N     +     +  I+  A     D ++ +  L      + +  + 
Sbjct: 93  QGYQYATGTSTGKNLAYFRQKRDGVNEYIDGDAERIDYDGKQDLTTLTTRATVRRL--QG 150

Query: 144 LNTF----LGCKLIVNIDTSFASLQ--------GCESDQVQSIIRY 177
            NT      G  +  +    F + +        G  + +V++++  
Sbjct: 151 TNTIMDEVHGSVITYDGQNDFYTAKAGKDVASPGNPNGRVRAMLSP 196


>gi|206559208|ref|YP_002229969.1| OstA-like protein [Burkholderia cenocepacia J2315]
 gi|198035246|emb|CAR51121.1| OstA-like protein [Burkholderia cenocepacia J2315]
          Length = 229

 Score = 77.3 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 58/161 (36%), Gaps = 15/161 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 47  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 106

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLG 149
               +         +  +  +      +D+  +  +     A  V   +  +    T  G
Sbjct: 107 FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTVADTVHG 166

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
             +  +    F + +G +        + +V++++   +G P
Sbjct: 167 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGP 207


>gi|325520920|gb|EGC99896.1| hypothetical protein B1M_34309 [Burkholderia sp. TJI49]
          Length = 221

 Score = 77.3 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 58/161 (36%), Gaps = 15/161 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    +  D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIKITGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +   +  +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDSERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
             +  +    F + +G +        + +V++++   +G P
Sbjct: 159 SVITYDGQHDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGP 199


>gi|83647981|ref|YP_436416.1| hypothetical protein HCH_05318 [Hahella chejuensis KCTC 2396]
 gi|83636024|gb|ABC31991.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 174

 Score = 77.3 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 60/173 (34%), Gaps = 14/173 (8%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           +   AL+  L+   LS A            +E + IKA   E         + GNV +TQ
Sbjct: 7   LFTAALLVALVFTPLSHALDLLNG-----SDEPVRIKAGRWERDGQKGIDTYIGNVVITQ 61

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVL 130
              S++ADK+ +  ++          +         +        A +   D  +  +V+
Sbjct: 62  GKSSIEADKVVLYTDDKGISRFQATGKPAHLVQFDAEKQTETHAYAESMDYDRSQSKVVM 121

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD----QVQSIIRYDG 179
                +   + +  ++  G ++I   D    + +G  S     QV+ I     
Sbjct: 122 ----RNHARILQDNSSVEGEEIIYFTDKRLVTAKGASSGNQTEQVEIIYHPPK 170


>gi|87201261|ref|YP_498518.1| OstA-like protein [Novosphingobium aromaticivorans DSM 12444]
 gi|87136942|gb|ABD27684.1| OstA-like protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 184

 Score = 77.3 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S         N  ++  AD +EV+D  ++    GNV ++Q D  ++A + T+ Y++T   
Sbjct: 34  SAQGIASHDSNAPVNYAADRIEVQDKAKRVVLSGNVDISQSDLRMRAARTTVAYSDT--- 90

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCK 151
            +  I R+D    + +  G  +        DF + I+ + G+    V L+   +T  G +
Sbjct: 91  GNIDIERIDATGGVQVTRGSESARGDVAVYDFNRNIITMTGN----VALRRGGDTLNGGR 146

Query: 152 LIVNIDTSFASLQ 164
           L++++D+  +S+ 
Sbjct: 147 LVIDLDSGLSSVD 159


>gi|224419265|ref|ZP_03657271.1| hypothetical protein HcanM9_08333 [Helicobacter canadensis MIT
           98-5491]
 gi|253826979|ref|ZP_04869864.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313142767|ref|ZP_07804960.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|253510385|gb|EES89044.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313131798|gb|EFR49415.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 155

 Score = 77.3 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/172 (15%), Positives = 59/172 (34%), Gaps = 21/172 (12%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           + ++I +L  +F L+                    ++I I A  L   +  +    +GNV
Sbjct: 1   MKIFILILTFLFPLIA-------------------DEIIIDAQELIADEKSKVTQLRGNV 41

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            +T+ +  L  D+  I  +  N+    +             + +I   A+        + 
Sbjct: 42  QITRINDKLNCDEAYIFLDKNNKPNKMQALGNVKFWLTLENNRKIQGKANELIYFPNLQE 101

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
             + G+   +   K   N   G K+I+     + ++ G      + I + D 
Sbjct: 102 YQIIGNAFVEEPAK--KNEVKGEKIIIRYKEGYINIVGDNKAPARLIFKLDK 151


>gi|330448613|ref|ZP_08312261.1| lipopolysaccharide transport periplasmic protein LptA
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492804|dbj|GAA06758.1| lipopolysaccharide transport periplasmic protein LptA
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 163

 Score = 77.3 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 61/161 (37%), Gaps = 6/161 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L  A L    +S +   +      IH+ A   +V          G V +TQ    ++ADK
Sbjct: 5   LFTAGLMLLLSSSVLAEQTQNQLPIHLSAITQDVDVINNVTTLTGKVDITQGGVQIKADK 64

Query: 81  MTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
             I  ++  +D+ +     +      +      ++  +  G       ++VL     DK 
Sbjct: 65  AVIKLDSKTKDLKSVEVYGKPAYFHRVMEDGKVVDGESLYGIYTPSNNMMVL----KDKA 120

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            + +  +T    ++  N+ T     +G + +QV +++  + 
Sbjct: 121 KITQDGSTIKAAQISYNLATQVMKAKGSKKNQVNTVLLPEK 161


>gi|121606596|ref|YP_983925.1| OstA family protein [Polaromonas naphthalenivorans CJ2]
 gi|120595565|gb|ABM39004.1| OstA family protein [Polaromonas naphthalenivorans CJ2]
          Length = 214

 Score = 76.9 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 56/172 (32%), Gaps = 13/172 (7%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
            +  LL A ++  A       K   ++ ++ +AD L   D  Q + F GNV +T+    +
Sbjct: 5   FLSFLLLAVMAAGAVLPAAAEKADRDKPMNAEADALRYDDLKQTSVFTGNVVITKGTTLI 64

Query: 77  QADKMTIDYNNTNRDVSNKINRM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNG 132
           +  ++ +  +     ++             +        I         D +  ++    
Sbjct: 65  RGGQVEVSQDPEGYQLAVATAAPGKLAYYRKKRDGVDEYIEGEGERIEYDSRADLVKFIK 124

Query: 133 DRADKVI-LKEKLNTFLGCKLIVNIDTSFASLQGC--------ESDQVQSII 175
               +        +   G  ++ + +T   ++              +V++++
Sbjct: 125 RAVVRRYKGATLSDETTGGLIVYDNNTDVFTVDSGAKNSTAANPGGRVRAML 176


>gi|319956688|ref|YP_004167951.1| osta family protein [Nitratifractor salsuginis DSM 16511]
 gi|319419092|gb|ADV46202.1| OstA family protein [Nitratifractor salsuginis DSM 16511]
          Length = 167

 Score = 76.9 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 40/131 (30%), Gaps = 2/131 (1%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + + AD     +  QKA F+G+   TQ    ++A K  + ++  N     +         
Sbjct: 23  LEVTADKFTHLEKEQKAIFQGHAHATQGASWIKAKKFVVYFDKENNAKEYQAMGNVNFEI 82

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           +     ++            +    L G       +        G ++ ++     A   
Sbjct: 83  VKKPDRDVKGQCDKLLYKVAEDSYRLIGHAVVDDRVNH--RLMKGDEIFLDNKRGLARAT 140

Query: 165 GCESDQVQSII 175
             +   V+ + 
Sbjct: 141 SGKKGPVKFVF 151


>gi|163854755|ref|YP_001629053.1| hypothetical protein Bpet0450 [Bordetella petrii DSM 12804]
 gi|163258483|emb|CAP40782.1| putative exported protein [Bordetella petrii]
          Length = 213

 Score = 76.9 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 53/172 (30%), Gaps = 17/172 (9%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
             + AL+   +    +Q          +       I +D L   D  +++ F GNV +T+
Sbjct: 21  AVIGALLLGTVACAHAQQQKPAEEPSTL-------ILSDTLHYDDVKRQSIFTGNVVLTR 73

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINR----MDVERNIFIQSGEINVIASNGYVDFQKRI 127
               L AD++  + +                + + +        I         +  K  
Sbjct: 74  GLMKLTADRLEANEDAAGNQFGTATANKGKLVTIRQERPETFEVIEGKGLRAEYNSTKGE 133

Query: 128 LVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFASLQGC-----ESDQVQS 173
             L G       +  K  +T  G ++  N  T     QG         +V+S
Sbjct: 134 FDLIGQALVTRYICGKPFDTIRGERVRYNEKTGVYQAQGGPNSSAPGGRVRS 185


>gi|254247188|ref|ZP_04940509.1| OstA-like protein [Burkholderia cenocepacia PC184]
 gi|124871964|gb|EAY63680.1| OstA-like protein [Burkholderia cenocepacia PC184]
          Length = 221

 Score = 76.9 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +        + +V++++  
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSP 194


>gi|152981899|ref|YP_001355040.1| OstA-like protein [Janthinobacterium sp. Marseille]
 gi|151281976|gb|ABR90386.1| OstA-like protein [Janthinobacterium sp. Marseille]
          Length = 184

 Score = 76.9 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 61/184 (33%), Gaps = 22/184 (11%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  ++ +L ++  L                K    +  +++A+ +E  D  Q   F GNV
Sbjct: 1   MKRFLSVLLVLCGL-------GTTVGSFAEKADATKPTNVEANKMEYDDIKQINTFTGNV 53

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI-----QSGEINVIASNGYVD 122
            +T+    ++A+KM +  +             D   N            I   A     D
Sbjct: 54  VLTRGTILMKANKMVVKQDPAGYQFITLYGSADTLANFKQKRDGGPDQWIEGQAERIEYD 113

Query: 123 FQKRILVLNGDRADKVILKEKL--NTFLGCKLIVNIDTSFASL----QGCES---DQVQS 173
            +  I+ L      +  L+     +   G  +  +    F ++     G       ++++
Sbjct: 114 DKAEIMKLFSKARMR-RLENGKPTDEVEGEFISYDTRAEFFTVHNTSSGDSKQGAGRIKA 172

Query: 174 IIRY 177
           +I+ 
Sbjct: 173 VIQP 176


>gi|170734134|ref|YP_001766081.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           cenocepacia MC0-3]
 gi|169817376|gb|ACA91959.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           cenocepacia MC0-3]
          Length = 221

 Score = 76.9 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 58/161 (36%), Gaps = 15/161 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
             +  +    F + +G +        + +V++++   +G P
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGP 199


>gi|89899586|ref|YP_522057.1| OstA-like protein [Rhodoferax ferrireducens T118]
 gi|89344323|gb|ABD68526.1| OstA-like protein [Rhodoferax ferrireducens T118]
          Length = 213

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 53/162 (32%), Gaps = 13/162 (8%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
             AS +   +   N+ ++++AD L   DA + + F G V +T+    ++  ++ +  +  
Sbjct: 16  PGASLVRAEQADRNKPMNVEADALRYDDAKKTSVFTGRVVLTKGSILIRGARIEVRQDPE 75

Query: 89  NRDVSNKINRM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEK 143
                             +        I     +   D +   +  N     +  L    
Sbjct: 76  GNQYGLVTAEPGKLASFRQKREGLDEFIEGQGESIEYDSRADTVKFNKQAQLRRYLGATL 135

Query: 144 LNTFLGCKLIVNIDTSFASLQGC--------ESDQVQSIIRY 177
            +   G  ++ N  T   ++ G            +V++++  
Sbjct: 136 NDEMSGGVIVYNNSTDVFTVDGGVAQGAPSATGGRVRAMLTP 177


>gi|107023722|ref|YP_622049.1| OstA-like protein [Burkholderia cenocepacia AU 1054]
 gi|116690809|ref|YP_836432.1| OstA family protein [Burkholderia cenocepacia HI2424]
 gi|105893911|gb|ABF77076.1| OstA-like protein [Burkholderia cenocepacia AU 1054]
 gi|116648898|gb|ABK09539.1| OstA family protein [Burkholderia cenocepacia HI2424]
          Length = 221

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +        + +V++++  
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSP 194


>gi|161523706|ref|YP_001578718.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           multivorans ATCC 17616]
 gi|189351530|ref|YP_001947158.1| hypothetical protein BMULJ_02733 [Burkholderia multivorans ATCC
           17616]
 gi|221199999|ref|ZP_03573042.1| cell envelope biogenesis protein YhbN [Burkholderia multivorans
           CGD2M]
 gi|221206846|ref|ZP_03579858.1| cell envelope biogenesis protein YhbN [Burkholderia multivorans
           CGD2]
 gi|221211206|ref|ZP_03584185.1| cell envelope biogenesis protein YhbN [Burkholderia multivorans
           CGD1]
 gi|160341135|gb|ABX14221.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           multivorans ATCC 17616]
 gi|189335552|dbj|BAG44622.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|221168567|gb|EEE01035.1| cell envelope biogenesis protein YhbN [Burkholderia multivorans
           CGD1]
 gi|221173501|gb|EEE05936.1| cell envelope biogenesis protein YhbN [Burkholderia multivorans
           CGD2]
 gi|221180238|gb|EEE12642.1| cell envelope biogenesis protein YhbN [Burkholderia multivorans
           CGD2M]
          Length = 221

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 57/161 (35%), Gaps = 15/161 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    +  D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIKITGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
             +  +    F + +G +        + +V++++   +G P
Sbjct: 159 SVITYDGQHDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGP 199


>gi|302381886|ref|YP_003817709.1| OstA family protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192514|gb|ADL00086.1| OstA family protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 164

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 58/168 (34%), Gaps = 15/168 (8%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            L      A L     +         N+ I   AD  E+ +       +G   + Q    
Sbjct: 6   ILAIGATVAALGLGGMAVAQSRPNTSNQPIGYGADSGELTNTA--VSLRGRAEIQQGQTR 63

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA 135
           L+A+ +    +      S  + R++   +++  +    +             +V+ GD  
Sbjct: 64  LRANAIEGARDA-----SGGLTRIEASGDVYYVTPNETIRGDRAVYTVTNATVVVTGD-- 116

Query: 136 DKVILKEKLNTFLGCKLIVNIDTSFASLQGC----ESDQVQSIIRYDG 179
             VIL +  N   G  L  N+DT  A +QG        +V+ +   +G
Sbjct: 117 --VILTQGQNVLTGGSLTYNVDTGEARIQGGGAGANDGRVRGVFYPEG 162


>gi|237748918|ref|ZP_04579398.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes OXCC13]
 gi|229380280|gb|EEO30371.1| ABC transporter periplasmic substrate-binding protein [Oxalobacter
           formigenes OXCC13]
          Length = 184

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 59/190 (31%), Gaps = 23/190 (12%)

Query: 5   LNSIHLYIHLL-ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           +     +  L+ A    L    L++         +   N+  +I+AD + V D  Q   F
Sbjct: 1   MKIFKPFKFLILAFCIGLSFPALAE---------RADANKPTNIEADQMTVDDVKQVTTF 51

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-----EINVIASN 118
            GNV +T+    ++A K  I  +                 ++  +        +      
Sbjct: 52  TGNVIVTKGTLLIKAAKAVIVQDPEGYQYVTLYAAPGKLASMRQKLDGGPNLWMEGYGEK 111

Query: 119 GYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKLIVNIDTSFAS-------LQGCESDQ 170
              D +  +         K +      +  +G  +  +  +           +    + +
Sbjct: 112 IEYDNKHEVAKFYTHARVKRMEGSVVTDDLMGEFIAYDGKSESYRANNTSQGVSKPGAGR 171

Query: 171 VQSIIRYDGR 180
           V+++I+   +
Sbjct: 172 VKAVIQPREK 181


>gi|171318645|ref|ZP_02907791.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           ambifaria MEX-5]
 gi|171096153|gb|EDT41076.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           ambifaria MEX-5]
          Length = 221

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +        + +V++++  
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSP 194


>gi|170700374|ref|ZP_02891384.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           ambifaria IOP40-10]
 gi|170134718|gb|EDT03036.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           ambifaria IOP40-10]
          Length = 221

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +        + +V++++  
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSP 194


>gi|34558351|ref|NP_908166.1| hypothetical protein WS2067 [Wolinella succinogenes DSM 1740]
 gi|34484070|emb|CAE11066.1| conserved hypothetical protein [Wolinella succinogenes]
          Length = 181

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 56/134 (41%), Gaps = 2/134 (1%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            +++ I A      +A +     G+V + + D  L  DK+T+ +++ NR +  +      
Sbjct: 21  KDQVEITAKHFVADEAKKTTLITGDVVVVRGDDRLITDKLTVFFDDKNRPLKYEAQGNVK 80

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                    ++   ++N   D  K    L G+   + I K   NT  G K+I+N  + FA
Sbjct: 81  FAITLADGRKLKGYSNNALYDAPKNEYHLLGNAFMEEIGKS--NTVKGEKIIINRVSGFA 138

Query: 162 SLQGCESDQVQSII 175
           ++ G      + I 
Sbjct: 139 NVVGDSQKPAKLIF 152


>gi|109896894|ref|YP_660149.1| OstA-like protein [Pseudoalteromonas atlantica T6c]
 gi|109699175|gb|ABG39095.1| OstA-like protein [Pseudoalteromonas atlantica T6c]
          Length = 173

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 55/150 (36%), Gaps = 9/150 (6%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    + I + +         +K+ F+ +V + Q   ++ AD++ +D +    +    
Sbjct: 2   AGKEDFTQAIKVDSKFQFGDGKTKKSIFREDVHINQGSLNVYADEVEVDASKGEGNEVFI 61

Query: 96  INRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
                 + +   + G      A+        R L L GD      LK+  ++  G  ++ 
Sbjct: 62  ATGSPAKYSQQQEQGGSIEASANRIEYRRDLRTLTLEGDAQ----LKQNNSSVKGESIVF 117

Query: 155 NIDTSFASLQG----CESDQVQSIIRYDGR 180
           N++      QG      S +V +I +   +
Sbjct: 118 NMELEQIVAQGESESENSGRVTTIFQPAKK 147


>gi|148360517|ref|YP_001251724.1| organic solvent tolerance protein [Legionella pneumophila str.
           Corby]
 gi|148282290|gb|ABQ56378.1| OstA-like protein; organic solvent tolerance protein [Legionella
           pneumophila str. Corby]
          Length = 139

 Score = 76.5 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/141 (12%), Positives = 46/141 (32%), Gaps = 9/141 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + + +D  ++     +  + GNV   Q   +L+A+K     +  N+           ++ 
Sbjct: 2   VQVVSDSADLNQKNHQGVYIGNVEFVQGSTNLRAEKAITQGDAKNQLTLAIAEGSKDKQA 61

Query: 105 IFI-----QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
            +           +  A        K ++ L G+      +++  N+    K+  +    
Sbjct: 62  HYWTTTAPDKPPFHAYADTIKYYPLKHLIELIGNAR----IEQGPNSLSAAKISYDTQEQ 117

Query: 160 FASLQGCESDQVQSIIRYDGR 180
                  E  +   II  + +
Sbjct: 118 HVLSHSDEKTRTTIIIYPEKK 138


>gi|115352900|ref|YP_774739.1| OstA family protein [Burkholderia ambifaria AMMD]
 gi|172061748|ref|YP_001809400.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           ambifaria MC40-6]
 gi|115282888|gb|ABI88405.1| OstA family protein [Burkholderia ambifaria AMMD]
 gi|171994265|gb|ACB65184.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           ambifaria MC40-6]
          Length = 221

 Score = 76.5 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   N+ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQNKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +      +D+  +  +     A  V   +  +T      G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY 177
             +  +    F + +G +        + +V++++  
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSP 194


>gi|94495609|ref|ZP_01302189.1| OstA-like protein [Sphingomonas sp. SKA58]
 gi|94424997|gb|EAT10018.1| OstA-like protein [Sphingomonas sp. SKA58]
          Length = 187

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 77/184 (41%), Gaps = 20/184 (10%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFK---VLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   + LL+  F+     +   +   +          N  ++  AD +EV+D   +    
Sbjct: 1   MKRTLILLSTGFLATTGVMIVGSGGPLFAQALRNHDSNAPVNFTADRIEVQDRADRVVVS 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSN--KINRMDVERNIFIQSGEINVIASNGYVD 122
           GNV +TQ   +L A +MT+ Y N     +N  +I+R+D   N+ +  G+     +    D
Sbjct: 61  GNVVVTQAGMTLNAARMTVAYRNQPGGGANGVEIDRIDASGNVVVTKGDQTARGNVAIYD 120

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-----------CESDQV 171
              +++ + G+    V L +  N   G +L++++++  +++ G             S +V
Sbjct: 121 LNAKLITMLGN----VALTQGANRLTGGRLVMDLNSGRSTVDGRSSGGGAGTSTSPSGRV 176

Query: 172 QSII 175
               
Sbjct: 177 SGTF 180


>gi|311109295|ref|YP_003982148.1| lipopolysaccharide transport periplasmic protein LptA
           [Achromobacter xylosoxidans A8]
 gi|310763984|gb|ADP19433.1| lipopolysaccharide transport periplasmic protein LptA
           [Achromobacter xylosoxidans A8]
          Length = 208

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 47/144 (32%), Gaps = 10/144 (6%)

Query: 47  IKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMDVE 102
           I +D L   D  +K+ F GNV MT+   +L +D + ++ +                + + 
Sbjct: 47  ILSDTLHYDDVKKKSVFTGNVNMTRGLMTLTSDVLEMNEDAQGNQYGTATANKGKIVTIR 106

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL-NTFLGCKLIVNIDTSFA 161
           +        I         D  K    L G       +  K  +T  G ++  N  T   
Sbjct: 107 QERPETFELIEGTGLRAEYDGTKSTFDLIGQAVVTRFVCGKPFDTIRGERVRYNEKTGTY 166

Query: 162 SLQGCE-----SDQVQSIIRYDGR 180
              G         +V+S+     +
Sbjct: 167 EAHGGPNSAAAGGRVRSVAEPRAK 190


>gi|256827967|ref|YP_003156695.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfomicrobium baculatum DSM 4028]
 gi|256577143|gb|ACU88279.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfomicrobium baculatum DSM 4028]
          Length = 175

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/179 (13%), Positives = 58/179 (32%), Gaps = 22/179 (12%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           L+  +F+     L  A  +         +  + I +D +       +  F G+V++ ++D
Sbjct: 4   LILFLFLACATPLWAAQTAPA------KDVPVKITSDTMTYTQKGDQVVFTGSVYVIRQD 57

Query: 74  FSLQADKMTIDYNNTNRDVSNKI----------NRMDVERNIFIQSGEINVIASNGYVDF 123
             L +D +T+         +               +                      + 
Sbjct: 58  IQLWSDTLTVLLEKKEGSGNATQSVADEQGSIKKIIAKGNVRIKADQGRTGTCGKATYEA 117

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR-YDGRP 181
            K +L +  +     +L E  N   G  + + I  S + + G +  +V++I      +P
Sbjct: 118 DKDLLTMEDNP----MLMEGANKIQGEVIKLFIKESRSEVLGGK-GRVEAIFNTPASKP 171


>gi|254523996|ref|ZP_05136051.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas sp. SKA14]
 gi|219721587|gb|EED40112.1| lipopolysaccharide transport periplasmic protein LptA
           [Stenotrophomonas sp. SKA14]
          Length = 175

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 51/151 (33%), Gaps = 6/151 (3%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLE-VKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
            S         NE + I++     V     K      V +TQ    +++ +  I   +  
Sbjct: 16  PSAAFAKSTDRNENMDIESGAQSGVLTGDGKTVLSQGVTITQGTLDIRSSEAEIYLKDGE 75

Query: 90  RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
              +    +    +        ++ +A     D +  I+ L G+      +     T  G
Sbjct: 76  AVRAVFTGKQATMKQQLDDGTWMDAVADRIDYDIKTEIITLTGNYK----VTSARGTNAG 131

Query: 150 CKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +++ N  +   +  G +  +V+++I    +
Sbjct: 132 QRMVYNTRSGEMN-SGGDGSRVRTVIPPKNK 161


>gi|207727851|ref|YP_002256245.1| hypothetical protein RSMK04150 [Ralstonia solanacearum MolK2]
 gi|206591092|emb|CAQ56704.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 198

 Score = 76.1 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/158 (13%), Positives = 54/158 (34%), Gaps = 14/158 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  + 
Sbjct: 29  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAIALA 88

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 89  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 148

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY-DGRP 181
             +    F +  G          S +V++++    G P
Sbjct: 149 TYDGQKEFYTASGGAENATAANPSGRVRAVLAPRSGTP 186


>gi|207742256|ref|YP_002258648.1| hypothetical protein RSIPO_00440 [Ralstonia solanacearum IPO1609]
 gi|206593644|emb|CAQ60571.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 198

 Score = 75.7 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/158 (13%), Positives = 54/158 (34%), Gaps = 14/158 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  + 
Sbjct: 29  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAIALA 88

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 89  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 148

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY-DGRP 181
             +    F +  G          S +V++++    G P
Sbjct: 149 TYDGQKEFYTASGGAENATAANPSGRVRAVLAPRSGTP 186


>gi|77919536|ref|YP_357351.1| hypothetical protein Pcar_1940 [Pelobacter carbinolicus DSM 2380]
 gi|77545619|gb|ABA89181.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 166

 Score = 75.7 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 62/147 (42%), Gaps = 8/147 (5%)

Query: 35  TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN 94
                   + + I +  LE    ++K  F G V   Q+  ++++ K+ + Y  +   VS+
Sbjct: 25  ASATAGKAQPLEITSQKLEADGTLKKVVFVGKVVARQDGLTIRSSKLIVAYGQSGTRVSS 84

Query: 95  KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIV 154
               ++   ++ +Q  +    A  G  +  +  +VL         +++  N+  G +++ 
Sbjct: 85  ----IEAIGDVVVQKDDRTATAGRGLYNVAEGTVVLTETPR----VQQGDNSVEGDEIVF 136

Query: 155 NIDTSFASLQGCESDQVQSIIRYDGRP 181
            ++   + ++     +V++I+   G P
Sbjct: 137 YLEEDRSIVKSQSGSRVRAILTPGGTP 163


>gi|17545129|ref|NP_518531.1| signal peptide protein [Ralstonia solanacearum GMI1000]
 gi|17427420|emb|CAD13938.1| putative signal peptide protein [Ralstonia solanacearum GMI1000]
          Length = 191

 Score = 75.7 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 54/158 (34%), Gaps = 14/158 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  I 
Sbjct: 30  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAVAIA 89

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 90  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 149

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY-DGRP 181
             +    F +  G          S +V++++    G P
Sbjct: 150 TYDGQKEFYTASGGAENATAANPSGRVRAVLAPRSGTP 187


>gi|326388614|ref|ZP_08210207.1| hypothetical protein Y88_3015 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206865|gb|EGD57689.1| hypothetical protein Y88_3015 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 210

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
                  +   AD +E++D  ++    GNV +TQE+  L+AD+  + Y + +      + 
Sbjct: 44  SHNSEAPVDFSADHMELQDKQKRVLLTGNVDITQEELRLKADRTLMTYTDND---KLTLQ 100

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           R++   N+ +   +          DF ++I+ + G  A +   + + +T  G +L+++++
Sbjct: 101 RIEATGNVVVTRQDERAAGDVAVYDFNRKIITMVGHVALR---RAQGDTLNGGRLVIDLN 157

Query: 158 TSFASLQG 165
           T  +S+ G
Sbjct: 158 TGISSIDG 165


>gi|167585437|ref|ZP_02377825.1| OstA-like protein [Burkholderia ubonensis Bu]
          Length = 221

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 58/161 (36%), Gaps = 15/161 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K    + I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQGKPINVEADNLTYDDLKQVTIATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LG 149
               +         +  +  +   +  +D+  +  +     A  V   +  +T      G
Sbjct: 99  YGSGKKHASFRQKREGLDEYIDGDSERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
             +  +    F + +G +        + +V++++   +G P
Sbjct: 159 SVITYDGQRDFYTARGGKDVAAPGNPNGRVRAMLSPRNGGP 199


>gi|239813483|ref|YP_002942393.1| lipopolysaccharide transport periplasmic protein LptA [Variovorax
           paradoxus S110]
 gi|239800060|gb|ACS17127.1| lipopolysaccharide transport periplasmic protein LptA [Variovorax
           paradoxus S110]
          Length = 239

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 51/156 (32%), Gaps = 16/156 (10%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI- 96
               ++ ++I++D +   D  Q + F GNV +T+    ++  ++ +  +           
Sbjct: 37  TADRSKPMNIESDAMRYDDLKQTSVFTGNVLVTKGTIIIRGARIDVRQDAEGYQYGVVTA 96

Query: 97  ---NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
               R   ++        I   +     D +   +    +   + ++     +   G  +
Sbjct: 97  APGKRAYYKQKRNAPDEWIEGESEVIEYDSRADNVKFIRNAVMRRLIGATPNDESTGALI 156

Query: 153 IVNIDTSFASLQGC-----------ESDQVQSIIRY 177
           + +      ++ G               +V++I+  
Sbjct: 157 VYDQSNDTYTVNGSTVPPNTGVNAPPVGRVRTILTP 192


>gi|187927372|ref|YP_001897859.1| lipopolysaccharide transport periplasmic protein LptA [Ralstonia
           pickettii 12J]
 gi|309779927|ref|ZP_07674681.1| lipopolysaccharide transport periplasmic protein LptA [Ralstonia
           sp. 5_7_47FAA]
 gi|187724262|gb|ACD25427.1| lipopolysaccharide transport periplasmic protein LptA [Ralstonia
           pickettii 12J]
 gi|308921286|gb|EFP66929.1| lipopolysaccharide transport periplasmic protein LptA [Ralstonia
           sp. 5_7_47FAA]
          Length = 195

 Score = 75.7 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/153 (13%), Positives = 53/153 (34%), Gaps = 13/153 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D+  +  +    + +   +
Sbjct: 27  RADRDKPLVLEADNASYDDLKQVYHLTGNVVLTKGTMVLRSDQADLRTDPEGYNYAVATS 86

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 87  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLITRARMERLQGATQLDEIRGAVI 146

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY 177
             +    F +  G          S +V++++  
Sbjct: 147 TYDGQKEFYTASGGAENATAANPSGRVRAVLAP 179


>gi|299068031|emb|CBJ39245.1| conserved exported protein of unknown function, putative OstA-like
           protein [Ralstonia solanacearum CMR15]
          Length = 191

 Score = 75.3 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 54/158 (34%), Gaps = 14/158 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  I 
Sbjct: 30  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAVAIA 89

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 90  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 149

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY-DGRP 181
             +    F +  G          S +V++++    G P
Sbjct: 150 TYDGQKEFYTASGGAENATAANPSGRVRAVLAPRSGTP 187


>gi|291277359|ref|YP_003517131.1| hypothetical protein HMU11510 [Helicobacter mustelae 12198]
 gi|290964553|emb|CBG40406.1| putative hypothetical protein [Helicobacter mustelae 12198]
          Length = 164

 Score = 75.3 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 53/136 (38%), Gaps = 2/136 (1%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           EK+ + AD     +    +  +GNV + +    L+A K+TI     N+            
Sbjct: 18  EKLEVVADHFMADNQKGISVVEGNVDVKKGQDHLKAQKVTIYTTKDNKLKEVFAQGDVDF 77

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
                   +I   A++   + Q +   L G+   +   KE  ++  G ++ +N  +   +
Sbjct: 78  FITTPDGRKIRGRANSLRYNAQSQEYHLIGNAKAREEGKE--SSIAGDEIKINNQSGSMN 135

Query: 163 LQGCESDQVQSIIRYD 178
           + G ++   + +   D
Sbjct: 136 VVGSKNKPAKLVFDLD 151


>gi|78067588|ref|YP_370357.1| OstA-like protein [Burkholderia sp. 383]
 gi|77968333|gb|ABB09713.1| OstA-like protein [Burkholderia sp. 383]
          Length = 221

 Score = 75.3 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 58/161 (36%), Gaps = 15/161 (9%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT--NRDVS 93
             K   ++ I+++AD L   D  Q     GNV +T+    ++ D++ +  +        S
Sbjct: 39  AEKADQSKPINVEADNLTYDDLKQVTVATGNVVITKGTIIIKGDRVEVRQDPEGYQYATS 98

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL----NTFLG 149
               +         +  +  +      +D+  +  +     A  V   +      +T  G
Sbjct: 99  FGSGKKHATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTTTIADTVHG 158

Query: 150 CKLIVNIDTSFASLQGCE--------SDQVQSIIRY-DGRP 181
             +  +    F + +G +        + +V++++   +G P
Sbjct: 159 SVITYDGQRDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGP 199


>gi|315638536|ref|ZP_07893712.1| OstA family protein [Campylobacter upsaliensis JV21]
 gi|315481380|gb|EFU72008.1| OstA family protein [Campylobacter upsaliensis JV21]
          Length = 154

 Score = 75.3 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 52/134 (38%), Gaps = 3/134 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   K+   GNV +++    L A+++ I  +   + +  + ++     +
Sbjct: 21  IEVKALNFYADENTGKSVLSGNVVVSRGKDVLNAEELVIFMDKNRKPLRYEASKNPKF-S 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I + +            +  K    +NG+     I  +K     G K+IV+   +   +Q
Sbjct: 80  IMLNNKTYKGSGDKFIYNVAKDTYEINGNAFIHEINTDKK--LYGDKIIVDRKANIYQVQ 137

Query: 165 GCESDQVQSIIRYD 178
             ++   + +   +
Sbjct: 138 SRQNKPARFVFELE 151


>gi|239787677|emb|CAX84185.1| OstA-like family protein [uncultured bacterium]
          Length = 277

 Score = 75.0 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/140 (24%), Positives = 55/140 (39%), Gaps = 11/140 (7%)

Query: 46  HIKA-DMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
            + A D LE  +A + A  +G+ F+  ED  L+AD +T D          +I R D   N
Sbjct: 138 TVTATDSLEYWEAKRVAVARGDAFIQHEDKRLRADTITADLKEDKN-GKLEIKRADAFGN 196

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + +++         G      ++  L G+    V +    N   G    VN+ T  + L 
Sbjct: 197 VLVRTPTDIATGDKGVYFTDTQLATLTGN----VKITRDKNQLNGGYAEVNLATGISRLF 252

Query: 165 GCE-----SDQVQSIIRYDG 179
                     +VQ I+  DG
Sbjct: 253 PAPPGNAQGTRVQGILMPDG 272



 Score = 54.2 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 58/160 (36%), Gaps = 16/160 (10%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           L A L  A+ S            I I +D  +E     Q+   +GN    + + ++ AD+
Sbjct: 23  LAAGLDFASNSAEGA--------IDITSDNGIEWMQREQRFIARGNAKAIRNNVTVLADE 74

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           +   Y +       +I +++   ++ I S +  V   +   D    +LV+ G    K ++
Sbjct: 75  LIAHYRDRKEGGGTEIWKLEALGHVRIHSADTKVFGDSAVYDIDNVVLVVRGKPMAK-LV 133

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
                      L        A  +G       + I+++ +
Sbjct: 134 TLTDTVTATDSLEYWEAKRVAVARGD------AFIQHEDK 167


>gi|120609120|ref|YP_968798.1| OstA family protein [Acidovorax citrulli AAC00-1]
 gi|120587584|gb|ABM31024.1| OstA family protein [Acidovorax citrulli AAC00-1]
          Length = 216

 Score = 75.0 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 50/174 (28%), Gaps = 21/174 (12%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
                A       K   N+ ++I+AD L   +  Q + F G V +T+    L+  ++ + 
Sbjct: 13  ASMAFAVGPAQAEKADRNKPMNIEADALRHDELKQTSVFTGRVVVTKGTIVLRGTRLDVR 72

Query: 85  YNNTNRDVSNKINRMDVERNIFI--------QSGEINVIASNGYVDFQKRILVLNGDRAD 136
            +                                 +         D +  ++ L      
Sbjct: 73  QDPDGFQYGTMTAEPGKRAFFRQKRDTAPGAPDEFVEGEGEVIEYDGRADLVRLIRRAEL 132

Query: 137 KVILKEK-LNTFLGCKLIVNIDTSFASLQGCE------------SDQVQSIIRY 177
           +   +    +   G  ++ N  T   ++ G +              +V++++  
Sbjct: 133 RRYRESTLTDEMAGALIVYNNTTDVFTVDGQKTAPGGAASSGTPGGRVRAVLSP 186


>gi|300705236|ref|YP_003746839.1| hypothetical protein RCFBP_21078 [Ralstonia solanacearum CFBP2957]
 gi|299072900|emb|CBJ44256.1| conserved exported protein of unknown function, putative OstA-like
           protein [Ralstonia solanacearum CFBP2957]
          Length = 198

 Score = 75.0 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/153 (13%), Positives = 52/153 (33%), Gaps = 13/153 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  + 
Sbjct: 29  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAIALA 88

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 89  KPGNLAFIRQKRDNVDEYIEGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 148

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY 177
             +    F +  G          S +V++++  
Sbjct: 149 TYDGQKEFYTASGGAENATAANPSGRVRAVLAP 181


>gi|241661911|ref|YP_002980271.1| lipopolysaccharide transport periplasmic protein LptA [Ralstonia
           pickettii 12D]
 gi|240863938|gb|ACS61599.1| lipopolysaccharide transport periplasmic protein LptA [Ralstonia
           pickettii 12D]
          Length = 195

 Score = 75.0 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/153 (13%), Positives = 53/153 (34%), Gaps = 13/153 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D+  +  +    + +   +
Sbjct: 27  RADRDKPLVLEADNASYDDLKQVYHLTGNVVLTKGTMVLRSDQADLRTDPEGYNYAVATS 86

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 87  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLITRARMERLQGATQLDEIRGAVI 146

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY 177
             +    F +  G          S +V++++  
Sbjct: 147 TYDGQKEFYTASGGAENATAANPSGRVRAVLAP 179


>gi|329899106|ref|ZP_08272513.1| LptA, protein essential for LPS transport across the periplasm
           [gamma proteobacterium IMCC3088]
 gi|328920672|gb|EGG28152.1| LptA, protein essential for LPS transport across the periplasm
           [gamma proteobacterium IMCC3088]
          Length = 166

 Score = 75.0 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 51/171 (29%), Gaps = 19/171 (11%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            L  L+ VL    L+Q+A            + I I AD     +      + GNV + Q 
Sbjct: 8   ILGLLLIVLSPWVLAQSAQ-----------DPIRISADEATRSELEGITRYLGNVVLVQG 56

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEIN-VIASNGYVDFQKRILVLN 131
             ++ A  + ID  N                   + +       A     +   R ++L 
Sbjct: 57  TITITASSLEIDQANPEEIKIIATGSPATFVQPMVGAEPAIDAKAQTIRYEQVARKVILE 116

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASL---QGCESDQVQSIIRYDG 179
            D      ++   +   G  +   ID               +V+ +I   G
Sbjct: 117 QDAR----IQRGESIIRGPLIEYFIDEKRVQAGQDANQPKSRVEVVIPPSG 163


>gi|326315296|ref|YP_004232968.1| lipopolysaccharide transport periplasmic protein LptA [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372132|gb|ADX44401.1| lipopolysaccharide transport periplasmic protein LptA [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 216

 Score = 75.0 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 50/174 (28%), Gaps = 21/174 (12%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
                A       K   N+ ++I+AD L   +  Q + F G V +T+    L+  ++ + 
Sbjct: 13  ASMAFAVGPAQAEKADRNKPMNIEADALRHDELKQTSVFTGRVVVTKGTIVLRGTRLDVR 72

Query: 85  YNNTNRDVSNKINRMDVERNIFI--------QSGEINVIASNGYVDFQKRILVLNGDRAD 136
            +                                 +         D +  ++ L      
Sbjct: 73  QDPDGFQYGTMTAEPGKRAFFRQKRDTAPGAPDEFVEGEGEVIEYDGRADLVRLIRRAEL 132

Query: 137 KVILKEK-LNTFLGCKLIVNIDTSFASLQGCE------------SDQVQSIIRY 177
           +   +    +   G  ++ N  T   ++ G +              +V++++  
Sbjct: 133 RRYRESTLTDEMAGALIVYNNTTDVFTVDGQKTAPGGAASSGTPGGRVRAVLSP 186


>gi|57242608|ref|ZP_00370545.1| OstA family protein [Campylobacter upsaliensis RM3195]
 gi|57016537|gb|EAL53321.1| OstA family protein [Campylobacter upsaliensis RM3195]
          Length = 154

 Score = 74.6 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 50/132 (37%), Gaps = 3/132 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   K+   GNV +++    L A+++ I  +   + +  + ++     +
Sbjct: 21  IEVKALNFYADENTGKSVLSGNVVVSRGKDVLNAEELVIFMDKNRKPLRYEASKNPKF-S 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I +              +  K    +NG+     I  +K     G K+IV+   +   +Q
Sbjct: 80  IMLNDKTYKGSGDKFIYNVAKDTYEINGNAFIHEINTDKK--LYGDKIIVDRKANIYQVQ 137

Query: 165 GCESDQVQSIIR 176
             ++   + +  
Sbjct: 138 SRQNKPARFVFE 149


>gi|242279723|ref|YP_002991852.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio salexigens DSM 2638]
 gi|242122617|gb|ACS80313.1| lipopolysaccharide transport periplasmic protein LptA
           [Desulfovibrio salexigens DSM 2638]
          Length = 541

 Score = 74.6 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 51/136 (37%), Gaps = 8/136 (5%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD--- 100
            I I +  +   +   +  F G V + + D +L +D +T         +S+  +++    
Sbjct: 404 PIKITSTKMTFSENRNRITFSGKVKVVRLDVTLTSDTLTAHLRPEGDSLSDTQDKIKKIV 463

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
              N+ +   +               I+ +NG+      L++  N   G ++   +  + 
Sbjct: 464 AAGNVKVVMKKRKGHCDKLTYVVGDSIIYMNGNAE----LQDGPNLIQGDEIKFYLKDNR 519

Query: 161 ASLQGCESDQVQSIIR 176
           A + G  +  +++I  
Sbjct: 520 AEVVGG-NKPIEAIFY 534


>gi|332531902|ref|ZP_08407786.1| LptA, protein essential for LPS transport across the periplasm
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038529|gb|EGI74972.1| LptA, protein essential for LPS transport across the periplasm
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 181

 Score = 74.6 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 55/179 (30%), Gaps = 17/179 (9%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
             N I   + +  L+     +   Q       +        I I AD  E +       F
Sbjct: 1   MTNKILKSLIIPTLILAFNSSAAEQNTQPAANQ--------ISISADKQEGQLKANVGIF 52

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIASNGY 120
           + NV +   +  + AD++ +   +   D                       ++  A    
Sbjct: 53  EKNVEIIHGNRRITADRLEVHKRDELGDNKQLLIATGSPAHFEEKQSDGTTMSASADEVR 112

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY 177
            D  KR L L G+      + +         +  +I+    S +  E+  D+V +I+  
Sbjct: 113 YDVSKRFLTLVGNAQ----VSQAGQKINAKSITYDIEQQLISAEKDENSTDRVHTILVP 167


>gi|300692615|ref|YP_003753610.1| hypothetical protein RPSI07_2996 [Ralstonia solanacearum PSI07]
 gi|299079675|emb|CBJ52352.1| conserved exported protein of unknown function, putative OstA-like
           protein [Ralstonia solanacearum PSI07]
          Length = 198

 Score = 74.6 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 52/153 (33%), Gaps = 13/153 (8%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++ + ++AD     D  Q     GNV +T+    L++D   +  +    + +  I 
Sbjct: 29  RADRDKPLVLEADNASYDDLKQVYHLSGNVVLTKGTMVLRSDTADLRTDPEGYNYAVAIA 88

Query: 98  RM----DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL-KEKLNTFLGCKL 152
           +      + +        I         D ++ I  L      + +    +L+   G  +
Sbjct: 89  KPGNLAFIRQKRDNVDEYIQGWGERIEYDGKQEISKLINRARMERLQGATQLDEIRGAVI 148

Query: 153 IVNIDTSFASLQGC--------ESDQVQSIIRY 177
             +    F +  G          S +V++++  
Sbjct: 149 TYDGQKEFYTASGGAENATAANPSGRVRAVLAP 181


>gi|224373217|ref|YP_002607589.1| cell envelope biogenesis protein YhbN [Nautilia profundicola AmH]
 gi|223589701|gb|ACM93437.1| cell envelope biogenesis protein YhbN [Nautilia profundicola AmH]
          Length = 152

 Score = 74.6 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 54/136 (39%), Gaps = 2/136 (1%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             E++ + +       A +++ FKG+V  T+   ++ AD+M I ++   + +        
Sbjct: 16  NAEELKVTSKYFHYDMAKKESIFKGDVNATKGKDNILADEMIIFFDKNKKPLKFIATGNV 75

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
                  ++      +           ++L G+     +   +  +  G K+I+N  T  
Sbjct: 76  RFVISLDKNATYKGRSDILVYQLHNGNIILKGNAKIVKLETNE--SVKGNKIILNRFTKN 133

Query: 161 ASLQGCESDQVQSIIR 176
           A + G E   V+ II+
Sbjct: 134 AEVTGGEKKPVEIIIK 149


>gi|206889363|ref|YP_002248080.1| hypothetical protein THEYE_A0231 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741301|gb|ACI20358.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 160

 Score = 74.6 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 13  HLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQE 72
            +  L+F+L    +       M        + I I +  L      + A F+G+V   + 
Sbjct: 8   LIAILIFLLFINPVLAEEKKEMP-------QPIIITSKTLINDSKAKTATFEGDVVAKRG 60

Query: 73  DFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK-RILVLN 131
           + +L A KM + Y +        I  ++   N+ +  G+  + +       +    ++  
Sbjct: 61  EVTLYAAKMIVYYEDE--QKGGNIKMIEAIGNVKLVKGDRVITSHKATYYPEPEERVIFT 118

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
           G+        E  N   G K+   +    + ++  +
Sbjct: 119 GEPRA----TEGKNLVTGEKITYFMKDDRSLVEKSK 150


>gi|87120460|ref|ZP_01076354.1| hypothetical protein MED121_21922 [Marinomonas sp. MED121]
 gi|86164103|gb|EAQ65374.1| hypothetical protein MED121_21922 [Marinomonas sp. MED121]
          Length = 183

 Score = 74.6 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 64/189 (33%), Gaps = 30/189 (15%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N I   +  L LV   L A++SQ              + I I+AD   + +    A + 
Sbjct: 1   MNKI---VRTLFLVCSTLGANISQ-------ALPEDSLQAIEIEADSAFIDNDKGSAIYI 50

Query: 65  GNVFMTQEDFSLQADKMTIDYNN------TNRDVSNKINRMDVERNIFIQSGEINVIASN 118
           GNV + Q    + A+K+TI  +N                  +  + +      I    + 
Sbjct: 51  GNVKVNQGTILISANKLTITSSNETNKYDKIYAKGTDTQVANFSQQLTASGDMIISRGNR 110

Query: 119 GYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL----------QGCES 168
            + D  + IL + G+      +K   +  +   +  ++ T               +  + 
Sbjct: 111 IFYDSSQSILEVEGESY----IKRGEDEIMAHFIRYDMTTGTFEARNKSKGSSEIKQNKK 166

Query: 169 DQVQSIIRY 177
            +V   ++ 
Sbjct: 167 GRVSMTLQP 175


>gi|134096262|ref|YP_001101337.1| ABC transporter periplasmic substrate-binding protein
           [Herminiimonas arsenicoxydans]
 gi|133740165|emb|CAL63216.1| Conserved hypothetical protein, putative organic solvent tolerance
           protein [Herminiimonas arsenicoxydans]
          Length = 185

 Score = 74.2 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/159 (15%), Positives = 54/159 (33%), Gaps = 15/159 (9%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
                K   ++  +++AD ++  D  Q   F GNV +T+    ++A+KM +  +      
Sbjct: 19  AAHAEKADASKPTNVEADQMQYDDVKQINTFIGNVVLTRGSILMKANKMVVTQDPAGYQF 78

Query: 93  SNKINRMDVERNIFI-----QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL--N 145
                      +            I+  A     D +  I+ L      +  L+     +
Sbjct: 79  VVMYAAPGTLASFRQKRDGGPDQWIDGQAERIEYDDKNEIMKLFSKARMR-RLENGKTTD 137

Query: 146 TFLGCKLIVNIDTSFASL----QGCES---DQVQSIIRY 177
              G  +  +    F ++     G       ++++II+ 
Sbjct: 138 EVNGEYISYDTRAEFFTVHNTASGDSKPGAGRIKAIIQP 176


>gi|304320835|ref|YP_003854478.1| hypothetical protein PB2503_06352 [Parvularcula bermudensis
           HTCC2503]
 gi|303299737|gb|ADM09336.1| hypothetical protein PB2503_06352 [Parvularcula bermudensis
           HTCC2503]
          Length = 159

 Score = 74.2 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 60/166 (36%), Gaps = 12/166 (7%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADML-EVKDAVQKAFFKGNVFMT 70
           +    +  + L A +S A    +          I + AD   EV D        G V + 
Sbjct: 1   MIAFYVSLLALGAAISAAQPVAVAPAADAP---IDLSADGACEVIDNGAIVRCSGGVRIV 57

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q    L +D+MT+       D     +R++   ++   +GE  +  + G        L +
Sbjct: 58  QGAAILASDRMTVY----GIDPDGGFDRIEAVGDVRYSNGENAISGARGTYSALSTELTV 113

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
            GD    V++ +      G +L+ N +T  +        +V+ +  
Sbjct: 114 TGD----VVVIQGDQVLTGGELVYNTETGASRFSPPPGGRVRGLFY 155


>gi|329905841|ref|ZP_08274229.1| Protein yhbN precursor [Oxalobacteraceae bacterium IMCC9480]
 gi|327547481|gb|EGF32297.1| Protein yhbN precursor [Oxalobacteraceae bacterium IMCC9480]
          Length = 184

 Score = 73.8 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 56/184 (30%), Gaps = 21/184 (11%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +  +     L+F       + A    +   K   N+   + A+ +   D  Q   F G+V
Sbjct: 1   MKPFFFAFLLMF-------NAAFVPAVHAEKADSNKPTVVDANQMAYDDVKQVNTFTGDV 53

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG-----EINVIASNGYVD 122
            + +    ++A ++ +  +      +          +   +        I   A     D
Sbjct: 54  VVVRGTLLMKAARVVVVQDPAGYQFATLYAAPGSLASFRQKRDGGENLWIEGEAERIEYD 113

Query: 123 FQKRILVLNGDRADKVIL-KEKLNTFLGCKLIVNIDTSFASL--------QGCESDQVQS 173
            +  ++ L      + +      +   G  +  +  T F S+              ++++
Sbjct: 114 GKTELVKLFSKAKMRRLNGTTPTDEVEGEFISYDSRTEFFSVNNTPAGQDSEAGGGRIKA 173

Query: 174 IIRY 177
            I+ 
Sbjct: 174 TIQP 177


>gi|291279433|ref|YP_003496268.1| hypothetical protein DEFDS_1042 [Deferribacter desulfuricans SSM1]
 gi|290754135|dbj|BAI80512.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 151

 Score = 73.8 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 58/135 (42%), Gaps = 9/135 (6%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I +  L      + + FKG+V    ++ ++++D M +  +N N+ V      +    N
Sbjct: 24  VQITSKELSYDVNKKLSIFKGDVNAFYDNTTIKSDLMYVYLDNDNKPVK-----IVCNGN 78

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + I    +  I++N   D +K +L L G+    V + +  N   G K++         ++
Sbjct: 79  VQIVKDNMTSISNNAIFDLKKDVLTLEGN----VKIWQDKNYLEGDKVVYFNKEKRVEVK 134

Query: 165 GCESDQVQSIIRYDG 179
              + +V+ I   + 
Sbjct: 135 NKNNQKVKIIFSPEK 149


>gi|222823664|ref|YP_002575238.1| OstA family protein [Campylobacter lari RM2100]
 gi|222538886|gb|ACM63987.1| OstA family protein [Campylobacter lari RM2100]
          Length = 152

 Score = 73.8 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 53/165 (32%), Gaps = 18/165 (10%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
              +  + +L     S               +KI + A    + +  + +   G+V + +
Sbjct: 3   FRAIIFLCLLNLFAFSA--------------QKIEVYAKDFYLDEKNETSVLSGDVEVKK 48

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            +  L + K+ I   N        I   D +  I ++    +        +  K I  +N
Sbjct: 49  GNDVLNSQKLVIYMKNKQP--IKYIATKDAKFKIMMKDKTYHGSGDEFIYNVAKDIYEIN 106

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR 176
           G+     +  +     +G K+IV+       +   +    + +  
Sbjct: 107 GNAKITEM--QTKKELIGDKIIVDRKNMTYRVVSKDKKPAKFVFE 149


>gi|119713541|gb|ABL97593.1| hypothetical protein MBMO_EB0-39F01.0004 [uncultured marine
           bacterium EB0_39F01]
          Length = 153

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 8/128 (6%)

Query: 25  DLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTID 84
             +Q A+  ++      N  + I A+ L +  +   A F+G  ++ Q    L ADK+ + 
Sbjct: 19  VFAQNASLSLSGANHDINLPVEITANNLSINQSSNSAIFEGTAYVGQGSLRLSADKIVVR 78

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
           YN      + K+  ++    +   +GE    A +        +L ++G+    V+L +  
Sbjct: 79  YNQD----TGKVTSVEATGKVVFTNGEDIAEAESAIYKIDSGLLSMSGN----VLLVQGK 130

Query: 145 NTFLGCKL 152
           +T  G  L
Sbjct: 131 STIGGNHL 138


>gi|154148051|ref|YP_001405908.1| OstA family protein [Campylobacter hominis ATCC BAA-381]
 gi|153804060|gb|ABS51067.1| OstA family protein [Campylobacter hominis ATCC BAA-381]
          Length = 157

 Score = 73.8 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 53/137 (38%), Gaps = 4/137 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDF-SLQADKMTIDYNNTNRDVSNKINRMDVER 103
           +++ AD     +    +   GNV + + D+ +L+ADK+TI ++     +       +   
Sbjct: 21  VNVTADNFFADENKLISILTGNVVLKKGDYDTLKADKLTIYFDKEKNPIKYVATG-NTSF 79

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N  ++    +        + +K I  L  +       KE      G K+IV+   +   +
Sbjct: 80  NAILKDKHYDGKGEILTYEPEKEIYTLEKNAYLHE--KETKKEVFGDKIIVDRAKTTYEV 137

Query: 164 QGCESDQVQSIIRYDGR 180
           +      ++ I   + +
Sbjct: 138 KSISKKPIKLIFEIEDK 154


>gi|88798181|ref|ZP_01113767.1| hypothetical protein MED297_13022 [Reinekea sp. MED297]
 gi|88778957|gb|EAR10146.1| hypothetical protein MED297_13022 [Reinekea sp. MED297]
          Length = 173

 Score = 73.4 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/156 (10%), Positives = 44/156 (28%), Gaps = 7/156 (4%)

Query: 18  VFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQ 77
           +  L    L+              +  I  KA    +     +    G+V +TQ   S+ 
Sbjct: 4   LKTLTVTLLAGLLTLQAAALPGDRDLAIRGKAHKTTLDGNSGQTTLTGSVVITQGALSIY 63

Query: 78  ADKMTIDYNNTNRDV---SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
           AD++    +   + +                      + +  +       +  ++  G  
Sbjct: 64  ADEVIFRRDPDTQRITYLKATGQPARFVDTPTENQPPVEMRGTQIEYFPDENTIITFGQA 123

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
                L++  N   G ++  N  +    ++     +
Sbjct: 124 E----LQQSDNQASGERIEYNTQSGVMVIESARLIR 155


>gi|57167675|ref|ZP_00366815.1| ostA family protein [Campylobacter coli RM2228]
 gi|57020797|gb|EAL57461.1| ostA family protein [Campylobacter coli RM2228]
          Length = 143

 Score = 73.4 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/136 (13%), Positives = 51/136 (37%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L A+K+ I  +   + +  +  + +    
Sbjct: 11  IEVKALNFYSDENKGESILSGNVEIIRGDDILTAEKVIIYTDKNRKPMRYEAVQ-NANFK 69

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K I  ++G+     +   +     G ++IV+   +   ++
Sbjct: 70  IVLKGKTYKGSGDKFIYNVAKDIYEIDGNAFINELESNQK--LYGDRIIVDKRNNVYRVE 127

Query: 165 GCESDQVQSIIRYDGR 180
             +    + I   + +
Sbjct: 128 SKDKKPARFIFDLEQK 143


>gi|218672973|ref|ZP_03522642.1| hypothetical protein RetlG_15785 [Rhizobium etli GR56]
          Length = 154

 Score = 73.4 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/140 (25%), Positives = 55/140 (39%), Gaps = 21/140 (15%)

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV-------------------- 101
            F GNV + Q   ++Q+ KMT+ Y +          +                       
Sbjct: 8   LFTGNVKVVQGTTTMQSGKMTVYYKDKAAKPGADGAQPAAQPEKSASLASGSADIDKILV 67

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              + + SG     A +G  D   +   L  D+ +KVIL +  N F GCKL V++ T  A
Sbjct: 68  TDKVLLTSGTQTATADDGNFDMASQTFTLTADQGNKVILSDGPNVFTGCKLTVHMQTGQA 127

Query: 162 SLQGCESDQVQSIIRYDGRP 181
            L+ C   +VQ  +    +P
Sbjct: 128 ELESC-GGRVQIQLDPKSQP 146


>gi|222109555|ref|YP_002551819.1| lipopolysaccharide transport periplasmic protein lpta [Acidovorax
           ebreus TPSY]
 gi|221728999|gb|ACM31819.1| lipopolysaccharide transport periplasmic protein LptA [Acidovorax
           ebreus TPSY]
          Length = 227

 Score = 73.4 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 51/162 (31%), Gaps = 20/162 (12%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   N+ ++I+AD L   +  Q + F G V MT+    L+  ++ +  +         
Sbjct: 36  AEKADRNKPMNIEADALRHDELKQTSVFTGRVVMTKGTIVLRGAQLEVRQDADGFQYGVV 95

Query: 92  ----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK-EKLNT 146
                     R   +         +         D +  ++ L      +   +    + 
Sbjct: 96  TAEPGKRAFFRQKRDTAPGAPDEFVEGEGEVIEYDGRADVVKLIRRAELRRYREATLTDE 155

Query: 147 FLGCKLIVNIDTSFASLQGCE-----------SDQVQSIIRY 177
             G  ++ N  T   ++ G +             +V++++  
Sbjct: 156 LAGALIVYNNLTDVFTVDGQKTAPAGATAGTPGGRVRAVLAP 197


>gi|145590089|ref|YP_001156686.1| OstA family protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048495|gb|ABP35122.1| OstA family protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 190

 Score = 73.4 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 59/192 (30%), Gaps = 19/192 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M +    +H       LV +     L+          K   ++ I ++A+ + V D  Q 
Sbjct: 1   MLSMFEPLHFSKSACLLVLLAAFTGLA-------KAEKADQDKPIILEAEKVSVNDVQQS 53

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNR-----DVSNKINRMDVERNIFIQSGEINVI 115
               G V + +    +  +   I  +           ++       +R        +   
Sbjct: 54  YDLNGQVLLIKGSMIVTGEDGHIQVDPEGYEFVEVKGTSDTVASFRQRREGPADEFMQGR 113

Query: 116 ASNGYVDFQKRILVLNGDRADKVILK-EKLNTFLGCKLIVNIDTSFASLQGCESDQ---- 170
            +    + +   L + GD + +  L  + L+   G K+  +  T    +      +    
Sbjct: 114 GTQVTYNAKTEQLTITGDASLRRSLNMQMLDQLQGTKIEYDDITERYRVTPPADAKPEDL 173

Query: 171 --VQSIIRYDGR 180
              ++I+    +
Sbjct: 174 PLARAILSPRRK 185


>gi|305433182|ref|ZP_07402338.1| OstA family protein [Campylobacter coli JV20]
 gi|304443883|gb|EFM36540.1| OstA family protein [Campylobacter coli JV20]
          Length = 152

 Score = 73.4 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/167 (12%), Positives = 58/167 (34%), Gaps = 19/167 (11%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           ++  +  +  +  SQ                I +KA      +   ++   GNV + + D
Sbjct: 5   IILFLMSISISLASQ----------------IEVKALNFYSDENKGESILSGNVEIIRGD 48

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
             L A+K+ I  +   + +  +  + +    I ++             +  K I  ++G+
Sbjct: 49  DILTAEKVIIYTDKNRKPMRYEAVQ-NANFKIVLKGKTYKGSGDKFIYNVAKDIYEIDGN 107

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
                +   +     G ++IV+   +   ++  +    + I   + +
Sbjct: 108 AFINELESNQK--LYGDRIIVDKRNNVYRVESKDKKPARFIFDLEQK 152


>gi|315926767|gb|EFV06141.1| ostA-like family protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315928940|gb|EFV08194.1| ostA-like family protein [Campylobacter jejuni subsp. jejuni 305]
 gi|315931847|gb|EFV10802.1| ostA-like family protein [Campylobacter jejuni subsp. jejuni 327]
          Length = 145

 Score = 73.0 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 45/136 (33%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   +         +    
Sbjct: 13  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKP-IRYEAMQNARFK 71

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 72  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 129

Query: 165 GCESDQVQSIIRYDGR 180
             +    + +     +
Sbjct: 130 SKDQKPARFVFDLKDK 145


>gi|322379278|ref|ZP_08053664.1| hypothetical protein HSUHS1_0903 [Helicobacter suis HS1]
 gi|322379850|ref|ZP_08054138.1| hypothetical protein HSUHS5_0205 [Helicobacter suis HS5]
 gi|321147728|gb|EFX42340.1| hypothetical protein HSUHS5_0205 [Helicobacter suis HS5]
 gi|321148315|gb|EFX42829.1| hypothetical protein HSUHS1_0903 [Helicobacter suis HS1]
          Length = 175

 Score = 73.0 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 60/172 (34%), Gaps = 20/172 (11%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
            L  +  YI L+ LV  L                     E + + AD     D  +    
Sbjct: 1   MLKRLLCYILLVGLVSALPI------------------KETLEVTADKFLANDLKKITII 42

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           +G+V + +   +L A+K+ I  N   +    +               E+   +     + 
Sbjct: 43  EGHVHIKKGKDTLIANKVIIYTNEKRQPTRYEAFGDVKFHLFTQDGREVEGHSDRLIYNA 102

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
            K+   L  +     I K  +N+  G ++I++ +  +A++ G +    + + 
Sbjct: 103 LKQEYRLLQNAVVNEIGK--VNSVKGEEIILSKEHGYANVLGGKDKPARFVF 152


>gi|268679306|ref|YP_003303737.1| OstA family protein [Sulfurospirillum deleyianum DSM 6946]
 gi|268617337|gb|ACZ11702.1| OstA family protein [Sulfurospirillum deleyianum DSM 6946]
          Length = 154

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 55/136 (40%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           + I AD     +  + + F+GNV +T+E   + A K+ +++++  +     I   D + N
Sbjct: 20  VEIVADKFFADEKKKISVFEGNVKVTKESDKITAKKIIVEFDDKKQP-IRYIATGDAKAN 78

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           + +   +    A     + QK +  L        I  ++     G  + VN  T    + 
Sbjct: 79  LIMNQKKYYGEAEKMTYEPQKSLYTLEKKAFLHEIDTDRK--VYGDFVRVNQATGHYEVD 136

Query: 165 GCESDQVQSIIRYDGR 180
              S  V+ I + + +
Sbjct: 137 SKNSAPVKFIFKVEDQ 152


>gi|304569749|ref|YP_003858612.1| hypothetical protein DVU4008 [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 175

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/161 (16%), Positives = 57/161 (35%), Gaps = 14/161 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
             A    T      +    + A  ++     Q   F+G+V++ + DF L + K+T+    
Sbjct: 4   ACAQPKATANPAQKSVPTTVTAQRMQYDANKQSVVFEGDVYVKRPDFELWSVKLTLHLGK 63

Query: 88  TNRDVS----------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           +    S           +I R+  E+N+ +     N             ++++ G     
Sbjct: 64  SKEGKSGGDVPGGMDAGEIERIVAEKNVRMVREGRNGTCQKATYTTNDGLMIMEGSP--- 120

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            +L +K N   G  +      + + + G  S  V+++    
Sbjct: 121 -VLFDKENVVKGEVIYFYTRENRSEVHGGTSRPVEAVFTSS 160


>gi|86149888|ref|ZP_01068117.1| OstA family protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151578|ref|ZP_01069792.1| OstA family protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|88596952|ref|ZP_01100188.1| OstA family protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613362|ref|YP_001000350.1| OstA family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|157414928|ref|YP_001482184.1| OstA family protein [Campylobacter jejuni subsp. jejuni 81116]
 gi|167005295|ref|ZP_02271053.1| hypothetical protein Cjejjejuni_03430 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|218562299|ref|YP_002344078.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|85839706|gb|EAQ56966.1| OstA family protein [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841207|gb|EAQ58455.1| OstA family protein [Campylobacter jejuni subsp. jejuni 260.94]
 gi|87250491|gb|EAQ73449.1| OstA family protein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88190641|gb|EAQ94614.1| OstA family protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360005|emb|CAL34794.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|157385892|gb|ABV52207.1| hypothetical protein C8J_0608 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|284925909|gb|ADC28261.1| OstA family protein [Campylobacter jejuni subsp. jejuni IA3902]
 gi|307747566|gb|ADN90836.1| OstA family protein [Campylobacter jejuni subsp. jejuni M1]
          Length = 153

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 45/136 (33%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   +         +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKP-IRYEAMQNARFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSIIRYDGR 180
             +    + +     +
Sbjct: 138 SKDQKPARFVFDLKDK 153


>gi|121607571|ref|YP_995378.1| OstA family protein [Verminephrobacter eiseniae EF01-2]
 gi|121552211|gb|ABM56360.1| OstA family protein [Verminephrobacter eiseniae EF01-2]
          Length = 217

 Score = 73.0 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 59/173 (34%), Gaps = 29/173 (16%)

Query: 29  AAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
            ++  +   K    + ++I+AD L   +  + + F G+V +TQ    L+  ++ +  +  
Sbjct: 16  GSSGRVHAEKADRTQPMNIEADALRHDEPTRTSVFSGHVVLTQGSIVLRGARLEMRQDAD 75

Query: 89  NRD--------VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK--- 137
                            R   +R +      I   +     D +   + L+     +   
Sbjct: 76  GHQHGLVTAEAGKRAFFRQKRDRPVGAPEEFIEGESERIEYDGKADTVRLSTRAELRRYR 135

Query: 138 -VILKEKLNTFLGCKLIVNIDTSFASLQGCES--------------DQVQSII 175
             +L ++     G  ++ +  T   ++ G  S               +V++++
Sbjct: 136 AALLSDQ---ITGAVIVYSHLTEVFTVDGQPSAPAGNAAEAAPAPAGRVRAVL 185


>gi|57236962|ref|YP_178763.1| OstA family protein [Campylobacter jejuni RM1221]
 gi|148926633|ref|ZP_01810314.1| hypothetical protein Cj8486_0661 [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|205355499|ref|ZP_03222270.1| hypothetical protein Cj8421_0651 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|57165766|gb|AAW34545.1| OstA family protein [Campylobacter jejuni RM1221]
 gi|145845152|gb|EDK22247.1| hypothetical protein Cj8486_0661 [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|205346733|gb|EDZ33365.1| hypothetical protein Cj8421_0651 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|315058063|gb|ADT72392.1| OstA family organic solvent tolerance protein [Campylobacter jejuni
           subsp. jejuni S3]
          Length = 153

 Score = 72.7 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 45/136 (33%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   +         +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKP-IRYEAMQNARFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSIIRYDGR 180
             +    + +     +
Sbjct: 138 SKDQKPARFVFDLKDK 153


>gi|307721066|ref|YP_003892206.1| lipopolysaccharide transport periplasmic protein LptA [Sulfurimonas
           autotrophica DSM 16294]
 gi|306979159|gb|ADN09194.1| lipopolysaccharide transport periplasmic protein LptA [Sulfurimonas
           autotrophica DSM 16294]
          Length = 157

 Score = 72.7 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 49/138 (35%), Gaps = 2/138 (1%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           ++++ IKAD  +       + F G+V + + +  L A K+T+  +  N+           
Sbjct: 17  SQELKIKADEFKGDQNKGISIFTGHVRIKKVNDELNASKVTVYTDKKNKPTKFVAVGDTS 76

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
            +    Q      +A        K+     G+   K +  +      G ++I+      A
Sbjct: 77  FKIQTEQGAHYRGVAQKVIYLPLKKEYHFFGNVHLKQL--DDKKEIFGDEVILQAIDGKA 134

Query: 162 SLQGCESDQVQSIIRYDG 179
             +G E + V  I     
Sbjct: 135 YAKGVEKEPVIMIFDIKD 152


>gi|218779213|ref|YP_002430531.1| OstA family protein [Desulfatibacillum alkenivorans AK-01]
 gi|218760597|gb|ACL03063.1| OstA family protein [Desulfatibacillum alkenivorans AK-01]
          Length = 202

 Score = 72.7 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 39/191 (20%), Positives = 60/191 (31%), Gaps = 21/191 (10%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADL-----SQAAASYMTRFKVLGNEKIHIKADMLEVKD 56
              L SI     L     V     L     +Q           L    I IKA  L    
Sbjct: 7   KRLLPSIIKIFLLTVFACVCSLGPLWADNTAQTPDQAALAGFDLSKGPIKIKAQKLVTNQ 66

Query: 57  AVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD--------VSNKINRMDVERNIFIQ 108
              KA+F  +V  TQ   +++A+++TI Y               S  + ++    N+ I 
Sbjct: 67  EENKAWFSMDVVATQGKTTIKANELTIWYVGEKEQNDVQSGLPASQSLKKIQALGNVEIV 126

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
           +      +       +   LVL G  A  V      NT  G  +I        + +G   
Sbjct: 127 NEAFTSHSDEALYLQKTGDLVLTGGPAKVV---SGKNTVSGE-IITRSKDGLLTFEGG-- 180

Query: 169 DQVQSIIRYDG 179
             VQ+    + 
Sbjct: 181 --VQAEFFPEK 189


>gi|86153470|ref|ZP_01071674.1| OstA family protein [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|85843196|gb|EAQ60407.1| OstA family protein [Campylobacter jejuni subsp. jejuni HB93-13]
          Length = 153

 Score = 72.7 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 45/136 (33%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   +         +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKP-IRYEAMQNASFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSIIRYDGR 180
             +    + +     +
Sbjct: 138 SKDQKPARFVFDLKDK 153


>gi|224369875|ref|YP_002604039.1| putative organic solvent tolerance protein OstA precursor
           [Desulfobacterium autotrophicum HRM2]
 gi|223692592|gb|ACN15875.1| putative organic solvent tolerance protein OstA precursor
           [Desulfobacterium autotrophicum HRM2]
          Length = 177

 Score = 72.7 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/170 (15%), Positives = 58/170 (34%), Gaps = 9/170 (5%)

Query: 17  LVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSL 76
           L+F+++ A +   +         L +  +HI AD +  +       F GN   T +D  +
Sbjct: 4   LIFLMVWAVILSPSLISAQTADNLQDRSLHITADAMTSERDSSFVAFTGNAVATSQDDVI 63

Query: 77  QADKMTID------YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
            AD + I           ++     I  +    N+   S +    A          +L L
Sbjct: 64  HADAIKIFIYTEDERKKLSKTDEQNIKEIIATGNVTFTSQDQKAFADKAVYTTSTLVLTL 123

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            GD      +    +   G K+ +        ++  +  +V+++     +
Sbjct: 124 TGDAPR---VITGESFVTGKKITLFRSNGKVVVESGKDQRVEALFNPADK 170


>gi|283956063|ref|ZP_06373550.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792383|gb|EFC31165.1| putative OstA family protein [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 145

 Score = 72.3 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 45/136 (33%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   +         +    
Sbjct: 13  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKP-IRYEAMQNATFK 71

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 72  IVLKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 129

Query: 165 GCESDQVQSIIRYDGR 180
             +    + +     +
Sbjct: 130 SKDQKPARFVFDLKDK 145


>gi|209521316|ref|ZP_03270033.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. H160]
 gi|209498262|gb|EDZ98400.1| lipopolysaccharide transport periplasmic protein LptA [Burkholderia
           sp. H160]
          Length = 177

 Score = 72.3 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/137 (14%), Positives = 50/137 (36%), Gaps = 6/137 (4%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             +   ++ ++I+AD +   D  Q + F G+V  T+    ++AD++ +  +         
Sbjct: 41  ADRADKDKPLNIEADNMTYDDLRQVSIFTGHVVATKGTILIKADRVEVSQDPQGYQFATG 100

Query: 92  VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI--LKEKLNTFLG 149
            S+  N     +        I   A     D ++ +  L  +   + +  +   L+   G
Sbjct: 101 TSSGNNLSYFRQKREGLDEYIEGTAIRIDYDGKQDLTTLTTNATVRRLQSMTTLLDQVHG 160

Query: 150 CKLIVNIDTSFASLQGC 166
             +  +    F + +  
Sbjct: 161 SVITYDGQNDFYTAKAG 177


>gi|153951767|ref|YP_001398393.1| OstA family protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939213|gb|ABS43954.1| OstA family protein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 153

 Score = 72.3 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 45/131 (34%), Gaps = 3/131 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +  ++         +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNHKP-IRYEAMQNASFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    +NG      +   +     G K+IV+   +   ++
Sbjct: 80  IILKGKTYKGSGDKFIYNVIKDTYEINGHAYINELGSNQK--LFGDKIIVDRKANIYRVE 137

Query: 165 GCESDQVQSII 175
             +    + + 
Sbjct: 138 SKDQKPARFVF 148


>gi|160871559|ref|ZP_02061691.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159120358|gb|EDP45696.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 173

 Score = 72.3 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 55/175 (31%), Gaps = 18/175 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +   +L    L++VF L     + +                + ++D +   +  ++  ++
Sbjct: 11  IKKAYLLFVNLSIVFCLSTVACAHSNDLA------------YFESDSVTYNNKTKQGIYR 58

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN--IFIQSGEINVIASNGYVD 122
           G++ +TQ    L AD  T  ++   +                IF    ++       Y  
Sbjct: 59  GHIKLTQGSAVLTADYATSYFDQNGQINKIIAIGNPARYQAFIFPHRPQLIATGKTIYYY 118

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
            +K  L   G+      + +  N F G ++  +  T             Q  I  
Sbjct: 119 PKKEYLEAIGNAE----MVQGKNHFKGYQINYDFKTKTIGSPLSPKGHTQITIAP 169


>gi|237753229|ref|ZP_04583709.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375496|gb|EEO25587.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 153

 Score = 71.9 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 50/137 (36%), Gaps = 2/137 (1%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           ++I + A      +  +    KGNV + +    L A++  +  ++ NR    +       
Sbjct: 17  DEIEVSAQEFIGDEKKKLTHLKGNVEIKRASDRLIANEAFVYLDSNNRPNKMQAIGNVRF 76

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
                   EI   ++        +   + G+   + I K+  N   G K+IV     + +
Sbjct: 77  WFALKDGREIEGESNEALYFPNTQEYQILGNAIVREIGKQ--NIVRGDKIIVRQKVGYIN 134

Query: 163 LQGCESDQVQSIIRYDG 179
           + G +    + I + D 
Sbjct: 135 VIGNDKKPARLIFKLDK 151


>gi|77361464|ref|YP_341039.1| ABC transporter periplasmic substrate-binding protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76876375|emb|CAI87597.1| conserved protein of unknown function ; putative transport protein
           (ABC superfamily, periplasmic binding component)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 181

 Score = 71.9 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 60/171 (35%), Gaps = 16/171 (9%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           I ++  + ++  ++ ++ + S +          I I AD  E +       F+ NV +  
Sbjct: 8   ILIIPSLILVFNSNAAEQSTSPLANQ-------ISISADRQEGQLKENVGIFEKNVEIIH 60

Query: 72  EDFSLQADKMTIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
            +  + AD++ +   +   D                       ++  A+    D  KR L
Sbjct: 61  GNRRITADRLEVHKRDELGDNKQLLIATGSPAYFEEKQADGTVMSASANEVRYDVAKRFL 120

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSIIRY 177
            L GD      + +         +  +I+    S +  E+  D+V +I+  
Sbjct: 121 TLVGDAN----ISQAGQKITAKSITYDIEQQLISAEKDENSTDRVHTILVP 167


>gi|149199440|ref|ZP_01876476.1| hypothetical protein LNTAR_07829 [Lentisphaera araneosa HTCC2155]
 gi|149137518|gb|EDM25935.1| hypothetical protein LNTAR_07829 [Lentisphaera araneosa HTCC2155]
          Length = 222

 Score = 71.9 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            + I+++          A FK NV +   DF L+ D+M + Y+   +     I ++    
Sbjct: 87  PLRIQSESSSYNSKKGLAIFKRNVVVEDGDFYLECDEMHVFYSKATKTTKGGIEKIVAID 146

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADK-VILKEKLNTFLGCKLIVNIDT---- 158
           N+ I+       A+      + + + L G   +K V++ E          I++ +T    
Sbjct: 147 NVKIRQSPNTATATKAVYLLKDQTITLTGTEKEKPVLISEDGQRMKSDFFIIHRETETIE 206

Query: 159 -SFASLQGCES 168
               +++  ES
Sbjct: 207 SGQVTIESDES 217


>gi|88861162|ref|ZP_01135796.1| hypothetical protein PTD2_17237 [Pseudoalteromonas tunicata D2]
 gi|88816884|gb|EAR26705.1| hypothetical protein PTD2_17237 [Pseudoalteromonas tunicata D2]
          Length = 166

 Score = 71.5 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/164 (14%), Positives = 54/164 (32%), Gaps = 10/164 (6%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
               L+  + S+ +      ++ + I AD  + +       F+ NV +T     ++AD +
Sbjct: 5   PILILALLSMSFFSSANNEKSQ-VLIDADKQQAELKRNVVIFEKNVEVTHGKRIIKADFL 63

Query: 82  TIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKV 138
                    +                       I   A     D    IL ++G+ +   
Sbjct: 64  EAYRRAELGENKELLIARGHPARYSETLPDGNVITASADEISYDVASAILTISGNAS--- 120

Query: 139 ILKEKLNTFLGCKLIVNIDTSFASLQGCE--SDQVQSIIRYDGR 180
            + +         +I +I+    S +  E  + +V++I+    +
Sbjct: 121 -ITQSGQKISAENIIYDINQQLISAEKAENSNQRVRTILTAPEK 163


>gi|94986898|ref|YP_594831.1| hypothetical protein LI0455 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731147|emb|CAJ54509.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 189

 Score = 71.5 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 65/182 (35%), Gaps = 19/182 (10%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++  + L+  L+         +   +   LG  +  I +D L      Q+  F  NV + 
Sbjct: 5   FVSQVLLLIGLIYTYNQPTLYAQPIKKGSLGTVETKIFSDELTYDLEKQQITFNKNVHVQ 64

Query: 71  QEDFSLQADKMTIDYNNTNRDVS---------------NKINRMDVERNIFIQSGEINVI 115
           + DF L  D +TI      +                   ++  +  +RN+ I+  +    
Sbjct: 65  RPDFQLTTDTLTIYLAPQKKSQKNEDLSTNPISSKISAGELKHIVAKRNVCIKGDKYTGT 124

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSII 175
           A       +  IL+L     D  +L +  NT  G  +   I  + + +   ++ +V++  
Sbjct: 125 AGKVTYTEKTGILLLE----DSPVLTDGENTITGDSIRYYIYENRSEVIRGKNKRVEATF 180

Query: 176 RY 177
             
Sbjct: 181 MQ 182


>gi|192360382|ref|YP_001983262.1| OstA-like protein superfamily [Cellvibrio japonicus Ueda107]
 gi|190686547|gb|ACE84225.1| OstA-like protein superfamily [Cellvibrio japonicus Ueda107]
          Length = 176

 Score = 71.5 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 40/140 (28%), Gaps = 6/140 (4%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
             N+ I   AD L V   + ++ + G+V + Q    + AD + +                
Sbjct: 35  DRNQVIRGTADTLVVDQKIGESTYSGSVRIEQGSLVITADIIKVRTRPDGSPDKIVATGS 94

Query: 100 DVERNIFI--QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
                         I   A +         L+L  + A    +++         +  ++ 
Sbjct: 95  PARFQQQPSLDQKVIVATAKSITYTPDNEHLLLVEEAA----IEQDGQVMKAPHINYDLI 150

Query: 158 TSFASLQGCESDQVQSIIRY 177
                 +  +  +V   I  
Sbjct: 151 NEVMKAKQIDGARVDIYIPP 170


>gi|326325998|ref|YP_004250807.1| putative Lipopolysaccharide-assembly, LptA [Vibrio
           nigripulchritudo]
 gi|323669049|emb|CBJ93091.1| Putative Lipopolysaccharide-assembly, LptA [Vibrio
           nigripulchritudo]
          Length = 165

 Score = 71.1 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/176 (10%), Positives = 52/176 (29%), Gaps = 15/176 (8%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +++    +  + +L +  L+               +   I + +        K    G+V
Sbjct: 1   MNVPFFTILALLLLPRVALA---------LDSDRYQPAKISSMLQSYDLKGSKMNLSGDV 51

Query: 68  FMTQEDFSLQADKMTIDY--NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQK 125
            + Q    + ADK+TI    +                  +      +   + +     + 
Sbjct: 52  SIQQGTIKISADKVTIFKHPDTGKILRIVAHGSPATFSQLMESGETMYGESRHFEYRAET 111

Query: 126 RILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-CESDQVQSIIRYDGR 180
             L++      K+    + N      +  N  +     +G  + D+  +++    +
Sbjct: 112 ADLIMTDQAKLKL---GEKNRIKANYISYNQVSQKLLAKGMKKGDRTSTVLYPTKK 164


>gi|283954069|ref|ZP_06371594.1| hypothetical protein C414_000080057 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794348|gb|EFC33092.1| hypothetical protein C414_000080057 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 153

 Score = 71.1 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 45/136 (33%), Gaps = 3/136 (2%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           I +KA      +   ++   GNV + + D  L ++K+ I  +   +         +    
Sbjct: 21  IEVKALNFYSDENKGESILSGNVEVIRGDDILNSEKLIIYTDKNRKP-IRYEAMQNARFK 79

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
           I ++             +  K    ++G      +   +     G K+IV+   +   +Q
Sbjct: 80  IVLKGKTYKGSGDKFIYNVVKDTYEIDGHAYINELGSNQK--LFGDKIIVDRKANIYQVQ 137

Query: 165 GCESDQVQSIIRYDGR 180
             +    + +     +
Sbjct: 138 SKDQKPTRFVFDLKDK 153


>gi|221134720|ref|ZP_03561023.1| OstA-like protein [Glaciecola sp. HTCC2999]
          Length = 184

 Score = 71.1 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 52/166 (31%), Gaps = 7/166 (4%)

Query: 16  ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFS 75
            ++   L       A S         N  I I A    V    + + +K +V + Q   +
Sbjct: 9   LIILSALMLSSGLQAKSDKPSLNQDINAPIAISAKSTFVDGVSKMSVYKDDVVVVQAGLT 68

Query: 76  LQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEI-NVIASNGYVDFQKRILVLNGDR 134
           + A +++ID +               +    ++ G     +A+        R +   GD 
Sbjct: 69  INAARLSIDASAGEGQEVFIATGEPAQFTQSLEDGSRVTALANEIRYSVVTRTVSFIGDA 128

Query: 135 ADKVILKEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
                L +  +      +  ++      A     E  +V ++ + +
Sbjct: 129 Q----LAQDTSVVKSESIEFDLINKQLVAKANNAEGGRVTTVFQPE 170


>gi|269469200|gb|EEZ80736.1| hypothetical protein Sup05_0142 [uncultured SUP05 cluster
           bacterium]
          Length = 163

 Score = 71.1 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 57/179 (31%), Gaps = 24/179 (13%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
           F+N ++L    L +                +        + I +KA  + + +    + +
Sbjct: 2   FMNKLYLMSLCLII--------------GNVFALPEDKGKPIEVKAYTVVIDELNGLSTY 47

Query: 64  KGNVFMTQEDFSLQADKMTIDYNN----TNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
            G   + Q    L A+K+ +  N            K      ++N   Q   +   A N 
Sbjct: 48  TGKAQVKQGSLMLDAEKIELFSNQTEVTKVIAKGTKNKLAHYKQNQPNQPRFVEATAMNI 107

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESD--QVQSIIR 176
                K  + L G  +      +  ++F G  L  +I       +  +    +V+  IR
Sbjct: 108 TYLISKEFVHLKGKAS----FVQGFDSFSGGTLDYDIKNDKVIAKKSKDGAQRVKFKIR 162


>gi|313682552|ref|YP_004060290.1| lipopolysaccharide transport periplasmic protein lpta
           [Sulfuricurvum kujiense DSM 16994]
 gi|313155412|gb|ADR34090.1| lipopolysaccharide transport periplasmic protein LptA
           [Sulfuricurvum kujiense DSM 16994]
          Length = 163

 Score = 70.7 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 44/133 (33%), Gaps = 2/133 (1%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           E++ + +D  +       + F G+V +T+    L A K+TI  +   + V          
Sbjct: 19  EELKVVSDNFKGDQQKGISVFTGDVKLTKGSDELNASKVTIFTDKDKKPVKYVAEGDVSF 78

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             +          +        +     +  +   +I  +      G K+IVN     AS
Sbjct: 79  YIVTEMKERYKGKSQVAIYFPNENEYHFS--KKVDLIRIDDYRRVKGDKVIVNTVYGQAS 136

Query: 163 LQGCESDQVQSII 175
            +   ++ V    
Sbjct: 137 AESANNEPVVMTF 149


>gi|315125505|ref|YP_004067508.1| ABC transporter periplasmic substrate-binding protein
           [Pseudoalteromonas sp. SM9913]
 gi|315014018|gb|ADT67356.1| ABC transporter periplasmic substrate-binding protein
           [Pseudoalteromonas sp. SM9913]
          Length = 179

 Score = 70.7 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 58/182 (31%), Gaps = 20/182 (10%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M+  L  I ++              ++  +           N+ I I AD  E +     
Sbjct: 1   MTNNLFKILIF----------PSLLIAFNSNGAEPAEAPAANQ-ISISADKQEGQLKENV 49

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSN---KINRMDVERNIFIQSGEINVIAS 117
             F+ NV +   +  + AD++ +   +   D                       ++  A+
Sbjct: 50  GIFEKNVEIIHGNRRITADRLEVHKRDELGDNKQLLIATGSPAYFEETQADGTIMSASAN 109

Query: 118 NGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES--DQVQSII 175
               D   R L L GD +    + +         +  +I+    S +  E+  D+V +I+
Sbjct: 110 EVRYDVSLRFLTLIGDAS----IAQAGQQITAKSITYDIEQQLISAEKDENSTDRVHTIL 165

Query: 176 RY 177
             
Sbjct: 166 VP 167


>gi|315453175|ref|YP_004073445.1| hypothetical protein HFELIS_07710 [Helicobacter felis ATCC 49179]
 gi|315132227|emb|CBY82855.1| putative hypothetical protein [Helicobacter felis ATCC 49179]
          Length = 171

 Score = 70.7 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 22/138 (15%), Positives = 55/138 (39%), Gaps = 2/138 (1%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
            E + + AD     +  +    +GNV + +   +L A+K+ I  N   + +  +      
Sbjct: 11  KETLEVSADKFTANEKKRITIIEGNVHIKKMQDTLTANKVIIYTNAKRKPIKYEAIGAVK 70

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
              +     ++N  +     D  K+   L  +     + K  +N+  G ++I++ +  +A
Sbjct: 71  FHIVTQDGRQVNGHSDRLIYDAIKQEYRLLQNAVVNEVGK--INSIKGEEIILSKERGYA 128

Query: 162 SLQGCESDQVQSIIRYDG 179
            + G ++   + +   D 
Sbjct: 129 DVFGGKNKPAKFVFDMDD 146


>gi|121592779|ref|YP_984675.1| OstA family protein [Acidovorax sp. JS42]
 gi|120604859|gb|ABM40599.1| OstA family protein [Acidovorax sp. JS42]
          Length = 227

 Score = 70.3 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 51/162 (31%), Gaps = 20/162 (12%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K   N+ ++I+AD L   +  Q + F G V MT+    L+  ++ +  +         
Sbjct: 36  AEKADRNKPMNIEADALRHDELKQTSVFTGRVVMTKGTIVLRGAQLEVRQDADGFQYGVV 95

Query: 92  ----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK-EKLNT 146
                     R   +         +         D +  ++ L      +   +    + 
Sbjct: 96  TAEPGKRAFFRQKRDTAPGAPDEFVEGEGEVIEYDGRADVVKLIRRAELRRYREATLTDE 155

Query: 147 FLGCKLIVNIDTSFASLQGCE-----------SDQVQSIIRY 177
             G  ++ N  T   ++ G +             +V++++  
Sbjct: 156 LAGALIVYNNLTDVFTVDGQKTAPGGATAGTPGGRVRAVLAP 197


>gi|213865401|ref|ZP_03387520.1| hypothetical protein SentesT_36938 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 112

 Score = 70.3 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 40/121 (33%), Gaps = 11/121 (9%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           M    N + L + L + +        +              ++ IHI++D   +      
Sbjct: 1   MKFKTNKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNV 51

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASN 118
             F GNV +TQ    + ADK+ +        ++V +   +      +      +   AS 
Sbjct: 52  VTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQ 111

Query: 119 G 119
            
Sbjct: 112 M 112


>gi|24375446|ref|NP_719489.1| hypothetical protein SO_3959 [Shewanella oneidensis MR-1]
 gi|24350294|gb|AAN56933.1|AE015827_5 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 183

 Score = 70.3 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 47/160 (29%), Gaps = 5/160 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           +L A L    +           +++ IKA          +  F G V + Q    + AD+
Sbjct: 6   ILLASLMLMTSMSTFAKVGDLQQEVKIKAVSQTADIKNNQIIFFGPVEVVQGSIKINADQ 65

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           +                      +  +  G     ++    + +  +            L
Sbjct: 66  LRAFSAEGENSKILVATGNPATYSQILDDGRPASASAK---EIRYEMATRTLTLTGTATL 122

Query: 141 KEKLNTFLGCKLIVNIDTSF--ASLQGCESDQVQSIIRYD 178
            +  +   G  +  NI      A   G   D+V +II+ D
Sbjct: 123 DQAGSQVTGNLIRYNIIQQKLIAESTGNGDDRVITIIQPD 162


>gi|170743376|ref|YP_001772031.1| OstA family protein [Methylobacterium sp. 4-46]
 gi|168197650|gb|ACA19597.1| OstA family protein [Methylobacterium sp. 4-46]
          Length = 285

 Score = 70.3 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 41/103 (39%), Gaps = 4/103 (3%)

Query: 78  ADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADK 137
           AD    +    +   S  I ++     + + + +      N   D     ++L G+    
Sbjct: 158 ADTRAAEAKPVDPTDSGAIRQVVCAGPVTVVNKDQVATGDNAVFDKAANRVILTGN---- 213

Query: 138 VILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
           V+L +  N   G +L+ +++T  A++      +V ++    G+
Sbjct: 214 VVLSQCQNVTRGNRLVYDMNTGRANMDPTAGGRVSAMFVPGGK 256



 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 32/94 (34%), Gaps = 1/94 (1%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
            S    F   G E I I AD L+V D   KA F GNV   Q + +++   MT+ Y     
Sbjct: 30  NSGFGAFGSSGKEPIKIDADRLDVFDHENKAVFAGNVVAVQGESTIRCSSMTVHYQRNRD 89

Query: 91  DV-SNKINRMDVERNIFIQSGEINVIASNGYVDF 123
               ++    + +      +              
Sbjct: 90  KGAKDEARAEEAKPAETKPAEAKPAETKLAETKP 123


>gi|221070009|ref|ZP_03546114.1| lipopolysaccharide transport periplasmic protein LptA [Comamonas
           testosteroni KF-1]
 gi|220715032|gb|EED70400.1| lipopolysaccharide transport periplasmic protein LptA [Comamonas
           testosteroni KF-1]
          Length = 226

 Score = 70.0 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 53/168 (31%), Gaps = 22/168 (13%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN-------- 87
             K    + ++I+AD L   +  Q + F GNV MT+    L+  ++ +  +         
Sbjct: 31  AEKADSAKPMNIEADALRHDELQQTSVFTGNVVMTKGSIVLRGAQLDVRQDAEGYQYGVI 90

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA-DKVILKEKLNT 146
                     R   +         I         D +  I+         +    +  + 
Sbjct: 91  KAEPGKRAFFRQKRDTLAGQPEEFIEGEGEVIEYDGKADIVKFIRRGEMRRYRGGQLSDQ 150

Query: 147 FLGCKLIVNIDTSFASLQG------------CESDQVQSIIRY-DGRP 181
             G  ++ N  T   ++ G             +  +V++I+   DG P
Sbjct: 151 VTGSIIVYNNITDVYTVDGQKTSGGLPSSSVGQGGRVRAIMAPKDGTP 198


>gi|146338573|ref|YP_001203621.1| hypothetical protein BRADO1494 [Bradyrhizobium sp. ORS278]
 gi|146191379|emb|CAL75384.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 161

 Score = 70.0 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 56/154 (36%), Gaps = 34/154 (22%)

Query: 57  AVQKAFFKGNVFMTQEDFSLQADKMTIDY---------------------NNTNRDVSNK 95
              +A F  NV + Q D ++++  + + Y                     +      + +
Sbjct: 4   KSNRATFSDNVKVVQGDTTMRSKSLEVLYASGQQRSPNANTAKSKRPLHSDQPGPSGNTE 63

Query: 96  INRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVN 155
           I R++    + +   +          D +  ++ + GD    V+L +  N   G +L+V+
Sbjct: 64  IKRLEAGGGVVVTRKDQTASGQRAVFDTKTNLISMLGD----VVLTQCGNVLRGDRLLVD 119

Query: 156 IDTSFASLQGCESDQVQSII--------RYDGRP 181
           + T  + ++  +  +V + I        +   +P
Sbjct: 120 MTTGVSHVE-VDKGRVTATINRGSGTACQPPSKP 152


>gi|34498785|ref|NP_903000.1| hypothetical protein CV_3330 [Chromobacterium violaceum ATCC 12472]
 gi|34104636|gb|AAQ60994.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 186

 Score = 69.6 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 47/146 (32%), Gaps = 12/146 (8%)

Query: 40  LGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
              + I I +D    ++     +   GNV + Q    L ADK+    +           R
Sbjct: 26  DKTKPIEITSDNGCTMEQTKGISTCTGNVVVVQGTLRLNADKVVATQDQQGNQTLQATGR 85

Query: 99  MDVERNIFIQS-GEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +   R     + G I   +S    D  K   VL G+      +K   +  +G  +  +  
Sbjct: 86  IVTFRQKLDNNSGWIEGQSSKLDYDSAKHFAVLTGNAR----VKRNGDLVIGNVITYDTQ 141

Query: 158 TSFASL------QGCESDQVQSIIRY 177
           +    +       G    +   I++ 
Sbjct: 142 SEVYQVMGGGASAGKGGGRTTVILQP 167


>gi|241767689|ref|ZP_04765319.1| lipopolysaccharide transport periplasmic protein LptA [Acidovorax
           delafieldii 2AN]
 gi|241361353|gb|EER57879.1| lipopolysaccharide transport periplasmic protein LptA [Acidovorax
           delafieldii 2AN]
          Length = 171

 Score = 69.6 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 52/165 (31%), Gaps = 14/165 (8%)

Query: 15  LALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDF 74
           +  +FVL+    +          K   N+ ++I+AD L   +  Q + F G V MT+   
Sbjct: 5   ILPIFVLMALAFAPGVG---QAEKADRNKPMNIEADALRHDELKQTSVFTGRVVMTKGSI 61

Query: 75  SLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
            L+  ++ +  +                     +   +  +      + +  ++  +G  
Sbjct: 62  VLRGARLDVRQDAEGYQYGVVTAEPGKRAFFRQKRDTLPGVPDEFI-EGESEVIEYDGRA 120

Query: 135 ADKVILKEKL----------NTFLGCKLIVNIDTSFASLQGCESD 169
            +   +              +   G  ++ N  T   ++ G    
Sbjct: 121 DNVRFITRAEMRRYRESVVTDELSGAVIVYNNLTDVFTVDGQRKS 165


>gi|264680673|ref|YP_003280583.1| OstA-like protein [Comamonas testosteroni CNB-2]
 gi|299532763|ref|ZP_07046150.1| OstA-like protein [Comamonas testosteroni S44]
 gi|262211189|gb|ACY35287.1| OstA-like protein [Comamonas testosteroni CNB-2]
 gi|298718987|gb|EFI59957.1| OstA-like protein [Comamonas testosteroni S44]
          Length = 218

 Score = 69.2 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 53/168 (31%), Gaps = 22/168 (13%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD---- 91
             K    + ++I+AD L   +  Q + F GNV MT+    L+  ++ +  +         
Sbjct: 23  AEKADSAKPMNIEADALRHDELQQTSVFTGNVVMTKGSIVLRGAQLDVRQDAEGYQYGVI 82

Query: 92  ----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRA-DKVILKEKLNT 146
                     R   +         I         D +  I+         +    +  + 
Sbjct: 83  KAEAGKRAFFRQKRDTVAGQPEEFIEGEGEVIEYDGKADIVKFIRRGEMRRYRGGQLSDQ 142

Query: 147 FLGCKLIVNIDTSFASLQG------------CESDQVQSIIRY-DGRP 181
             G  ++ N  T   ++ G             +  +V++I+   DG P
Sbjct: 143 VTGSIIVYNNITDVYTVDGQKTSGGLPSSSVGQGGRVRAIMAPKDGTP 190


>gi|160896121|ref|YP_001561703.1| lipopolysaccharide transport periplasmic protein LptA [Delftia
           acidovorans SPH-1]
 gi|160361705|gb|ABX33318.1| lipopolysaccharide transport periplasmic protein LptA [Delftia
           acidovorans SPH-1]
          Length = 228

 Score = 69.2 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/171 (12%), Positives = 54/171 (31%), Gaps = 24/171 (14%)

Query: 34  MTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS 93
               K    + ++I+AD L   +  Q + F GNV MT+    L+  ++ +  +       
Sbjct: 29  AQAEKADSTKPMNIEADALRHDELKQTSVFTGNVVMTKGTIVLRGAQLDVRQDPEGFQYG 88

Query: 94  NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL--------- 144
                         +   +         + +  ++  +G       ++            
Sbjct: 89  VVTAEAGKRAFFRQKRDTVPGQPEEFV-EGEGEVIEYDGKADLVKFIRRGELRRYRGGQL 147

Query: 145 -NTFLGCKLIVNIDTSFASLQG------------CESDQVQSIIRY-DGRP 181
            +   G  ++ N  T   ++ G             +  +V++++   +G P
Sbjct: 148 SDEITGSIIVYNNLTDVFTVDGQKTSGGQPSSTAGQGGRVRAVLAPKEGTP 198


>gi|171464190|ref|YP_001798303.1| OstA family protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193728|gb|ACB44689.1| OstA family protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 190

 Score = 69.2 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 60/173 (34%), Gaps = 12/173 (6%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           +L    L  A  + +   K   ++ + ++A+ + V D  Q     G V + +    +  +
Sbjct: 13  LLSFLALGFAITNPVLAEKADQDKPVILQAEKVSVNDVKQIYDLNGQVLLIKGSIIVTGE 72

Query: 80  KMTIDYNNTNRD-----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDR 134
              I  +    +      + +      +R        +    +    D +   L+L GD 
Sbjct: 73  NGHIAVDPQGYEFVDVIGTPEEVASFRQRREGPADEFMQGRGAQVTYDAKSEFLILTGDA 132

Query: 135 ADKVILK-EKLNTFLGCKLIVNIDTSFASLQGCESDQ------VQSIIRYDGR 180
           + K +L  + L+   G K+  +    +  +   +  +       ++I+    +
Sbjct: 133 SLKRLLNMQMLDQLKGWKIEYDDVKQYYQVIPPKDAKPEDLPLARAILSPRRK 185


>gi|118602139|ref|YP_903354.1| OstA family protein [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567078|gb|ABL01883.1| OstA family protein [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 161

 Score = 68.8 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 60/169 (35%), Gaps = 19/169 (11%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           LL  +  L    ++           +   + I + A M+ + +  + + + G   +TQ  
Sbjct: 5   LLICLLALSGYAIA---------LVIDNYKPIEVSASMVVIDEKKKISTYVGKASITQGS 55

Query: 74  FSLQADKMTIDYNNTNRDVS----NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILV 129
           F L A+ + +  N                   ++N   QS  I   A N     ++ ++ 
Sbjct: 56  FMLNAEIIQLFSNQQEVIKIIAKGTYKQPAHYQQNQSNQSRFIEAQALNITYLTKQELVH 115

Query: 130 LNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS--LQGCESDQVQSIIR 176
           L G    K  L + ++ F G  L  +I        +    + +V+  I+
Sbjct: 116 LKG----KAHLVQGVDFFSGDTLDYDIKNDKIITSMSKDGTQRVRFKIK 160


>gi|262166554|ref|ZP_06034291.1| LptA protein [Vibrio mimicus VM223]
 gi|262026270|gb|EEY44938.1| LptA protein [Vibrio mimicus VM223]
          Length = 126

 Score = 68.8 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 44/124 (35%), Gaps = 6/124 (4%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEIN 113
               +  F G+V + Q   ++ ADK+ +  N  N   +       +     +  +   + 
Sbjct: 1   MKSNRVTFLGDVKLKQGSININADKLIVIRNANNGKIEEIEGYGNVATFSQLTDEGKTLY 60

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
             A   Y   +   LV+     +K +L +  +   G K+   I +           +V +
Sbjct: 61  GEAKELYYKVRDDELVMI----NKAMLSQDDSEIRGSKIRYKISSQKLIADSDGKGRVST 116

Query: 174 IIRY 177
           +++ 
Sbjct: 117 VLQP 120


>gi|254457970|ref|ZP_05071397.1| cell envelope biogenesis protein YhbN [Campylobacterales bacterium
           GD 1]
 gi|207085363|gb|EDZ62648.1| cell envelope biogenesis protein YhbN [Campylobacterales bacterium
           GD 1]
          Length = 155

 Score = 68.4 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/135 (14%), Positives = 50/135 (37%), Gaps = 2/135 (1%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           ++++ IKA+  +  +    + F+G V + + +  L A K+T+  +  ++           
Sbjct: 17  SQELKIKANQFDADEKTGISIFQGKVNIIKGNDELNASKVTVHTDAKHQPTKYIAEGEVS 76

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                 +      +A         +      D   K I  ++    +G ++++      A
Sbjct: 77  FNIETKKGSLYQGVAGKVIYMPTIKEYHFFTDVHLKQI--DEKKEIIGDEVVLKTIEGKA 134

Query: 162 SLQGCESDQVQSIIR 176
             +G + + V  I +
Sbjct: 135 YARGAKKEPVIMIFK 149


>gi|262401816|ref|ZP_06078381.1| LptA protein [Vibrio sp. RC586]
 gi|262351788|gb|EEZ00919.1| LptA protein [Vibrio sp. RC586]
          Length = 126

 Score = 68.4 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 44/124 (35%), Gaps = 6/124 (4%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN--RDVSNKINRMDVERNIFIQSGEIN 113
               +  F G+V + Q   ++ ADK+ +  N  N   +       +     +  +   + 
Sbjct: 1   MKSNRVTFLGDVKLKQGSININADKLIVIRNADNGKIEEIEGYGNVATFSQLTDEGKTLY 60

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
             A   Y   +   LV+     +K +L +  +   G K+   I +           +V +
Sbjct: 61  GEAKELYYKVRDDELVMI----NKAMLSQDDSEIRGSKIRYKISSQKLIADSEGKGRVST 116

Query: 174 IIRY 177
           +++ 
Sbjct: 117 VLQP 120


>gi|511886|gb|AAA26347.1| ORF0 [Sinorhizobium meliloti]
          Length = 127

 Score = 68.0 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT---NRDVSNKINRMDVERNIFIQSGEI 112
           D   KA F GNV + Q   +LQA  MT+ Y          +  I+R++V   +F+ SG  
Sbjct: 1   DPESKAIFTGNVKVVQGTTTLQAGNMTVFYKAGGGSVTSGNADIDRIEVSNKVFLSSGAQ 60

Query: 113 NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ 172
                +G V+   + +VL G    KV+L E  N F+GC+L V +DT  A L  C   +VQ
Sbjct: 61  QATGESGIVNLTNQTIVLKG---KKVVLSEGKNVFVGCQLNVQMDTGEAQLDAC-GGRVQ 116

Query: 173 SIIRYDGR 180
             +    R
Sbjct: 117 IQLDPQSR 124


>gi|332529261|ref|ZP_08405224.1| OstA-like protein [Hylemonella gracilis ATCC 19624]
 gi|332041271|gb|EGI77634.1| OstA-like protein [Hylemonella gracilis ATCC 19624]
          Length = 200

 Score = 68.0 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 52/149 (34%), Gaps = 16/149 (10%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI----NRMD 100
           +HI+AD L   D  Q + F GNV +T+    ++ +++ +  +       N       R  
Sbjct: 1   MHIEADALRYDDQRQISVFSGNVVLTRGGIRIEGERIEVRQDALGYQYGNITAALGQRAR 60

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE-KLNTFLGCKLIVNIDTS 159
             +        +   ++    D +  +  L GD   + +    + +   G  ++ +    
Sbjct: 61  FTQLREGMDETVVAESNTIEYDGRTDVFKLLGDAVLRRLRSGAEADIMTGQVVVYDNLKD 120

Query: 160 FASLQG-----------CESDQVQSIIRY 177
             ++ G               +V++ +  
Sbjct: 121 IFTIDGARATGGVAPRPGTDTRVRATLSP 149


>gi|87124321|ref|ZP_01080170.1| hypothetical protein RS9917_11945 [Synechococcus sp. RS9917]
 gi|86167893|gb|EAQ69151.1| hypothetical protein RS9917_11945 [Synechococcus sp. RS9917]
          Length = 154

 Score = 67.6 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 58/184 (31%), Gaps = 42/184 (22%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           MS  ++ +      +  +  L     +Q  AS   +        I I++D     +    
Sbjct: 1   MSVSVSRLSTAWVSMLCLSALAPGLRAQPLASTQPQQPAQQGGLITIESDTQSADNITGV 60

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
               GNV +                                       +  +   +    
Sbjct: 61  VTALGNVRIVY------------------------------------PARGMVATSRQAQ 84

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV--QSIIRYD 178
              ++  LVL+GD     +++E  N     +++ ++D   A  +  +  QV  Q +IR D
Sbjct: 85  YYSKEGRLVLSGDVD---VIQEGGNALRAERVVYSLDDERAVAEPAQGGQVFSQMVIRQD 141

Query: 179 -GRP 181
            G+P
Sbjct: 142 QGQP 145


>gi|17231559|ref|NP_488107.1| hypothetical protein alr4067 [Nostoc sp. PCC 7120]
 gi|17133202|dbj|BAB75766.1| alr4067 [Nostoc sp. PCC 7120]
          Length = 165

 Score = 67.3 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 52/174 (29%), Gaps = 39/174 (22%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           L+ +      L L   L          S +T     GN  + I++D+ E     Q    +
Sbjct: 9   LSKMRRLGLALLLPVTLFGTVALPNQLSSVTAQTPGGNRPLTIRSDIQEYDAKNQVITAR 68

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV M      +Q                                      ++      +
Sbjct: 69  GNVQMLYPARQIQ------------------------------------ATSAQAQYFSK 92

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +R +  +G+     IL++  N+    K+   ID          + QV+SI   +
Sbjct: 93  ERRIDFSGNVY---ILQQGGNSIRAEKVTYLIDEGRFVALPQSNRQVESIYMIE 143


>gi|149194641|ref|ZP_01871737.1| OstA family protein [Caminibacter mediatlanticus TB-2]
 gi|149135385|gb|EDM23865.1| OstA family protein [Caminibacter mediatlanticus TB-2]
          Length = 150

 Score = 66.9 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/137 (14%), Positives = 49/137 (35%), Gaps = 3/137 (2%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           + ++ I +          ++ FKG+V  T+   ++  +++ + +N   + +         
Sbjct: 16  SAELKITSKFFNYDSKKLESIFKGDVNATKGSDNILCNELIVYFNKNKKPIKYIAIGNVR 75

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                 ++                  ++LNG+   K I   +  +  G  + +N  T   
Sbjct: 76  FIFKMDENSTYKGKTDKLTYLLMTGEIILNGNAFIKKIETNE--SISGDIIKINRITKNI 133

Query: 162 SLQGCESDQVQSIIRYD 178
            ++G     V  II+ D
Sbjct: 134 EVEG-NKKPVNIIIKVD 149


>gi|186681605|ref|YP_001864801.1| OstA family protein [Nostoc punctiforme PCC 73102]
 gi|186464057|gb|ACC79858.1| OstA family protein [Nostoc punctiforme PCC 73102]
          Length = 168

 Score = 66.9 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 50/174 (28%), Gaps = 39/174 (22%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++    +   L L   LL            T      N  + I+AD+ E     Q    +
Sbjct: 9   MSQFRRFGLALMLPVALLGTFAFPTQLQTATAQTSKDNRPLTIRADVQEYDAKNQVITAR 68

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV M      LQ                                      ++      +
Sbjct: 69  GNVQMLYPSRQLQ------------------------------------ATSAQAQYFSK 92

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +R +  +G+     IL++  N+    K+   ID          + QV+SI   +
Sbjct: 93  ERRIDFSGNVY---ILQQGGNSIRAEKVTYLIDEGRFVALPQSNRQVESIYMIE 143


>gi|23015175|ref|ZP_00054959.1| COG1934: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 325

 Score = 66.9 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 57/164 (34%), Gaps = 10/164 (6%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAF 62
                 +     A++  L    L+Q            G+++I + AD  +E      +  
Sbjct: 1   MKPPALIPFITAAILMALPGLSLAQGFE-----MSKSGDQQIQVYADNGIEWHSEELRVI 55

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
            +GN    + + ++ AD +T  Y        ++I R+D + N+ I+S            D
Sbjct: 56  ARGNAHAIRGNMTVDADVLTAHYRKGP--KGDEIWRLDADGNVVIRSPNDTATGHKAIYD 113

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
             K I VL G  A  V             L     T  A L+G 
Sbjct: 114 LDKSIFVLKGTPAKLVTPT--DTFTATDSLEYWELTKMAVLRGD 155



 Score = 49.9 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 38/118 (32%), Gaps = 8/118 (6%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQ-EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQ 108
           D LE  +  + A  +G+    Q    +L+ D +T  + +  +D                +
Sbjct: 139 DSLEYWELTKMAVLRGDAVAVQEGGKTLKGDVLTAHFKDKEKDK-------PAPARPGAK 191

Query: 109 SGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
                   +         + +   D    V++     T  G +   N +T  A++ G 
Sbjct: 192 PQSGTSSGAAAGSGDGGGLELQRADAYGHVVIISSSETVTGDRGDYNAETGIATVSGS 249


>gi|294084813|ref|YP_003551573.1| hypothetical protein SAR116_1246 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664388|gb|ADE39489.1| hypothetical secreted protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 268

 Score = 66.9 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 57/167 (34%), Gaps = 10/167 (5%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKA-DMLEVKDAVQKAFF 63
           LN +  +  L AL+ V+    LS A A             + I+A D LE          
Sbjct: 4   LNFLLRHFALFALLLVMSPGLLSIANAQDKQAET--QTAPVTIEASDFLEWDQNKGLYLA 61

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
           +G+    Q D  + AD++  +Y+        +IN M    N+F   GE     +    D 
Sbjct: 62  EGDAIAVQRDMRISADRLEANYDPE--QAGREINLMTATGNVFFIDGENTATGARLVYDL 119

Query: 124 QKRILVLNGDRADKVILKEKLNTFLG-CKLIVN-IDTSFASLQGCES 168
                 + G       +           K+I +  + + A + G   
Sbjct: 120 VSSTYSVFG---KNAKVTSPRGVMTATKKIIYDESNPTKAKINGIGK 163



 Score = 34.5 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 7/41 (17%), Positives = 16/41 (39%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNT 88
             D +        A   GNV + +    ++  +  +D+N+ 
Sbjct: 209 TGDKVNYDFNTSIAILTGNVELIEGQNVMRGSRAEVDFNSG 249


>gi|15607109|ref|NP_214491.1| hypothetical protein aq_2173 [Aquifex aeolicus VF5]
 gi|2984372|gb|AAC07891.1| putative protein [Aquifex aeolicus VF5]
          Length = 144

 Score = 66.5 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 59/139 (42%), Gaps = 12/139 (8%)

Query: 42  NEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDV 101
           ++ I  +A+ LE      +  +KGNV + ++  +L+AD++ I  +  N+        +  
Sbjct: 18  SQTITGEANSLEFLKD--RLIYKGNVILHRDSSTLKADEVVILLDKENKPYK-----LIA 70

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
           + N+  +       A     D +K I+ L G+      ++E        ++I+       
Sbjct: 71  KGNVKFRENGRKAEAEFAEYDLRKEIIHLKGNAK----IEENGRVVEADEIIIYKREKRL 126

Query: 162 SLQGCESDQVQSIIRYDGR 180
             +G +  +V+++   + +
Sbjct: 127 VAKG-KGKRVRTVYVEEKK 144


>gi|291287219|ref|YP_003504035.1| lipopolysaccharide transport periplasmic protein LptA
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290884379|gb|ADD68079.1| lipopolysaccharide transport periplasmic protein LptA
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 165

 Score = 66.1 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 44  KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER 103
            IHI+AD +       K+   GNV + + D ++++D+M +          N++  +  + 
Sbjct: 36  PIHIEADKMVTI--GNKSIITGNVVVVRGDMTMKSDEMEVT-----AAEGNQVKEIYSKG 88

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           N+ I+  ++  ++    +   ++ +VL  +      + +  N   G K+ + ++++   +
Sbjct: 89  NVRIEDKDLLALSGFARLYQDEQKVVLTDNAK----VWKGDNYIEGEKITLFMESNRLFV 144

Query: 164 QGC--ESDQVQSIIRYDG 179
                + D+++ II    
Sbjct: 145 DKGDNKGDRIKIIITPQK 162


>gi|300313258|ref|YP_003777350.1| signal peptide protein [Herbaspirillum seropedicae SmR1]
 gi|300076043|gb|ADJ65442.1| signal peptide protein [Herbaspirillum seropedicae SmR1]
          Length = 201

 Score = 66.1 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 49/155 (31%), Gaps = 13/155 (8%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
             K    +  +I+AD +   D  Q   F GNV MT+    ++A ++ +  +    + +  
Sbjct: 21  AEKADTTKPTNIEADQMVYDDVRQVKTFTGNVVMTRGTLIIKAGRVVLTTDQYGYENAVL 80

Query: 96  INRMDVERNIFIQSG-----EINVIASNGYVDFQKRILVLNGDRADKVI-LKEKLNTFLG 149
                       +        I   A       Q  +  L      + +  K   +   G
Sbjct: 81  YAAPGSLATFRQKRDGGPDLWIEGQAERIEYSEQTEVSKLFQRAHIQRMDGKRITDEVNG 140

Query: 150 CKLIVNIDTSFASLQGCES-------DQVQSIIRY 177
             +  +    F S+    S        ++ ++I+ 
Sbjct: 141 EFISYDSRAEFYSVNNTASGQSKPGAGRITAVIQP 175


>gi|153007151|ref|YP_001381476.1| OstA family protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030724|gb|ABS28492.1| OstA family protein [Anaeromyxobacter sp. Fw109-5]
          Length = 186

 Score = 65.7 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 57/143 (39%), Gaps = 12/143 (8%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN---VFMTQEDFSLQADKMTID 84
            +AAS      V G  K+HI AD LE     ++  F G    V +T+ D  L   ++   
Sbjct: 29  SSAASRSPVATVAGEAKVHIDADELEYVFQKREVIFTGKRTPVVLTRGDARLTCRRLVAT 88

Query: 85  YNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKL 144
            +        +I R     ++  + GE  V       +     LV  G+     +L++  
Sbjct: 89  NDAR-----GEIARAVCSGDVRFERGERLVTCEKATYEAAAARLVCEGNP----VLRDGP 139

Query: 145 NTFLGCKLIVNIDTSFASLQGCE 167
           +   G +L+ +++   A L+G  
Sbjct: 140 SEASGTRLVYDLEIDKARLEGAR 162


>gi|260767120|ref|ZP_05876065.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
 gi|260617875|gb|EEX43049.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
 gi|315181263|gb|ADT88177.1| organic solvent tolerance protein [Vibrio furnissii NCTC 11218]
          Length = 786

 Score = 65.3 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/139 (15%), Positives = 54/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             + I+++AD LE     ++A + GNV + Q    ++AD +T+   +           + 
Sbjct: 52  NEQPINVEADKLEAI-NGERATYSGNVVVIQGKKQIRADNVTLHQKDNV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LGCKLIVNI 156
            E N+    G++   +     +     + L  +   K + ++            K +  I
Sbjct: 102 AEGNVNFSDGQVKATSDKATNNLTTDQMTLE-NTKYKFLCEQGRGEAAYISKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G  + ++++
Sbjct: 161 EDGSITSCPEGDSAWRLRA 179


>gi|154707186|ref|YP_001424154.1| hypothetical protein CBUD_0760 [Coxiella burnetii Dugway 5J108-111]
 gi|161830749|ref|YP_001596942.1| cell envelope biogenesis protein YhbN [Coxiella burnetii RSA 331]
 gi|164686059|ref|ZP_01947184.2| cell envelope biogenesis protein YhbN [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165923982|ref|ZP_02219814.1| cell envelope biogenesis protein YhbN [Coxiella burnetii RSA 334]
 gi|154356472|gb|ABS77934.1| hypothetical protein CBUD_0760 [Coxiella burnetii Dugway 5J108-111]
 gi|161762616|gb|ABX78258.1| cell envelope biogenesis protein YhbN [Coxiella burnetii RSA 331]
 gi|164601615|gb|EAX32202.2| cell envelope biogenesis protein YhbN [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165916568|gb|EDR35172.1| cell envelope biogenesis protein YhbN [Coxiella burnetii RSA 334]
          Length = 171

 Score = 65.3 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 41/146 (28%), Gaps = 8/146 (5%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNK 95
                  +  H+++  +  +       + G+V+ TQ    +  DK+ + +N T   +   
Sbjct: 29  ALSSDQFKPYHVRSIEVIYRRPDHITLYHGDVYATQGTTWISGDKVIVYHNPTTNRIVRL 88

Query: 96  INRMDVERNIFIQSGEI---NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
                      +   +       A        K  ++L  +      + +K N   G  +
Sbjct: 89  KAIGHPAHYSTMPDNQKARLYAQAETILYFPAKAQVLLIKNAR----VTQKQNILTGPHI 144

Query: 153 IVNIDTSFASLQ-GCESDQVQSIIRY 177
             +I                  +I  
Sbjct: 145 WYDIKKQTVISTVPNGKGNTTVVIEP 170


>gi|86607079|ref|YP_475842.1| hypothetical protein CYA_2457 [Synechococcus sp. JA-3-3Ab]
 gi|86555621|gb|ABD00579.1| hypothetical protein CYA_2457 [Synechococcus sp. JA-3-3Ab]
          Length = 612

 Score = 65.3 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/165 (12%), Positives = 52/165 (31%), Gaps = 16/165 (9%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A +         ++++ I AD L      Q A  +GN+ + Q +  +Q+ + T     + 
Sbjct: 292 AQADPQATPAQQDQEVTIVADRLTYDRNTQIARGEGNLEIRQGETIIQSAQGTYRRRESQ 351

Query: 90  RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN-------GDRADKVILKE 142
             ++  +   +    +   +          +   +  +           G  +    L++
Sbjct: 352 SLLTGGVTLRE-PGRVLTSARLEGNHRDKIFFFEENVLYRQMATSTPAPGGGSLTEELRQ 410

Query: 143 KLNTFLGCKLIVNIDTSFASLQ--------GCESDQVQSIIRYDG 179
                   +L+ N  T  +           G ++   Q+ I  + 
Sbjct: 411 AETEVRAARLVYNSRTGTSEFSEAVEFIQRGRKAKANQATITPEK 455



 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/144 (15%), Positives = 49/144 (34%), Gaps = 15/144 (10%)

Query: 33  YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV 92
              + +   ++   I AD +E+  A   A F GNV + Q + +++ D+           +
Sbjct: 477 QNPQTQADVDQPTVIYADRVEIDQASGDARFFGNVVIVQANRAIEGDRAEYSDQGQIFRI 536

Query: 93  SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
           +     + +     +        A             L G  A    +    N   G  +
Sbjct: 537 TADQAPVLLCDRGELNPIPRESTAP------------LPGRDALD-QMCRGANRLSGRLV 583

Query: 153 IVNIDTSFASLQGCESDQVQSIIR 176
            +N++    +++G E    Q + +
Sbjct: 584 TLNLERDEYTVEGDEQQ--QGMFQ 605



 Score = 57.2 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 53/153 (34%), Gaps = 17/153 (11%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           + A  S  T         I I AD L    A Q A  KGN+ + +    ++A + T    
Sbjct: 203 AAAPMSDPTSAGADPTSTI-ITADQLTYDRANQVAEGKGNLRIREGGLEIRAPQGTYLRR 261

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG-DRADKVILKEKLN 145
                +S  +   +V              A  G  D     L L   D       +++  
Sbjct: 262 QAQSILSGGVVLQEV--------------ADVGSRDPLLADLRLAQADPQATPAQQDQEV 307

Query: 146 TFLGCKLIVNIDTSFASLQGCESDQV-QSIIRY 177
           T +  +L  + +T  A  +G    +  ++II+ 
Sbjct: 308 TIVADRLTYDRNTQIARGEGNLEIRQGETIIQS 340


>gi|229586751|ref|YP_002845252.1| hypothetical protein RAF_ORF0605 [Rickettsia africae ESF-5]
 gi|228021801|gb|ACP53509.1| Unknown [Rickettsia africae ESF-5]
          Length = 194

 Score = 64.6 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 82  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTKELYIFYKTIDEKQTIDHIVVPTKLT 141

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 142 VERKIKNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|239947701|ref|ZP_04699454.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921977|gb|EER22001.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 194

 Score = 64.6 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y       +     +  +  
Sbjct: 82  LHITSDTLIIDRTKQKAEYLGNVVVYFDNAILRTKELYIFYKTIAEKQTIDHVVVPTKLT 141

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 142 VERKINNELLLADSAKYFFDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|253734674|ref|ZP_04868839.1| possible ABC superfamily ATP binding cassette transporter,
          periplasmic lipopolysaccharide-binding protein
          [Staphylococcus aureus subsp. aureus TCH130]
 gi|253727351|gb|EES96080.1| possible ABC superfamily ATP binding cassette transporter,
          periplasmic lipopolysaccharide-binding protein
          [Staphylococcus aureus subsp. aureus TCH130]
          Length = 80

 Score = 64.2 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 31/87 (35%), Gaps = 9/87 (10%)

Query: 6  NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
          N + L + L + +        +              ++ IHI++D   +        F G
Sbjct: 1  NKLSLNLVLASSLLAASIPAFA---------VTGDTDQPIHIESDQQSLDMQGNVVTFTG 51

Query: 66 NVFMTQEDFSLQADKMTIDYNNTNRDV 92
          NV +TQ    + ADK+ +      +  
Sbjct: 52 NVIVTQGTIKINADKVVVTRPGGEQGK 78


>gi|34580434|ref|ZP_00141914.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28261819|gb|EAA25323.1| unknown [Rickettsia sibirica 246]
          Length = 194

 Score = 64.2 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 82  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTKELHIFYKTIDEKQTIDHIVVPTKLT 141

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 142 VERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|157803764|ref|YP_001492313.1| hypothetical protein A1E_02940 [Rickettsia canadensis str. McKiel]
 gi|157785027|gb|ABV73528.1| hypothetical protein A1E_02940 [Rickettsia canadensis str. McKiel]
          Length = 145

 Score = 64.2 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 63/153 (41%), Gaps = 12/153 (7%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++       ++ L+  L  +    A+   ++          HI +D L +    QKA + 
Sbjct: 1   MSLQSSIYRIIKLLVFLTISISIYASDKDISNL--------HITSDTLIIDKTKQKAEYL 52

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +  ++  L+ +++ I Y   +   +     +  + N+  +     ++A +    F 
Sbjct: 53  GNVVVYFDNAILRTEELYIFYKTIDEKQTIDHIIVPTKLNVERKINNELLLADSAKYFFD 112

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
            + L+L G+    VIL+   N     KLI  +D
Sbjct: 113 NKQLILIGN----VILQRDDNVLKTNKLIYYVD 141


>gi|78777275|ref|YP_393590.1| OstA-like protein [Sulfurimonas denitrificans DSM 1251]
 gi|78497815|gb|ABB44355.1| OstA-like protein [Sulfurimonas denitrificans DSM 1251]
          Length = 166

 Score = 63.8 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 46/133 (34%), Gaps = 2/133 (1%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           +++ +KA +         + F+G+V + + +  L A K+TI  N+               
Sbjct: 18  QELQVKAKLFNADQKAGISIFEGDVNIIRGNDELNASKVTIHTNSAQEPTKFIAEGNASF 77

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
           +   I+       A       + +      D   K +  +     +G ++I+      A 
Sbjct: 78  KIKTIEGALYVGKAHKVIYLPKTKEYYFYQDVHLKQL--DDKKEIIGDEVILKTIEGKAY 135

Query: 163 LQGCESDQVQSII 175
            +G   + V  I 
Sbjct: 136 AKGAAKEPVIMIF 148


>gi|15892582|ref|NP_360296.1| hypothetical protein RC0659 [Rickettsia conorii str. Malish 7]
 gi|15619747|gb|AAL03197.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 194

 Score = 63.8 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 82  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTKELYIFYKTIDEKQTIDHIVVPTKLT 141

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 142 VERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|212212788|ref|YP_002303724.1| LPS ABC transporter periplasmic component [Coxiella burnetii
           CbuG_Q212]
 gi|212219029|ref|YP_002305816.1| LPS ABC transporter periplasmic component [Coxiella burnetii
           CbuK_Q154]
 gi|215919032|ref|NP_819773.2| cell envelope biogenesis protein YhbN [Coxiella burnetii RSA 493]
 gi|206583917|gb|AAO90287.2| LPS ABC transporter periplasmic component [Coxiella burnetii RSA
           493]
 gi|212011198|gb|ACJ18579.1| LPS ABC transporter periplasmic component [Coxiella burnetii
           CbuG_Q212]
 gi|212013291|gb|ACJ20671.1| LPS ABC transporter periplasmic component [Coxiella burnetii
           CbuK_Q154]
          Length = 142

 Score = 63.8 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 17/145 (11%), Positives = 41/145 (28%), Gaps = 8/145 (5%)

Query: 37  FKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
                 +  H+++  +  +       + G+V+ TQ    +  DK+ + +N T   +    
Sbjct: 1   MSSDQFKPYHVRSIEVIYRRPDHITLYHGDVYATQGTTWISGDKVIVYHNPTTNRIVRLK 60

Query: 97  NRMDVERNIFIQSGEI---NVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLI 153
                     +   +       A        K  ++L  +      + +K N   G  + 
Sbjct: 61  AIGHPAHYSTMPDNQKARLYAQAETILYFPAKAQVLLIKNAR----VTQKQNILTGPHIW 116

Query: 154 VNIDTSFASLQ-GCESDQVQSIIRY 177
            +I                  +I  
Sbjct: 117 YDIKKQTVISTVPNGKGNTTVVIEP 141


>gi|328950869|ref|YP_004368204.1| OstA family protein [Marinithermus hydrothermalis DSM 14884]
 gi|328451193|gb|AEB12094.1| OstA family protein [Marinithermus hydrothermalis DSM 14884]
          Length = 298

 Score = 63.4 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 48/128 (37%), Gaps = 4/128 (3%)

Query: 40  LGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRM 99
            G + + ++AD +        +  +G+V +T  +    AD +  +        S +   +
Sbjct: 130 EGEDPVEVQADKMTFDVDADVSTSEGSVRLTSGNQEGTADLVYYEEERGLAVFSMREGTV 189

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTS 159
            + R    + G++ + A       +++ L+  G     V L +   T  G  L  + +  
Sbjct: 190 TLVRRRSGEQGDLVIQAREVRSLTREKQLIATG----GVTLVDGEITTTGDALYYDDNEG 245

Query: 160 FASLQGCE 167
            A + G  
Sbjct: 246 TAIIIGSP 253



 Score = 39.1 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 13/127 (10%), Positives = 34/127 (26%), Gaps = 7/127 (5%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI 107
           +   ++  +  + A F+G V + +   + +  ++   Y+        +      +     
Sbjct: 73  EGKSMQEAEGERTATFEGEVVVKRGRVTARGPRLV--YSEATGVGVLEGPAEMRQEPARE 130

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
               + V A     D    +    G     V L           +    +   A +    
Sbjct: 131 GEDPVEVQADKMTFDVDADVSTSEG----SVRLTSGNQEGTADLVYYEEERGLA-VFSMR 185

Query: 168 SDQVQSI 174
              V  +
Sbjct: 186 EGTVTLV 192


>gi|218781660|ref|YP_002432978.1| Organic solvent tolerance protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763044|gb|ACL05510.1| Organic solvent tolerance protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 753

 Score = 63.0 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 53/144 (36%), Gaps = 14/144 (9%)

Query: 11  YIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
           ++ L A  + L     + A    +    +  +E  +I AD L+  +        GNV + 
Sbjct: 10  FVRLGAAWWALTVLLFAPAFGQGLDLSNMDPSEPWNITADKLQYDNMTNTYRGSGNVLIW 69

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           +  + ++AD+   D NN +         +    N+ ++ G   V     Y+D        
Sbjct: 70  RSGYRMEADEAGFDRNNNS---------LWAVGNVTVKGGGDVVTGDRVYMDLATE---- 116

Query: 131 NGDRADKVILKEKLNTF-LGCKLI 153
            G   +  +  +  + F  G ++ 
Sbjct: 117 TGLVENGTLFIQATHFFVRGGRIE 140


>gi|313679933|ref|YP_004057672.1| hypothetical protein Ocepr_1042 [Oceanithermus profundus DSM 14977]
 gi|313152648|gb|ADR36499.1| hypothetical protein Ocepr_1042 [Oceanithermus profundus DSM 14977]
          Length = 299

 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 50/153 (32%), Gaps = 6/153 (3%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
                +    A         G + + ++A  +        +   G V +   +    AD+
Sbjct: 114 ATGLGVLAGPAEMHQEPAKEGEDPVEVRAQEMSFDVDTDISTSSGGVVLASGNQKGWADR 173

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
             + Y          +++  V+     + GE+ + A       + + L+  G     V L
Sbjct: 174 --VYYEEERGLAVFTMDQGTVKLVRERKDGELVINAPEVRSLTRSKKLIATG----GVKL 227

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQS 173
            +   T  G  L  + +T  A + G  +  V +
Sbjct: 228 VDGEITTTGDALYYDDETGEAIVIGNPARSVNA 260



 Score = 38.8 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 38/127 (29%), Gaps = 7/127 (5%)

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI 107
           +   ++  +  + A F+G V +T+   + +  ++   Y+               +     
Sbjct: 76  EGKSMQAAEGERTATFEGGVTVTRGRLTAKGPRLV--YSEATGLGVLAGPAEMHQEPAKE 133

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
               + V A     D    I   +G     V+L          ++    +   A     +
Sbjct: 134 GEDPVEVRAQEMSFDVDTDISTSSG----GVVLASGNQKGWADRVYYEEERGLAVFTMDQ 189

Query: 168 SDQVQSI 174
              V+ +
Sbjct: 190 GT-VKLV 195


>gi|332526870|ref|ZP_08402963.1| OstA-like protein [Rubrivivax benzoatilyticus JA2]
 gi|332111312|gb|EGJ11296.1| OstA-like protein [Rubrivivax benzoatilyticus JA2]
          Length = 206

 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 50/145 (34%), Gaps = 12/145 (8%)

Query: 45  IHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDV----SNKINRM 99
           + ++AD    V    Q   F GNV +TQ    ++AD++ +              +     
Sbjct: 34  MVVEADRPGSVDLQRQLVEFNGNVVITQGTMVIRADRVELRETADGYRAATAIGSAGRPA 93

Query: 100 DVERNIFIQSGEINVIASNGYVDFQKRILVLNGD-RADKVILKEKLNTFLGCKLIVNIDT 158
              +        +  +A     D +   L   G+    ++      +   G +++ +   
Sbjct: 94  SYRQKRDGVDEVVEGVADRIEYDGRADTLRFIGNGAVRRLRGAVVADEITGSQIVWDNTA 153

Query: 159 SFASLQGCE------SDQVQSIIRY 177
              S+ G E      S +V++++  
Sbjct: 154 ETFSVAGGETTRANPSGRVRAVLSP 178


>gi|157825778|ref|YP_001493498.1| hypothetical protein A1C_03545 [Rickettsia akari str. Hartford]
 gi|157799736|gb|ABV74990.1| hypothetical protein A1C_03545 [Rickettsia akari str. Hartford]
          Length = 125

 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 51/113 (45%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   ++  +     +  +  
Sbjct: 13  LHITSDTLIIDRTKQKAEYLGNVVVYFDNAILRTKELYIFYKTIDKKQTIDHIVVPTKLT 72

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 73  VERKINNELLLADSVKYFFDDKQLILLGN----VILQRDDNVLKTNKLIYYVD 121


>gi|238650255|ref|YP_002916106.1| hypothetical protein RPR_00295 [Rickettsia peacockii str. Rustic]
 gi|238624353|gb|ACR47059.1| hypothetical protein RPR_00295 [Rickettsia peacockii str. Rustic]
          Length = 169

 Score = 63.0 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 57  LHITSDSLIIDRTKQKAAYLGNVIVYFDNAILRTQELYIFYKTIDEKQTIDHIVVPTKLT 116

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 117 VERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 165


>gi|189218964|ref|YP_001939605.1| hypothetical protein Minf_0952 [Methylacidiphilum infernorum V4]
 gi|189185822|gb|ACD83007.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 178

 Score = 62.6 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/166 (12%), Positives = 63/166 (37%), Gaps = 9/166 (5%)

Query: 1   MSAFLN-SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQ 59
           M   +     +   L++   +       Q             +  + + ++  ++   + 
Sbjct: 1   MKPNIKMKRVIRKFLISYYLLFGFNLFGQFPEENPPELLTNPDATV-VTSNTFKLDQNIH 59

Query: 60  KAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
           + FF GNV     +F +++++MT+ ++       ++I R+  +    +   +    A+  
Sbjct: 60  QGFFSGNVITIANNFKMRSNEMTVFFDE----SGSEIKRLIAKGEALLVQEKRTAKAAQM 115

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
                +  L+L G+     +++E  +   G  + +  +++   + G
Sbjct: 116 EYIVAEDKLILTGNP---EVIEENKDHVTGNVITIFRNSNQMFVDG 158


>gi|294793351|ref|ZP_06758496.1| putative LPS-assembly protein (Organic solvent tolerance protein)
           [Veillonella sp. 6_1_27]
 gi|294455782|gb|EFG24147.1| putative LPS-assembly protein (Organic solvent tolerance protein)
           [Veillonella sp. 6_1_27]
          Length = 240

 Score = 62.6 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/164 (15%), Positives = 52/164 (31%), Gaps = 28/164 (17%)

Query: 4   FLNSIHLY-IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
            +N      + +LA++        +              N+ + I AD L       +A 
Sbjct: 1   MMNKKKQIGMAILAVLMTASVTVWAA-------------NDPLTISADTLSYDGNSGRAD 47

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
             GNV +TQ D ++   K   +      ++   ++ +          G    +++     
Sbjct: 48  ATGNVVITQADKTMTGAKGWYNTKTQEANLDGGVSMI----------GSDMAMSAQAVHS 97

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           +       NG     V L+       G  +  N D+ +  + G 
Sbjct: 98  YNNNKFTANG----SVHLQRADRQIFGDSVEYNTDSEYGLVTGN 137



 Score = 37.2 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 35/130 (26%), Gaps = 15/130 (11%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I  D +E     +     GN  +  E  +L  DK+          +             
Sbjct: 117 QIFGDSVEYNTDSEYGLVTGNARLIAEGTTLTGDKVE-------GWMKEVRAVAQGNVTF 169

Query: 106 FIQSGEINVIASNGYV----DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                 ++  A         +    +++L+G         +  N     +L + +    A
Sbjct: 170 SNPERNVSGSADRATYTQTPNQNDGVVLLSGSAHA----VQNGNVLNAPELKIRLADDSA 225

Query: 162 SLQGCESDQV 171
              G  S  V
Sbjct: 226 ETLGGRSTLV 235


>gi|149191633|ref|ZP_01869877.1| organic solvent tolerance protein [Vibrio shilonii AK1]
 gi|148834533|gb|EDL51526.1| organic solvent tolerance protein [Vibrio shilonii AK1]
          Length = 772

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 58/150 (38%), Gaps = 17/150 (11%)

Query: 27  SQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
           ++  +    +      E I+I+AD LE   + Q+A +KG+V + Q + ++ AD +T+   
Sbjct: 38  AEQCSVDTAQSSDSNQEPINIEADSLEAI-SGQRATYKGDVVVVQGNKTITADNVTLHQK 96

Query: 87  NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN- 145
                       +  E N+ +  GEI  ++     +  K  + L  +   + +       
Sbjct: 97  ENI---------VVAEGNVVMNDGEIRAVSDKATNNLNKDEITLE-NTQYQFLCTPGRGD 146

Query: 146 ---TFLGCKLIVNIDTSFASL--QGCESDQ 170
                   K +  I+    +   +G  S +
Sbjct: 147 AVFVSKTGKKLYEIEDGSITSCPEGDNSWR 176



 Score = 39.9 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 41/130 (31%), Gaps = 16/130 (12%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV M   +    +DK T + N     + N   +       
Sbjct: 85  TITADNVTLHQKENIVVAEGNVVMNDGEIRAVSDKATNNLNKDEITLENTQYQFLCTP-- 142

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFL--GCKLIVNIDTSFASL 163
                         +V    + L    D +      E  N++      + ++ D   A+L
Sbjct: 143 --------GRGDAVFVSKTGKKLYEIEDGSIT-SCPEGDNSWRFLASGIDIDPDEEVATL 193

Query: 164 QGCESDQVQS 173
               + +V+ 
Sbjct: 194 Y---NSRVEV 200


>gi|11933006|emb|CAC19344.1| hypothetical protein [Cupriavidus necator]
          Length = 155

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 35/113 (30%), Gaps = 4/113 (3%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
           A      +    + + ++AD     D  Q     GNV +T+    L++D   +  +    
Sbjct: 29  AQPAFAERADQTKPLVLEADNASYDDVKQIYTLTGNVVLTKGTMVLKSDAAELRTDPEGY 88

Query: 91  D----VSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
                 S    +  + +        I+        D +  I  L G+     +
Sbjct: 89  QYAIATSKPGRQAYIRQKRDGVDEYIDGWGDRIEYDGKSEINKLIGNARAARV 141


>gi|260767483|ref|ZP_05876420.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
 gi|260617595|gb|EEX42777.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio furnissii CIP 102972]
          Length = 224

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/139 (15%), Positives = 54/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
             + I+++AD LE     ++A + GNV + Q    ++AD +T+   +           + 
Sbjct: 52  NEQPINVEADKLEAI-NGERATYSGNVVVIQGKKQIRADNVTLHQKDNV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LGCKLIVNI 156
            E N+    G++   +     +     + L  +   K + ++            K +  I
Sbjct: 102 AEGNVNFSDGQVKATSDKATNNLTTDQMTLE-NTKYKFLCEQGRGEAAYISKTGKAVYGI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G  + ++++
Sbjct: 161 EDGSITSCPEGDSAWRLRA 179


>gi|71891835|ref|YP_277564.1| ABC transporter periplasmic substrate-binding protein [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
 gi|71795941|gb|AAZ40692.1| putative transport protein (ABC superfamily, peri_bind) [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 169

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 50/148 (33%), Gaps = 6/148 (4%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           A +Y        ++ + I ++   +        F   V +  ++  L ADK+ I +    
Sbjct: 21  AFTYSHALAYKKSQILQIYSECQSINMLTNTIIFTDRVMLKYKNIDLYADKILISHTEDT 80

Query: 90  RDVSN--KINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
             +S                    I   +S  + +     + L G+      +K+  N+ 
Sbjct: 81  HHLSMIEAHGNPVTLNQTQKMGNMIFAQSSIIHYNTSDDTITLIGNAY----IKQSGNSI 136

Query: 148 LGCKLIVNIDTSFASLQGCESDQVQSII 175
              K+I +I          + ++V +I+
Sbjct: 137 QSDKIIYSIKNKQIKAISNQGNKVITIL 164


>gi|121591544|ref|ZP_01678805.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121546598|gb|EAX56792.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
          Length = 120

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 41/118 (34%), Gaps = 6/118 (5%)

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNG 119
              G+V + Q   ++ ADK+ +  N  N   +       +     +  +   +   A   
Sbjct: 2   VLIGDVRLKQGSININADKLIVIRNAENGKIEEIEGYGNLATFSQLTDEGKTLYGEAKEL 61

Query: 120 YVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           Y   +   LV+     +K +L +  +   G K+   I             +V ++++ 
Sbjct: 62  YYKVRDDELVMI----NKAMLSQDDSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQP 115


>gi|81299325|ref|YP_399533.1| hypothetical protein Synpcc7942_0514 [Synechococcus elongatus PCC
           7942]
 gi|81168206|gb|ABB56546.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 140

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 50/174 (28%), Gaps = 39/174 (22%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + ++   +     +F  +       A +         ++ + + +D+ E          +
Sbjct: 1   MTAVIRRLIWGMSLFAAIAPASWSFAQTTNAPAPAQADQSLTLFSDIQEANSKTGVVTAR 60

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +      L+                                      A+      +
Sbjct: 61  GNVVILYPARQLR------------------------------------ATAAQAQYFSR 84

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
           +R ++L G+     + +E  N+  G  +   I+T           QVQSI   D
Sbjct: 85  ERRIILTGNVF---VQQEGGNSLRGETVTYLIETGKFVALPTPQGQVQSIYNLD 135


>gi|238019690|ref|ZP_04600116.1| hypothetical protein VEIDISOL_01564 [Veillonella dispar ATCC 17748]
 gi|237863731|gb|EEP65021.1| hypothetical protein VEIDISOL_01564 [Veillonella dispar ATCC 17748]
          Length = 244

 Score = 62.3 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 54/164 (32%), Gaps = 26/164 (15%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
             +N     I +  L  ++  +  + AA           N+ + I AD L       +A 
Sbjct: 4   NIMNKKKQ-IGMAILAMLMTASVTAWAA-----------NDPLTISADTLSYDGNTGRAD 51

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
             GNV +TQ D ++       +      ++   ++ +          G    +++     
Sbjct: 52  ANGNVVITQADKTMTGANGWYNTKTQEANLDGGVSMI----------GTDMAMSAQSVHS 101

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           +       NG     V L+       G K+  N DT +  + G 
Sbjct: 102 YNNNKFTANG----GVHLQRSDRQIFGDKVEYNTDTEYGLVSGN 141


>gi|67459110|ref|YP_246734.1| hypothetical protein RF_0718 [Rickettsia felis URRWXCal2]
 gi|67004643|gb|AAY61569.1| Uncharacterized protein [Rickettsia felis URRWXCal2]
          Length = 145

 Score = 61.9 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 50/113 (44%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 33  LHITSDTLIIDRIKQKAEYLGNVVVYFDNAILRTKELYIFYKTIDDKQTIDYIVIPTKLT 92

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +    F  + L+L G+    VIL+   N     KLI  +D
Sbjct: 93  VERKINNELLLADSAKYFFDDKQLILLGN----VILQRDDNVLKTNKLIYYVD 141


>gi|145630471|ref|ZP_01786251.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           R3021]
 gi|144983861|gb|EDJ91303.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           R3021]
          Length = 475

 Score = 61.9 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNFLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|56751015|ref|YP_171716.1| hypothetical protein syc1006_d [Synechococcus elongatus PCC 6301]
 gi|56685974|dbj|BAD79196.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 146

 Score = 61.9 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 51/177 (28%), Gaps = 39/177 (22%)

Query: 2   SAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKA 61
           +  + ++   +     +F  +       A +         ++ + + +D+ E        
Sbjct: 4   TTGMTAVIRRLIWGMSLFAAIAPASWSFAQTTNAPAPAQADQSLTLFSDIQEANSKTGVV 63

Query: 62  FFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
             +GNV +      L+                                      A+    
Sbjct: 64  TARGNVVILYPARQLR------------------------------------ATAAQAQY 87

Query: 122 DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
             ++R ++L G+     + +E  N+  G  +   I+T           QVQSI   D
Sbjct: 88  FSRERRIILTGNVF---VQQEGGNSLRGETVTYLIETGKFVALPTPQGQVQSIYNLD 141


>gi|297171736|gb|ADI22728.1| hypothetical protein [uncultured verrucomicrobium HF0500_27H16]
          Length = 189

 Score = 61.9 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/177 (11%), Positives = 56/177 (31%), Gaps = 22/177 (12%)

Query: 19  FVLLKADLSQAAASYMTRF-KVLGNEKIHIKADMLEV--KDAVQKAFFKGNVFMTQEDFS 75
            +L    + +   S  +   K   + +  I +D L +  ++      F GNV +   +  
Sbjct: 1   MLLTAWAVCEGQVSAPSAEPKAENSGETEIFSDNLVMVSREKDNYFIFTGNVEIHATNMV 60

Query: 76  LQADKMTIDYNNTNRD---------------VSNKINRMDVERNIFIQSGEINVIASNGY 120
              +++ +                          KI R+     + +   +    A    
Sbjct: 61  ATCERLEVYAGKDAEPSAEKKQVKEKEKEEASIGKIERILATGKVRLIQKDRVATAGKAE 120

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRY 177
           +  Q+  +VL     +  ++ +K  T  G ++ +       +++     + +  +  
Sbjct: 121 IYPQEGKVVL----LESPVVTDKQGTLTGYRITLLQGEQKVTVESGAGQRPKITLPQ 173


>gi|281356233|ref|ZP_06242726.1| OstA family protein [Victivallis vadensis ATCC BAA-548]
 gi|281317602|gb|EFB01623.1| OstA family protein [Victivallis vadensis ATCC BAA-548]
          Length = 861

 Score = 61.9 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 55/165 (33%), Gaps = 31/165 (18%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN---NTNRDVSNKINRMDV 101
           +   +D + +     +    GNV + +E+  +  D+MTI  +   +     +N+   ++ 
Sbjct: 188 MTATSDSMLIDMNNNQILLIGNVRVDEENSGVDCDRMTIFIDRRSDQELAGANRTAPVNA 247

Query: 102 ERN---------------------IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           E                          + G+    A +   D +   + L G+      +
Sbjct: 248 EDTLEGVSRILCDGNVVVSRKLTAEEAKEGDQKAFADHMVYDVKTASVTLTGEEKKNPRV 307

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIR----YDGRP 181
                +  G ++++  +   A++ G        +I+       +P
Sbjct: 308 IRGQESLTGQRIVMFREEQRATVTGDCE---ILVIQEPENPGDKP 349



 Score = 43.0 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 16/186 (8%), Positives = 45/186 (24%), Gaps = 45/186 (24%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
            ++A    ++           +K+    V     ++ F   V M  +  +L+ + M +  
Sbjct: 662 SAEARPGALSGMFGNSKSARTLKSGHAVVDMLKNESEFHEKVEMVDDQGTLKCEDMFVYA 721

Query: 86  NNTNRDVSNKINRMDVERN----------------------------------------- 104
             +    +    +   + +                                         
Sbjct: 722 EKSAPAAAQTAAKSAAKPHSPDLPPDDDGFAVEESGSEVPERIELAEGLELSRILCLKDV 781

Query: 105 ----IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
                                    + +++ GD  +K  +        G ++IV +D+  
Sbjct: 782 ELTRRTKTGEVQRAGGQKADYVVADKKIIMTGDDREKPWMSASGGRLKGKRIIVYVDSER 841

Query: 161 ASLQGC 166
             + G 
Sbjct: 842 MEVDGG 847



 Score = 42.2 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 45/143 (31%), Gaps = 3/143 (2%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
                  + + +D+ ++      + F GNV + +   +L+ DKM +         + +  
Sbjct: 345 PGDKPGVMKVNSDIAQMDYRNNYSDFIGNVKVDEPRMTLECDKMRVTLRELAGGPAVESV 404

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
                 +     G          +    R+ ++  D A K++  +K           N  
Sbjct: 405 GDTASLSGLPDFGTTGGKRELDKIKCSGRVKMVRKDDAGKLMPDQKAEASFAD---FNYA 461

Query: 158 TSFASLQGCESDQVQSIIRYDGR 180
                + G E    + +    GR
Sbjct: 462 DRTVRMYGGEPKLTRGLEEMSGR 484



 Score = 42.2 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 18/165 (10%), Positives = 42/165 (25%), Gaps = 30/165 (18%)

Query: 30  AASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTN 89
           +A      +   ++ + I +D  ++        F GNV +      L  D+M +      
Sbjct: 507 SAPAEGAKEQAPSQTV-ITSDESDLNYGGNSLVFTGNVQVRDPRMILDCDRMELVMMPRE 565

Query: 90  RDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLG 149
                +      + +                       ++  G+    V   E       
Sbjct: 566 SAAKAEKKDPAKKADEL----------GGASESKFLSKVICTGN----VHAVEDRMDLKT 611

Query: 150 CKLIVN---------IDTSFASLQGCE------SDQVQSIIRYDG 179
            KL +          ++       G +        +V  + + D 
Sbjct: 612 DKLTLLFRELPPGTVVEPGMFQSNGTQLTKILCDGRVVMVNQPDP 656


>gi|254673983|emb|CBA09767.1| hypothetical protein NMW_2210 [Neisseria meningitidis alpha275]
          Length = 119

 Score = 61.9 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 30/100 (30%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
           L   ++  +AS     +    + I I+AD   +  A Q   F GNV + Q    + A ++
Sbjct: 8   LFVLIAFFSASPAFALQSDSRQPIQIEADQGSLDQANQSTTFSGNVVIRQGTLDISAARV 67

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYV 121
            +       +           +    +             
Sbjct: 68  NVTRGGKGGESVRAEGFASPLQPDIGRRQRHGARTGKQRC 107


>gi|157828533|ref|YP_001494775.1| hypothetical protein A1G_03750 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933248|ref|YP_001650037.1| hypothetical protein RrIowa_0788 [Rickettsia rickettsii str. Iowa]
 gi|157801014|gb|ABV76267.1| hypothetical protein A1G_03750 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908335|gb|ABY72631.1| hypothetical protein RrIowa_0788 [Rickettsia rickettsii str. Iowa]
          Length = 138

 Score = 61.5 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QKA + GNV +  ++  L+  ++ I Y   +   +     +  +  
Sbjct: 26  LHITSDSLIIDRTKQKAAYLGNVIVYFDNVILRTKELYIFYKTIDEKQTIDHIVVPTKLT 85

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +       + L+L G+    VIL+   N     KLI  +D
Sbjct: 86  VERKINNELLLADSAKYFCDNKQLILLGN----VILQRDDNVLKTNKLIYYVD 134


>gi|148260669|ref|YP_001234796.1| OstA family protein [Acidiphilium cryptum JF-5]
 gi|146402350|gb|ABQ30877.1| OstA family protein [Acidiphilium cryptum JF-5]
          Length = 323

 Score = 61.5 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 54/141 (38%), Gaps = 18/141 (12%)

Query: 52  LEVKDAVQKAFFKGNVFMT-QEDFSLQADKMTIDYN-------------NTNRDVSNKIN 97
           L+     +KA   G+  +  ++  S+ AD++T  +                +   ++++ 
Sbjct: 167 LQYWSEARKAVAIGHAKVVGKDGRSVTADRLTGYFTAAPAAPKAGGTPPAGSTAEASQLR 226

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           ++  E ++ + +        +G       I VL G+    V +    N   G    VN+ 
Sbjct: 227 KVVAEGHVVVTTQTDVATGDHGVYHPATGIAVLTGN----VHITHGPNELAGHIAQVNMK 282

Query: 158 TSFASLQGCESDQVQSIIRYD 178
           T  A+L      +V+ +I  D
Sbjct: 283 TGVATLVSAPGHRVEGLILPD 303



 Score = 46.8 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/172 (12%), Positives = 45/172 (26%), Gaps = 31/172 (18%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
            +A S            I I A   +      +    KGN    +   ++ AD++   Y+
Sbjct: 21  ASAQSLGFGTAGGQPAPIDITAQNGISWNQKTRIVTAKGNARAVRGKVTVTADELVAHYS 80

Query: 87  NTN-----------------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
                                        +++I ++D   ++ I +              
Sbjct: 81  PKPASGAAKPTPAAKPDASAGGLGGLDSGASQITQLDAVGHVHIFTATEQAFGDLAVYHM 140

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG-----CESDQ 170
            +  LVL G     +   E +       L    +   A   G      +  +
Sbjct: 141 ARHELVLTGGNLRLITPTETVTATRA--LQYWSEARKAVAIGHAKVVGKDGR 190


>gi|91205591|ref|YP_537946.1| hypothetical protein RBE_0776 [Rickettsia bellii RML369-C]
 gi|91069135|gb|ABE04857.1| unknown [Rickettsia bellii RML369-C]
          Length = 151

 Score = 61.5 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 64/153 (41%), Gaps = 12/153 (7%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           ++++ L    + LV     +  + A    ++          HI +D L +    QKA + 
Sbjct: 1   MSTLLLIYRTIKLVIFFTISISTYADDKDISNL--------HITSDTLIINRVKQKAEYL 52

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +  ++  L+ +++ I Y   +   +     +  + ++  +     ++A +G     
Sbjct: 53  GNVVVYFDNAILRTEELYIFYKTIDNKQTIDYIVVPTKLSVEKKINNELLLADSGKYFLD 112

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
            + L+L G+    V+L+   N     KLI  +D
Sbjct: 113 NKQLILLGN----VVLERNNNILKTNKLIYYVD 141


>gi|258405212|ref|YP_003197954.1| Organic solvent tolerance protein [Desulfohalobium retbaense DSM
           5692]
 gi|257797439|gb|ACV68376.1| Organic solvent tolerance protein [Desulfohalobium retbaense DSM
           5692]
          Length = 784

 Score = 61.5 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 55/156 (35%), Gaps = 16/156 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           L S+H  +  +  +  LL   L    A+ ++  +        ++AD +     +Q     
Sbjct: 3   LFSLHRLLW-ICFLCCLLHFPLEPGFAAPVSGPQTSPETPWEVEADSVSADQDIQLLEAW 61

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           G+V + + +  L+AD +                 + +  N+    G  ++ A     D Q
Sbjct: 62  GDVTLHKGENYLKADYVRYY---------WSTRWVYLRGNVQGNWGGDHLQAEEAEFDLQ 112

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSF 160
            ++  LN    +  I  +  + +   +  V   T  
Sbjct: 113 SKVGWLN----NGTIFVQDPHMYFQGR--VLRKTGT 142


>gi|326403863|ref|YP_004283945.1| hypothetical protein ACMV_17160 [Acidiphilium multivorum AIU301]
 gi|325050725|dbj|BAJ81063.1| hypothetical protein ACMV_17160 [Acidiphilium multivorum AIU301]
          Length = 323

 Score = 61.1 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 54/141 (38%), Gaps = 18/141 (12%)

Query: 52  LEVKDAVQKAFFKGNVFMT-QEDFSLQADKMTIDYN-------------NTNRDVSNKIN 97
           L+     +KA   G+  +  ++  S+ AD++T  +                +   ++++ 
Sbjct: 167 LQYWSEARKAVAIGHAKVLGKDGRSVTADRLTGYFTAAPAAPKAGGTPPAGSTAEASQLR 226

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           ++  E ++ + +        +G       I VL G+    V +    N   G    VN+ 
Sbjct: 227 KVVAEGHVVVTTQTDVATGDHGVYHPATGIAVLTGN----VHITHGPNELAGHIAQVNMK 282

Query: 158 TSFASLQGCESDQVQSIIRYD 178
           T  A+L      +V+ +I  D
Sbjct: 283 TGVATLLSAPGHRVEGLILPD 303



 Score = 48.0 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 48/177 (27%), Gaps = 31/177 (17%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYN 86
            +A S            I I A   +      +    KGN    +   ++ AD++   Y+
Sbjct: 21  ASAQSLGFGTAGGQPAPIDITAQNGISWNQKTRIVTAKGNARAVRGKVTVTADELVAHYS 80

Query: 87  NTN-----------------------RDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
                                        +++I ++D   ++ I +              
Sbjct: 81  PKPASGAAKPTPAAKPDASAGGLGGLDSGASQITQLDAVGHVHIFTATEQAFGDLAVYHM 140

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGR 180
            +  LVL G     +   E +       L    +   A   G        ++  DGR
Sbjct: 141 ARHELVLTGGNLRLITPTETVTATRA--LQYWSEARKAVAIGHAK-----VLGKDGR 190


>gi|288956948|ref|YP_003447289.1| hypothetical protein AZL_001070 [Azospirillum sp. B510]
 gi|288909256|dbj|BAI70745.1| hypothetical protein AZL_001070 [Azospirillum sp. B510]
          Length = 291

 Score = 61.1 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 57/155 (36%), Gaps = 7/155 (4%)

Query: 28  QAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNN 87
           Q A       K++  + +    D LE  +A      +G+    + +  L+AD + I    
Sbjct: 123 QVAVVTGKDLKLITAKDVVTARDSLEYYEAQDLTVARGDAVAVRGNDRLRAD-VLIGRLK 181

Query: 88  TNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF 147
              D ++++ R+D   NI + +     ++          + VL G+    V +    N  
Sbjct: 182 KMPDGTSQMERIDGSGNIIVTTPTDVALSDKLVYSVADNVAVLIGN----VRITRGDNQL 237

Query: 148 LGCKLIVNIDT--SFASLQGCESDQVQSIIRYDGR 180
            G    +N++T  +          +V  ++    +
Sbjct: 238 NGEAAEMNMNTKINRVIAGRDAGGRVSGLLIPADK 272



 Score = 51.5 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 10/144 (6%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADKMT 82
             L+Q              + + I AD  +E    V+    +GN    + + ++ AD +T
Sbjct: 27  PALAQGLPGMGG------KQPVEINADQAIEWHQDVRAYVARGNASAKRNESTVFADVLT 80

Query: 83  IDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKE 142
             Y        N++ ++  + N+ + S    V   +G  D  K++ V+ G   D  ++  
Sbjct: 81  AYYRE-VPGKGNEVFQLVADGNVRVVSPNQQVFGDHGVYDVDKQVAVVTG--KDLKLITA 137

Query: 143 KLNTFLGCKLIVNIDTSFASLQGC 166
           K        L           +G 
Sbjct: 138 KDVVTARDSLEYYEAQDLTVARGD 161


>gi|145640810|ref|ZP_01796392.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           R3021]
 gi|145274324|gb|EDK14188.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           22.4-21]
          Length = 467

 Score = 61.1 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|86609742|ref|YP_478504.1| hypothetical protein CYB_2301 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558284|gb|ABD03241.1| hypothetical protein CYB_2301 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 597

 Score = 61.1 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/151 (11%), Positives = 47/151 (31%), Gaps = 8/151 (5%)

Query: 21  LLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
           LL       A+          ++++ I AD L      Q A  +GN+ + Q +  +++ +
Sbjct: 268 LLADLRLAQASPGPEATPDQQDQEVTIIADRLTYDRNTQIAQGEGNLEIQQGETIIRSAQ 327

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNG-------D 133
            T     +   ++  +   +    +   +          ++     +            +
Sbjct: 328 GTYRRRESQSLLTGGVTLEE-PGRVLTSARLEGNHRDKIFLFEDNVLYRQMATSTPAPSE 386

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQ 164
            +    L++        +L+ N  T  +   
Sbjct: 387 GSLTEELRQAETEVRAARLVYNSRTGTSEFS 417



 Score = 58.4 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/139 (14%), Positives = 46/139 (33%), Gaps = 15/139 (10%)

Query: 38  KVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKIN 97
           +   ++   I AD +E+  A   A F GNV + Q + +++ D+           +S +  
Sbjct: 467 QADVDQPTVIYADRVEIDQASSDARFFGNVVIVQANRAIEGDRADYFDREQIFKISAEQ- 525

Query: 98  RMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
                  +  +     +   +      +  L           +    N   G  + +NI 
Sbjct: 526 ---APVVLCDRGEVGRLPGESTQALPGRNALD---------QMCRGANRLSGKLVTLNIK 573

Query: 158 TSFASLQGCESDQVQSIIR 176
               +++G      Q + +
Sbjct: 574 QDEYTVEGDRQQ--QGMFQ 590



 Score = 46.1 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 55/159 (34%), Gaps = 14/159 (8%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKI--HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
            +  L +A    +      G+      I AD +      Q A  KGN+ + +    ++A 
Sbjct: 178 FQFALLRAEQGKLIVLPPNGSAPTSTTITADQITYDRTNQVAEGKGNLRIRERGIEIRAP 237

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
           + T         +S  +              E+   +S   +    R+   +        
Sbjct: 238 QGTYLRQQAQSILSGGV-----------VLQEVAGDSSRDPLLADLRLAQASPGPEATPD 286

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGC-ESDQVQSIIRY 177
            +++  T +  +L  + +T  A  +G  E  Q ++IIR 
Sbjct: 287 QQDQEVTIIADRLTYDRNTQIAQGEGNLEIQQGETIIRS 325


>gi|309973772|gb|ADO96973.1| LPS assembly OM complex LptDE, protein LptD [Haemophilus influenzae
           R2846]
          Length = 782

 Score = 61.1 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ D
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHND 155


>gi|323495832|ref|ZP_08100900.1| LPS assembly outer membrane complex protein LptD [Vibrio
           sinaloensis DSM 21326]
 gi|323319048|gb|EGA71991.1| LPS assembly outer membrane complex protein LptD [Vibrio
           sinaloensis DSM 21326]
          Length = 771

 Score = 61.1 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 60/192 (31%), Gaps = 32/192 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKV-------------LGNEKIHI 47
           MS F  S  L    ++  F + +          +                     + + +
Sbjct: 1   MSRF--SRTLLAASISAAFFVPQTQAEATLNDSVQELPAIDQCLINEPEPENPNQQPVKV 58

Query: 48  KADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFI 107
           +AD LE      KA +KG+V + Q     QAD++T+               +  E N+  
Sbjct: 59  EADSLEAI-NGNKATYKGDVVVVQGKKRFQADQVTLHEKENI---------IVAEGNVAF 108

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFASL 163
             G +   +     +     + L  +   K + +             K +  +     + 
Sbjct: 109 SDGTVKSQSDKVTNNLTTEDITLE-NTKYKFLCEPGRGDAVYIAKTGKAVYEMKDGSITS 167

Query: 164 --QGCESDQVQS 173
             +G  + ++++
Sbjct: 168 CPEGDNAWRMRA 179


>gi|145634859|ref|ZP_01790567.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           PittAA]
 gi|145268025|gb|EDK08021.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           PittAA]
          Length = 782

 Score = 61.1 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNFLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|319775326|ref|YP_004137814.1| LPS-assembly protein [Haemophilus influenzae F3047]
 gi|317449917|emb|CBY86129.1| LPS-assembly protein [Haemophilus influenzae F3047]
          Length = 782

 Score = 61.1 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQPSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNIKLHNN 155


>gi|145628389|ref|ZP_01784190.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           22.1-21]
 gi|144980164|gb|EDJ89823.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           22.1-21]
          Length = 754

 Score = 61.1 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|83591352|ref|YP_425104.1| hypothetical protein Rru_A0012 [Rhodospirillum rubrum ATCC 11170]
 gi|83574266|gb|ABC20817.1| hypothetical protein Rru_A0012 [Rhodospirillum rubrum ATCC 11170]
          Length = 323

 Score = 60.7 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/170 (15%), Positives = 57/170 (33%), Gaps = 17/170 (10%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNV 67
              I  L +  +L+ A  +  A +          + + + AD  +E +         GN 
Sbjct: 16  SRLIRALGVAALLVLAPTAAGAQTAGG-------QPLEVYADDGIEWRRDEAVYIANGNA 68

Query: 68  FMTQEDFSLQADKMTIDYNNT-------NRDVSNKINRMDVERNIFIQSGEINVIASNGY 120
              Q D  ++AD++   Y          +      I RM+   N+ I   +  +  ++  
Sbjct: 69  AAIQGDSEVRADRLLARYRTDASAGAESSDTGGGDIYRMEAHGNVRILLTDRTITGTDAV 128

Query: 121 VDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQ 170
            D  ++++ L GD                  L    + + A  +G  + +
Sbjct: 129 RDLDRKVMWLTGDNLKME--SASDIVTADDSLEYWEERNLAVARGNATSR 176



 Score = 58.4 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 51/168 (30%), Gaps = 29/168 (17%)

Query: 36  RFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ--EDFSLQADKMTIDYNNTNRDVS 93
             K+     I    D LE  +    A  +GN    Q     ++ AD +T  + + +   +
Sbjct: 142 NLKMESASDIVTADDSLEYWEERNLAVARGNATSRQIASRQTITADVLTAYFKDASTPKT 201

Query: 94  -----------------------NKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
                                  + I  M    N+ + +    +       D       +
Sbjct: 202 AGSAKGKPATSKSGAGLAAPAEGSNIKVMTAVGNVVVVTPNEVIRGDEATYDPTSGQATV 261

Query: 131 NGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            G     V +  +     G +  VN+ T  + L G   D+ +++ +  
Sbjct: 262 LG----AVRITTEGEQLNGTRATVNMKTGVSRLFGDGQDRARALFKPS 305


>gi|229845778|ref|ZP_04465890.1| organic solvent tolerance protein [Haemophilus influenzae 7P49H1]
 gi|229810782|gb|EEP46499.1| organic solvent tolerance protein [Haemophilus influenzae 7P49H1]
          Length = 782

 Score = 60.7 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ D
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHND 155


>gi|145638473|ref|ZP_01794083.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           PittII]
 gi|145272802|gb|EDK12709.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           PittII]
 gi|309751605|gb|ADO81589.1| LPS assembly OM complex LptDE, protein LptD [Haemophilus influenzae
           R2866]
          Length = 782

 Score = 60.7 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|68249331|ref|YP_248443.1| organic solvent tolerance protein [Haemophilus influenzae 86-028NP]
 gi|229844601|ref|ZP_04464740.1| organic solvent tolerance protein [Haemophilus influenzae 6P18H1]
 gi|81336244|sp|Q4QMG4|LPTD_HAEI8 RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|68057530|gb|AAX87783.1| organic solvent tolerance protein [Haemophilus influenzae 86-028NP]
 gi|229812315|gb|EEP48005.1| organic solvent tolerance protein [Haemophilus influenzae 6P18H1]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|16272671|ref|NP_438889.1| organic solvent tolerance protein [Haemophilus influenzae Rd KW20]
 gi|1171927|sp|P44846|LPTD_HAEIN RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|1573734|gb|AAC22389.1| organic solvent tolerance protein [Haemophilus influenzae Rd KW20]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNALPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|145632081|ref|ZP_01787816.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           3655]
 gi|144986988|gb|EDJ93518.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           3655]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNFLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|260579823|ref|ZP_05847653.1| LPS-assembly protein [Haemophilus influenzae RdAW]
 gi|260093107|gb|EEW77040.1| LPS-assembly protein [Haemophilus influenzae RdAW]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNALPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|260583172|ref|ZP_05850952.1| organic solvent tolerance protein [Haemophilus influenzae NT127]
 gi|260093790|gb|EEW77698.1| organic solvent tolerance protein [Haemophilus influenzae NT127]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|301169450|emb|CBW29050.1| exported protein required for envelope biosynthesis and integrity
           [Haemophilus influenzae 10810]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVMTGDVNFLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|145637731|ref|ZP_01793383.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           PittHH]
 gi|145269080|gb|EDK09031.1| organic solvent tolerance protein precursor [Haemophilus influenzae
           PittHH]
          Length = 782

 Score = 60.7 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNITLHNN 155


>gi|290968955|ref|ZP_06560490.1| OstA-like protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290780911|gb|EFD93504.1| OstA-like protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 242

 Score = 60.3 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 53/186 (28%), Gaps = 37/186 (19%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGN 66
              ++   +A++  L    L  AA              I I AD+L      + A   GN
Sbjct: 6   KKMVFSISVAVLCGLPVGVLQAAA------------RPITITADVLAYDGETRVATADGN 53

Query: 67  VFMTQEDFSLQADKMTIDYNNTNRDVSN-------------------KINRMDVERNIFI 107
           V++ Q +  L       +      +VS                    + N +    N+  
Sbjct: 54  VYIRQGETGLTGQHAIYNIKTDVAEVSGNACIVQPDLQVRAAKIEAYQKNHIIAAGNVQA 113

Query: 108 QSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
             G+  +  +       +   ++ G    +     +       ++   +        G  
Sbjct: 114 VKGDKRLQGARVDYYIDRNYGIITGHAFLEA----QGAKIWANRIEAWL--QEVRAVGTG 167

Query: 168 SDQVQS 173
             +V+S
Sbjct: 168 KVRVES 173


>gi|303230987|ref|ZP_07317730.1| OstA-like protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302514369|gb|EFL56368.1| OstA-like protein [Veillonella atypica ACS-049-V-Sch6]
          Length = 239

 Score = 60.3 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 53/164 (32%), Gaps = 25/164 (15%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N    Y+ L  +  +++ +  + AA              + I AD L       +A   
Sbjct: 1   MNK-KKYMGLAVISAMMMLSVTAWAA----------NEGPLTISADTLSYDGNTGRAEAS 49

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +TQ+D ++       +       +   ++ +          G+   +++       
Sbjct: 50  GNVVITQQDKTMTGANGWYNTKTREASLEGGVSMI----------GDNMSMSAQSVHSVN 99

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
                  GD    V L+       G  +  N DT +  + G   
Sbjct: 100 DNQFSAEGD----VHLQRDDRQIFGDSVEYNSDTEYGKVVGNAK 139



 Score = 38.8 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 16/132 (12%), Positives = 36/132 (27%), Gaps = 15/132 (11%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I  D +E     +     GN  +  E  +L  +++              +         
Sbjct: 117 QIFGDSVEYNSDTEYGKVVGNAKLIAEGTTLTGNQVEGWLKEIRAVAQGGVTFN------ 170

Query: 106 FIQSGEINVIASNGYV----DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                 ++  A         +    +++L G         +  N     +L + +  + A
Sbjct: 171 -NPDKNVSGSADRATYTQTPNQNDGVVLLTGSAHA----VQNGNVLNAPELKLYLKDNSA 225

Query: 162 SLQGCESDQVQS 173
              G  S  V +
Sbjct: 226 ETLGGRSTLVIT 237


>gi|303230205|ref|ZP_07316973.1| OstA-like protein [Veillonella atypica ACS-134-V-Col7a]
 gi|302515131|gb|EFL57105.1| OstA-like protein [Veillonella atypica ACS-134-V-Col7a]
          Length = 239

 Score = 60.3 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/164 (15%), Positives = 53/164 (32%), Gaps = 25/164 (15%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N    Y+ L  +  +++ +  + AA              + I AD L       +A   
Sbjct: 1   MNK-KKYMGLAVISAMMMLSVTAWAA----------NEGPLTISADTLSYDGNTGRAEAS 49

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +TQ+D ++       +       +   ++ +          G+   +++       
Sbjct: 50  GNVVITQQDKTMTGANGWYNTKTREASLEGGVSMI----------GDNMSMSAQSVHSVN 99

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCES 168
                  GD    V L+       G  +  N DT +  + G   
Sbjct: 100 DNQFSAEGD----VHLQRDDRQIFGDSVEYNSDTEYGKVVGNAK 139



 Score = 38.4 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 16/132 (12%), Positives = 35/132 (26%), Gaps = 15/132 (11%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I  D +E     +     GN  +  E  +L  +++              +         
Sbjct: 117 QIFGDSVEYNSDTEYGKVVGNAKLIAEGTTLTGNQVEGWLKEIRAVAQGGVTFN------ 170

Query: 106 FIQSGEINVIASNGYV----DFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                 ++  A         +    ++ L G         +  N     +L + +  + A
Sbjct: 171 -NPDKNVSGSADRATYTQTPNQNDGVVFLTGSAHA----VQNGNVLNAPELKLYLKDNSA 225

Query: 162 SLQGCESDQVQS 173
              G  S  V +
Sbjct: 226 ETLGGRSTLVIT 237


>gi|282850058|ref|ZP_06259440.1| OstA-like protein [Veillonella parvula ATCC 17745]
 gi|282580247|gb|EFB85648.1| OstA-like protein [Veillonella parvula ATCC 17745]
          Length = 240

 Score = 60.3 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 54/183 (29%), Gaps = 37/183 (20%)

Query: 4   FLNSIHLY-IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
            +N      + +LA++        +              N+ + I AD L       +A 
Sbjct: 1   MMNKKKQIGMAILAVLMTASVTVWAA-------------NDPLTISADTLSYDGNSGRAD 47

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRD-------------------VSNKINRMDVER 103
             GNV +TQ D ++   K   +      +                    S   N+     
Sbjct: 48  ATGNVVITQADKTMTGAKGWYNTKTQEANLDGGVSMIGSDMAMSAQTVHSYNNNKFTANG 107

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           ++ +Q  +  +   +          ++ G+      L  +  T  G K+   +    A  
Sbjct: 108 SVHLQRADRQIFGDSVEYSTDSEYGLVTGNAR----LIAEGTTLTGDKVEGWMKEVRAVA 163

Query: 164 QGC 166
           QG 
Sbjct: 164 QGN 166


>gi|313892388|ref|ZP_07825980.1| OstA-like protein [Dialister microaerophilus UPII 345-E]
 gi|313119247|gb|EFR42447.1| OstA-like protein [Dialister microaerophilus UPII 345-E]
          Length = 234

 Score = 60.3 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/163 (12%), Positives = 52/163 (31%), Gaps = 29/163 (17%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + +I+  I ++   F+ + +  +                   I AD L      +     
Sbjct: 1   MKNIYKLITVIIFTFLSVGSVFAA-----------------DITADELVYDSQTKTVSAT 43

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +   + ++       D+N+    +S  +N    +    +    + + +        
Sbjct: 44  GNVVINDGESTITGASGKYDFNDKTAILSGGVN--YTKNQDTLSCETLYIYSDK------ 95

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
                +NG    ++  K +     G ++  N +T    + G  
Sbjct: 96  ----TINGKGNVELDFKSENIFLSGDEISYNQNTGIGQINGNG 134


>gi|157964549|ref|YP_001499373.1| hypothetical protein RMA_0666 [Rickettsia massiliae MTU5]
 gi|157844325|gb|ABV84826.1| hypothetical protein RMA_0666 [Rickettsia massiliae MTU5]
          Length = 194

 Score = 59.9 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 58/149 (38%), Gaps = 14/149 (9%)

Query: 9   HLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVF 68
            + I  L L+F++     +                 +HI +D L +    QKA +  NV 
Sbjct: 56  KMSIIKLVLLFIISTIIYANDKNISN----------LHITSDSLIIDRTKQKAAYLENVI 105

Query: 69  MTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRIL 128
           +  ++  L+  ++ I Y   +   +     +  +  +  +     ++A +    F  + L
Sbjct: 106 VYFDNAILRTKELYIFYKTIDEKQTIDHIVVPTKLTVERKINNELLLADSAKYFFDNKQL 165

Query: 129 VLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +L G+    VIL+   N     KLI  +D
Sbjct: 166 ILLGN----VILQRDDNVLKTNKLIYYVD 190


>gi|229525139|ref|ZP_04414544.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae bv. albensis VL426]
 gi|229338720|gb|EEO03737.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae bv. albensis VL426]
          Length = 782

 Score = 59.9 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 62/194 (31%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---------------NEKI 45
           M   ++         ++   L    +   A+    R ++                  + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPGQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.8 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|294795170|ref|ZP_06760304.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
 gi|294453962|gb|EFG22337.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
          Length = 240

 Score = 59.9 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 54/183 (29%), Gaps = 37/183 (20%)

Query: 4   FLNSIHLY-IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
            +N      + +LA++        +              N+ + I AD L       +A 
Sbjct: 1   MMNKKKQIGMAILAVLMTASVTVWAA-------------NDPLTISADTLSYDGNSGRAD 47

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRD-------------------VSNKINRMDVER 103
             GNV +TQ D ++   K   +      +                    S   N+     
Sbjct: 48  ATGNVVITQADKTMTGAKGWYNTKTQEANLDGGVSMIGSDMAMSAQTVHSYNNNKFTANG 107

Query: 104 NIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASL 163
           ++ +Q  +  +   +          ++ G+      L  +  T  G K+   +    A  
Sbjct: 108 SVHLQRADRQIFGDSVEYSTDSEYGLVTGNAR----LIAEGTTLTGDKVEGWMKEVRAVA 163

Query: 164 QGC 166
           QG 
Sbjct: 164 QGN 166


>gi|313894684|ref|ZP_07828247.1| OstA-like protein [Veillonella sp. oral taxon 158 str. F0412]
 gi|313440874|gb|EFR59303.1| OstA-like protein [Veillonella sp. oral taxon 158 str. F0412]
          Length = 231

 Score = 59.6 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/155 (13%), Positives = 48/155 (30%), Gaps = 27/155 (17%)

Query: 12  IHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQ 71
           + +LA++        +              N+ + I AD L       +A   GNV +TQ
Sbjct: 1   MAILAVLMTASVTAWAA-------------NDPLTISADTLSYDGNTGRADATGNVVITQ 47

Query: 72  EDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLN 131
            D ++       +       +   ++ +          G    +++     +       +
Sbjct: 48  ADKTMTGANGWYNTKTQEASLEGGVSLI----------GSDMAMSAQSVHSYNNNKFTAS 97

Query: 132 GDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           G     V L+       G  +  + D+ +  + G 
Sbjct: 98  G----GVHLQRGDRQIFGDSVEYSTDSEYGLVSGN 128


>gi|298370561|ref|ZP_06981876.1| organic solvent tolerance protein [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281171|gb|EFI22661.1| organic solvent tolerance protein [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 804

 Score = 59.6 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 53/195 (27%), Gaps = 29/195 (14%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKAD------------ 50
           A L S+   +  L + F     +     A+                +             
Sbjct: 2   ARLFSLKPLVFALGVGFGAAATNAQNIGAAASAPGTADYYRPSETASSPKPARNLSLGTT 61

Query: 51  -----MLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
                   V+   +     GN      +  L AD   +  +            +  E ++
Sbjct: 62  CLFCSHETVQAEARALGLTGNPVRRSGEDPLPADYTRVTADQ---IQGKTKVAVRAEGDV 118

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
            I+  +  + A     D     +       +K  L +  +T  G K+  N+  S      
Sbjct: 119 IIERNDEILNAQWADYDQAANTVT----AGNKFKLAQNGSTVSGNKITYNLTDST----- 169

Query: 166 CESDQVQSIIRYDGR 180
             SD V+     +GR
Sbjct: 170 GTSDYVRVDAEQEGR 184


>gi|258627056|ref|ZP_05721854.1| LPS-assembly protein precursor [Vibrio mimicus VM603]
 gi|258580730|gb|EEW05681.1| LPS-assembly protein precursor [Vibrio mimicus VM603]
          Length = 780

 Score = 59.6 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 53/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTF----LGCKLIVNI 156
            E N+    GEI  +++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNSDEMTLE-NTRYQFLCEPGRGEVVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G  + ++++
Sbjct: 161 EDGSITSCPEGDNAWRMRA 179


>gi|329122678|ref|ZP_08251256.1| LPS-assembly protein [Haemophilus aegyptius ATCC 11116]
 gi|327472552|gb|EGF17982.1| LPS-assembly protein [Haemophilus aegyptius ATCC 11116]
          Length = 782

 Score = 59.6 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 56/162 (34%), Gaps = 16/162 (9%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H  I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHTLISLAILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNSLPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +     + + S  +    V      +  +IN++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQV---KQSGNQSTPLRMAYVRNGFDYKDNQINML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
             +   +       L  +   + + ++         + ++ +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADNIKLHNN 155


>gi|220907913|ref|YP_002483224.1| OstA family protein [Cyanothece sp. PCC 7425]
 gi|219864524|gb|ACL44863.1| OstA family protein [Cyanothece sp. PCC 7425]
          Length = 164

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/162 (13%), Positives = 48/162 (29%), Gaps = 40/162 (24%)

Query: 20  VLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQAD 79
           ++    ++    S          + + +KAD+ +          +GNV +      +Q  
Sbjct: 34  LIRPGAIASLPFSSPIARAEAPQQALTLKADIQQANANTGVVTARGNVQLIYPARQIQ-- 91

Query: 80  KMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVI 139
                                               A       ++R +VL+G+    V 
Sbjct: 92  ----------------------------------ATAFQAQYFSRERRIVLSGN----VY 113

Query: 140 LKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDGRP 181
           + ++ N+     +   ID          + QV+S+I+    P
Sbjct: 114 VLQQGNSLRAETVTYLIDEGRFVALPTPNRQVESVIQLRDNP 155


>gi|319760192|ref|YP_004124130.1| lipopolysaccharide transport periplasmic protein [Candidatus
           Blochmannia vafer str. BVAF]
 gi|318038906|gb|ADV33456.1| lipopolysaccharide transport periplasmic protein [Candidatus
           Blochmannia vafer str. BVAF]
          Length = 171

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 54/149 (36%), Gaps = 9/149 (6%)

Query: 32  SYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRD 91
           S + +     N+ I I +    +        FK +V +  ++  L ADK+ I++N  N  
Sbjct: 22  STLEKIANSNNQSIEIHSTSQLINTPENIIIFKDHVVLKYKNIRLCADKIIINHNTNNYK 81

Query: 92  VSNKINRMDVERNIFIQSGE-----INVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
           +   I              +      +  A+    D +   ++ NG+    V +K+  N+
Sbjct: 82  LIKCIKAYGHPVIFQNTQKKTSDIITSAQANTICYDIENNSIIFNGN----VYIKQLGNS 137

Query: 147 FLGCKLIVNIDTSFASLQGCESDQVQSII 175
                ++ +I+          +    +I+
Sbjct: 138 IHSDNIVYSINEKKIQATSNTNGNTTAIL 166


>gi|269797611|ref|YP_003311511.1| OstA family protein [Veillonella parvula DSM 2008]
 gi|269094240|gb|ACZ24231.1| OstA family protein [Veillonella parvula DSM 2008]
          Length = 239

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 53/180 (29%), Gaps = 36/180 (20%)

Query: 6   NSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKG 65
               + + +LA++        +              N+ + I AD L       +A   G
Sbjct: 3   KKKQIGMAILAVLMTASVTVWAA-------------NDPLTISADTLSYDGNSGRADATG 49

Query: 66  NVFMTQEDFSLQADKMTIDYNNTNRD-------------------VSNKINRMDVERNIF 106
           NV +TQ D ++   K   +      +                    S   N+     ++ 
Sbjct: 50  NVVITQADKTMTGAKGWYNTKTQEANLDGGVSMIGSDMAMSAQAVHSYNNNKFTANGSVH 109

Query: 107 IQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGC 166
           +Q  +  +   +          ++ G+      L  +  T  G K+   +    A  QG 
Sbjct: 110 LQRADRQIFGDSVEYSTDSEYGLVTGNAR----LIAEGTTLTGDKVEGWMKEVRAVAQGN 165


>gi|153824294|ref|ZP_01976961.1| organic solvent tolerance protein [Vibrio cholerae B33]
 gi|126518183|gb|EAZ75408.1| organic solvent tolerance protein [Vibrio cholerae B33]
          Length = 281

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 51/139 (36%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI   ++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +    G  + ++++
Sbjct: 161 EDGSITSCPDGDNAWRMRA 179



 Score = 38.8 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 85  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 144

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 145 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 193


>gi|254227130|ref|ZP_04920675.1| organic solvent tolerance protein [Vibrio cholerae V51]
 gi|125620344|gb|EAZ48733.1| organic solvent tolerance protein [Vibrio cholerae V51]
          Length = 707

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 62/194 (31%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---------------NEKI 45
           M   ++         ++   L    +   A+    R ++                  + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPGQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.4 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|108757302|ref|YP_629320.1| hypothetical protein MXAN_1059 [Myxococcus xanthus DK 1622]
 gi|108461182|gb|ABF86367.1| hypothetical protein MXAN_1059 [Myxococcus xanthus DK 1622]
          Length = 208

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 42/143 (29%), Gaps = 11/143 (7%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKM 81
                     +          E + I  D +       +A   GNV +      L+ D+M
Sbjct: 34  SAPSAGTGTRAPGPLGGKELTEPVQINGDNVTF--QKSQATLTGNVKVKHRTLDLKCDRM 91

Query: 82  TIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK 141
           T +Y         ++ R+     +    G+          D    +LV+ G    +    
Sbjct: 92  TANYTPQ-----REVTRVVCTGGVHAVDGDRMAKGERAEYDVPSGVLVVTGSPEAR---- 142

Query: 142 EKLNTFLGCKLIVNIDTSFASLQ 164
           +      G K+ + +      ++
Sbjct: 143 QGTTHMRGTKVRLTLGNERLEVE 165


>gi|229512624|ref|ZP_04402093.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TMA 21]
 gi|229350301|gb|EEO15252.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TMA 21]
          Length = 787

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 62/194 (31%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---------------NEKI 45
           M   ++         ++   L    +   A+    R ++                  + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPGQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.4 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|229519984|ref|ZP_04409413.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TM 11079-80]
 gi|229342933|gb|EEO07922.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae TM 11079-80]
          Length = 787

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 59/194 (30%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASY---------------MTRFKVLGNEKI 45
           M   ++         ++   L    +   A+                          + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPSQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.4 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|153827428|ref|ZP_01980095.1| organic solvent tolerance protein [Vibrio cholerae MZO-2]
 gi|149738671|gb|EDM53014.1| organic solvent tolerance protein [Vibrio cholerae MZO-2]
          Length = 622

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 51/139 (36%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 46  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 95

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI   ++          + L  +   + + +             K +  I
Sbjct: 96  AEGNVQFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 154

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +    G  + ++++
Sbjct: 155 EDGSITSCPDGDNAWRMRA 173



 Score = 38.8 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 79  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 138

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 139 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 187


>gi|15640473|ref|NP_230100.1| organic solvent tolerance protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121729960|ref|ZP_01682380.1| organic solvent tolerance protein [Vibrio cholerae V52]
 gi|147675099|ref|YP_001218714.1| organic solvent tolerance protein [Vibrio cholerae O395]
 gi|153820174|ref|ZP_01972841.1| organic solvent tolerance protein [Vibrio cholerae NCTC 8457]
 gi|229507085|ref|ZP_04396591.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae BX 330286]
 gi|229508760|ref|ZP_04398252.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae B33]
 gi|229519747|ref|ZP_04409190.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC9]
 gi|229606259|ref|YP_002876907.1| organic solvent tolerance protein [Vibrio cholerae MJ-1236]
 gi|254850677|ref|ZP_05240027.1| organic solvent tolerance protein [Vibrio cholerae MO10]
 gi|297580586|ref|ZP_06942512.1| organic solvent tolerance protein [Vibrio cholerae RC385]
 gi|298501022|ref|ZP_07010823.1| organic solvent tolerance protein [Vibrio cholerae MAK 757]
 gi|9654870|gb|AAF93619.1| organic solvent tolerance protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121628300|gb|EAX60810.1| organic solvent tolerance protein [Vibrio cholerae V52]
 gi|126509284|gb|EAZ71878.1| organic solvent tolerance protein [Vibrio cholerae NCTC 8457]
 gi|146316982|gb|ABQ21521.1| organic solvent tolerance protein [Vibrio cholerae O395]
 gi|227012300|gb|ACP08510.1| organic solvent tolerance protein [Vibrio cholerae O395]
 gi|229344436|gb|EEO09411.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC9]
 gi|229354163|gb|EEO19094.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae B33]
 gi|229355830|gb|EEO20750.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae BX 330286]
 gi|229368914|gb|ACQ59337.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae MJ-1236]
 gi|254846382|gb|EET24796.1| organic solvent tolerance protein [Vibrio cholerae MO10]
 gi|297535002|gb|EFH73837.1| organic solvent tolerance protein [Vibrio cholerae RC385]
 gi|297540270|gb|EFH76330.1| organic solvent tolerance protein [Vibrio cholerae MAK 757]
          Length = 787

 Score = 59.2 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 62/194 (31%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---------------NEKI 45
           M   ++         ++   L    +   A+    R ++                  + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPGQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.4 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|229530290|ref|ZP_04419678.1| imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae 12129(1)]
 gi|229332063|gb|EEN97551.1| imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae 12129(1)]
          Length = 787

 Score = 59.2 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 62/194 (31%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---------------NEKI 45
           M   ++         ++   L    +   A+    R ++                  + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPGQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.4 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|227080657|ref|YP_002809208.1| organic solvent tolerance protein [Vibrio cholerae M66-2]
 gi|227008545|gb|ACP04757.1| organic solvent tolerance protein [Vibrio cholerae M66-2]
          Length = 799

 Score = 59.2 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 62/194 (31%), Gaps = 32/194 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLG---------------NEKI 45
           M   ++         ++   L    +   A+    R ++                  + I
Sbjct: 1   MYNPMSCFSRTFLAASISAALFAPQIQAEASVDDNRAQLPNGEQCLVNQPEPTNPGQQPI 60

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
           +++AD LE     QKA + GNV + Q    + AD +T+               +  E N+
Sbjct: 61  NVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VVAEGNV 110

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNIDTSFA 161
               GEI   ++          + L  +   + + +             K +  I+    
Sbjct: 111 QFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEIEDGSI 169

Query: 162 SL--QGCESDQVQS 173
           +    G  + ++++
Sbjct: 170 TSCPDGDNAWRMRA 183



 Score = 38.4 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 89  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 148

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 149 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 197


>gi|153803548|ref|ZP_01958134.1| organic solvent tolerance protein [Vibrio cholerae MZO-3]
 gi|124120915|gb|EAY39658.1| organic solvent tolerance protein [Vibrio cholerae MZO-3]
          Length = 766

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 51/139 (36%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI   ++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +    G  + ++++
Sbjct: 161 EDGSITSCPDGDNAWRMRA 179



 Score = 38.8 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 85  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 144

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 145 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 193


>gi|298530257|ref|ZP_07017659.1| Organic solvent tolerance protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509631|gb|EFI33535.1| Organic solvent tolerance protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 758

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 50/165 (30%), Gaps = 30/165 (18%)

Query: 4   FLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFF 63
            L  I+L   +     +L+                   +E   ++AD + V         
Sbjct: 1   MLYKINLAFFIFLAGMLLIAGCSWA------------SDEPWELEADQMYVDQEKNLVEA 48

Query: 64  KGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDF 123
            GNV M + D  +QAD   +  +            + ++ NI  +    ++      +D 
Sbjct: 49  FGNVLMWRMDDYVQADYARLHTDTN---------WIYLKGNIQARFEGDHIEGREAELDL 99

Query: 124 QKRILVLNGDRADKVILKEKLNTFLGCKL------IVNIDTSFAS 162
              +  +      KV + +    F G ++          +    +
Sbjct: 100 DNHVGWIK---EGKVFMAQDNVYFSGERMEKTGPHTYTYEDGIMT 141


>gi|329121343|ref|ZP_08249969.1| OstA family protein [Dialister micraerophilus DSM 19965]
 gi|327469752|gb|EGF15218.1| OstA family protein [Dialister micraerophilus DSM 19965]
          Length = 234

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/163 (12%), Positives = 51/163 (31%), Gaps = 29/163 (17%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           + +I+  I ++    + + +  +                   I AD L      +     
Sbjct: 1   MKNIYKLITVIIFTLLSVGSVFAA-----------------DITADELVYDSQTKTVSAT 43

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +   + ++       D+N+    +S  +N    +    +    + + +        
Sbjct: 44  GNVVINDGESTITGASGKYDFNDKTAILSGGVN--YTKNQDTLSCETLYIYSDK------ 95

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCE 167
                +NG    ++  K +     G ++  N +T    + G  
Sbjct: 96  ----TINGKGNVELDFKSENIFLSGDEISYNQNTGIGQINGNG 134


>gi|157827305|ref|YP_001496369.1| hypothetical protein A1I_04995 [Rickettsia bellii OSU 85-389]
 gi|157802609|gb|ABV79332.1| hypothetical protein A1I_04995 [Rickettsia bellii OSU 85-389]
          Length = 146

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 51/113 (45%), Gaps = 4/113 (3%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERN 104
           +HI +D L +    QK  + GNV +  ++  L+ +++ I Y   +   +     +  + +
Sbjct: 28  LHITSDTLIINRVKQKVEYLGNVVVYFDNAILRTEELYIFYKTIDNKQTIDYIVVPTKLS 87

Query: 105 IFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           +  +     ++A +G      + L+L G+    V+L+   N     KLI  +D
Sbjct: 88  VEKKINNELLLADSGKYFLDNKQLILLGN----VVLERNNNILKTNKLIYYVD 136


>gi|260775522|ref|ZP_05884419.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608703|gb|EEX34868.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio coralliilyticus ATCC BAA-450]
          Length = 789

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 52/139 (37%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
               I+++AD LE      KA + GNV + Q    ++AD +T+   +           + 
Sbjct: 61  NQLPINVEADSLEAI-NGDKATYSGNVTVVQGKKRMKADNVTLHQQDNI---------VV 110

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GE+  I+           + L  +   K + +             K +  I
Sbjct: 111 AEGNVTFSDGELKTISDKAVNKLNTEEVTLE-NTNYKFLCEPGRGEAVYVSKTGKAVYEI 169

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G +S ++++
Sbjct: 170 EDGTITSCPEGDKSWRMKA 188


>gi|51473689|ref|YP_067446.1| hypothetical protein RT0492 [Rickettsia typhi str. Wilmington]
 gi|51460001|gb|AAU03964.1| rickettsial conserved hypothetical protein [Rickettsia typhi str.
           Wilmington]
          Length = 143

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 61/155 (39%), Gaps = 17/155 (10%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAF 62
           +  +SI+  I L+  + V +    +              +  + I A+ L +    QKA 
Sbjct: 2   SLQSSIYRIIKLIIFLTVNISIASA-------------KDTNLQITANTLIIDRIKQKAE 48

Query: 63  FKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122
           + GNV +  ++  L+  K+ I Y         +   +  +  +  +     ++A +    
Sbjct: 49  YSGNVIIYFDNAILKTQKLYIFYKTIAEKKIIEHIVVPTKLTVERKINNELLLADSAKYF 108

Query: 123 FQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID 157
           F  + L+L G+    VIL+   +     KLI  ++
Sbjct: 109 FVDKQLILLGN----VILQRNDHVLKTNKLIYYVE 139


>gi|255743829|ref|ZP_05417786.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholera CIRS 101]
 gi|262147182|ref|ZP_06027988.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae INDRE 91/1]
 gi|262167590|ref|ZP_06035294.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC27]
 gi|67477419|sp|Q9KUR9|LPTD_VIBCH RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|255738578|gb|EET93966.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholera CIRS 101]
 gi|262023926|gb|EEY42623.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae RC27]
 gi|262031387|gb|EEY49995.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio cholerae INDRE 91/1]
          Length = 783

 Score = 58.8 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 51/139 (36%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI   ++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +    G  + ++++
Sbjct: 161 EDGSITSCPDGDNAWRMRA 179



 Score = 38.4 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 85  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 144

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 145 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 193


>gi|262403928|ref|ZP_06080485.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC586]
 gi|262349890|gb|EEY99026.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC586]
          Length = 780

 Score = 58.8 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 51/139 (36%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI   ++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTHSTKATNHLNTDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +    G  + ++++
Sbjct: 161 EDGSITSCPDGDNAWRMRA 179



 Score = 38.4 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 30/120 (25%), Gaps = 13/120 (10%)

Query: 46  HIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNI 105
            I AD + +         +GNV  +  +    + K T   N     + N   +   E   
Sbjct: 85  RIAADNVTLHQQENVVVAEGNVQFSDGEIKTHSTKATNHLNTDEMTLENTRYQFLCEPGR 144

Query: 106 FIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN--TFLGCKLIVNIDTSFASL 163
                             +    V   +        +  N        + V+ +   A+ 
Sbjct: 145 -----------GEAVYVSKTGKAVYEIEDGSITSCPDGDNAWRMRASSIDVDQNEEIATF 193


>gi|206602319|gb|EDZ38800.1| Protein of unknown function [Leptospirillum sp. Group II '5-way
           CG']
          Length = 209

 Score = 58.4 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/172 (15%), Positives = 58/172 (33%), Gaps = 22/172 (12%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH--IKADMLEVKDAVQKAFFK 64
             H    +  ++F L+                    + +   I AD +  ++   +  F 
Sbjct: 22  KRHALRSVAVVIFFLVLPGFFFLHVGSAWG-----EQPVSTVINADRMLAENIQNEIHFV 76

Query: 65  GNVFMTQEDFSLQADKMTIDY-----------NNTNRDVSNKINRMDVERNIFIQSGEIN 113
           G+V + +++  L++D + + +           N   R  S KI  M    +++I+ G   
Sbjct: 77  GHVHLVKKNLVLKSDNLDVFFVPPSRGATLMDNMHARQKSQKIQTMIATGHVYIKKGNRI 136

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
             A       Q    VL        ++ +  +   G K+        + +QG
Sbjct: 137 AYAGKAVYIAQGHYFVLT----RLPVVIQNGDRISGEKITFFTRIDKSLVQG 184


>gi|33519525|ref|NP_878357.1| hypothetical protein Bfl043 [Candidatus Blochmannia floridanus]
 gi|33517188|emb|CAD83570.1| OstA-like protein (organic solvent tolerance) [Candidatus
           Blochmannia floridanus]
          Length = 168

 Score = 58.4 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 45/133 (33%), Gaps = 6/133 (4%)

Query: 45  IHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVS--NKINRMDVE 102
           I I ++   +        F  NV    ++  L ADK+ I +N      S           
Sbjct: 34  IEIHSEYQSINKLTNVIHFTDNVICKYKNIKLYADKVIITHNQKKYKSSILTAYGHPATI 93

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
             I       +  A   + D    I+  +G+   K +     N+     +I +I+     
Sbjct: 94  HYIQTSKNITSASAEVIFFDSIDNIITFSGNAHIKYL----GNSIYSDNIIYSINQKKIQ 149

Query: 163 LQGCESDQVQSII 175
               +++Q  +I+
Sbjct: 150 AISNQNNQTTTIL 162


>gi|302342254|ref|YP_003806783.1| OstA family protein [Desulfarculus baarsii DSM 2075]
 gi|301638867|gb|ADK84189.1| OstA family protein [Desulfarculus baarsii DSM 2075]
          Length = 774

 Score = 58.4 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/166 (15%), Positives = 59/166 (35%), Gaps = 16/166 (9%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           + + + AL+       L+Q+        ++  +  + ++AD L   D       +G V +
Sbjct: 14  VLMIVAALLVFSAGPALAQSNEL----VRLETSTPVDVRADKLTYDDKTNSYLAEGEVEI 69

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINRMDVER-----NIFIQSGEINVIASNGYVDFQ 124
           TQ    L ADK+ +   +   +    ++ +   +     ++ +          +  +   
Sbjct: 70  TQGANRLVADKVRLFSQSMIAEAEGNVSMVSPSQVVSAASLVVNLNTSTGKLYDARIFLP 129

Query: 125 KRILVLNGDRADKVILKEKLNTFL---GCKLIVNIDTSFASLQGCE 167
                L G    + I+K   +T+    G     + D+    + G E
Sbjct: 130 ATHYYLRG----EEIVKTGEDTYTMAQGGFTTCDGDSPNWEVTGSE 171


>gi|269104091|ref|ZP_06156788.1| cell envelope biogenesis YhbN [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163989|gb|EEZ42485.1| cell envelope biogenesis YhbN [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 115

 Score = 58.4 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/112 (12%), Positives = 38/112 (33%), Gaps = 6/112 (5%)

Query: 69  MTQEDFSLQADKMTIDYN--NTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKR 126
           M Q    ++A+K+ +        ++  +          +      I+  A     +    
Sbjct: 1   MRQGSIDIRANKVVVTRPQGKEGQETIDAYGTPATFHQVMDDGKPIDGSARKMRYETATE 60

Query: 127 ILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYD 178
            L ++    D  +L +  +   G  +   ID      +    ++V +I++ +
Sbjct: 61  FLKMS----DHAVLTQDGSEIKGNVITYKIDEQRLMAKSGSKERVTTILQPN 108


>gi|319897766|ref|YP_004135963.1| lps-assembly protein [Haemophilus influenzae F3031]
 gi|317433272|emb|CBY81647.1| LPS-assembly protein [Haemophilus influenzae F3031]
          Length = 782

 Score = 58.4 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 53/157 (33%), Gaps = 16/157 (10%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNE---------KIHIKADMLEVK 55
           +N  H+ I L  L  +  +  L+      +        E          ++I+AD  E+ 
Sbjct: 1   MNKKHILISLPILTALYSQQSLADLHEQCLMGVPKFSGEVVTGDVNALPVYIEADNAEIN 60

Query: 56  DAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVI 115
                A ++GNV + Q +  L A  + +  +         +  + V      +  +I+++
Sbjct: 61  Q-PNDATYQGNVDLKQGNRHLLAQSVQVKQSENQPTP---LRMVYVRNGFDYKDNQIHML 116

Query: 116 ASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKL 152
             +   +       L  +   + + ++         +
Sbjct: 117 GKDAEFNLDSHDGNLT-NSEYEFVGRQGRG--KADDI 150


>gi|78212776|ref|YP_381555.1| hypothetical protein Syncc9605_1245 [Synechococcus sp. CC9605]
 gi|78197235|gb|ABB35000.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 145

 Score = 58.0 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/167 (11%), Positives = 41/167 (24%), Gaps = 46/167 (27%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +  I  +   L L+ +      +QA               I I++D+    +        
Sbjct: 1   MLRIGGFCLALPLLAIFWPLVSAQAQQMADAGV-------ITIESDLQSADNGTGVITAS 53

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV +      L                                       +       +
Sbjct: 54  GNVRLVHAGRGL------------------------------------VATSRQAQYFTE 77

Query: 125 KRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQV 171
           +  +VL+GD     +++   N     +    ++   A        QV
Sbjct: 78  EDRIVLSGDVD---VIQANGNQLRADRFTYLLEEGRAIASPVPGQQV 121


>gi|258542095|ref|YP_003187528.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633173|dbj|BAH99148.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636230|dbj|BAI02199.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639285|dbj|BAI05247.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642339|dbj|BAI08294.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645394|dbj|BAI11342.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648449|dbj|BAI14390.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651502|dbj|BAI17436.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654493|dbj|BAI20420.1| organic solvent tolerance protein [Acetobacter pasteurianus IFO
           3283-12]
          Length = 775

 Score = 58.0 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 46/144 (31%), Gaps = 8/144 (5%)

Query: 14  LLALVFVLLKADLSQAAASYM---TRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMT 70
              L+F L K   +Q     M   T      +E    +AD ++  D      + GNV + 
Sbjct: 27  AACLLFSLPKHAHAQFRPQVMHLDTGRPTSPDEPATFQADKVDYNDVEHTVTWTGNVQVW 86

Query: 71  QEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVL 130
           Q D  L+AD++  D +         +  +  + ++                     ++ +
Sbjct: 87  QGDHVLRADRIVYDRDTGVMAARGNVATIQPDGSVLYTHYAELSGGMK-----DGIMMHV 141

Query: 131 NGDRADKVILKEKLNTFLGCKLIV 154
           N    D   L          K+ V
Sbjct: 142 NATMQDNAKLAANGLRRTAGKINV 165



 Score = 50.7 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 9/78 (11%), Positives = 24/78 (30%), Gaps = 9/78 (11%)

Query: 102 ERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFA 161
                         A     +  +  +   G+    V + +  +     +++ + DT   
Sbjct: 51  TGRPTSPDEPATFQADKVDYNDVEHTVTWTGN----VQVWQGDHVLRADRIVYDRDTGVM 106

Query: 162 SLQGCESDQVQSIIRYDG 179
           + +G       + I+ DG
Sbjct: 107 AARGNV-----ATIQPDG 119


>gi|258623408|ref|ZP_05718412.1| LPS-assembly protein precursor [Vibrio mimicus VM573]
 gi|258584374|gb|EEW09119.1| LPS-assembly protein precursor [Vibrio mimicus VM573]
          Length = 780

 Score = 58.0 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 53/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI  +++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNSDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G  + ++++
Sbjct: 161 EDGSITSCPEGDNAWRMRA 179


>gi|262172453|ref|ZP_06040131.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus MB-451]
 gi|261893529|gb|EEY39515.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus MB-451]
          Length = 753

 Score = 58.0 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 53/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 25  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 74

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI  +++          + L  +   + + +             K +  I
Sbjct: 75  AEGNVQFSDGEIKTLSTKATNHLNSDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 133

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G  + ++++
Sbjct: 134 EDGSITSCPEGDNAWRMRA 152


>gi|262164101|ref|ZP_06031840.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus VM223]
 gi|262027629|gb|EEY46295.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio mimicus VM223]
          Length = 780

 Score = 58.0 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 53/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI  +++          + L  +   + + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNSDEMTLE-NTRYQFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +   +G  + ++++
Sbjct: 161 EDGSITSCPEGDNAWRMRA 179


>gi|298492657|ref|YP_003722834.1| OstA family protein ['Nostoc azollae' 0708]
 gi|298234575|gb|ADI65711.1| OstA family protein ['Nostoc azollae' 0708]
          Length = 165

 Score = 57.6 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 51/172 (29%), Gaps = 39/172 (22%)

Query: 8   IHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNV 67
           +H     L L   LL      +     T     GN  + I++D+ E     Q    +GNV
Sbjct: 12  MHRLALSLMLPVALLGVVSLPSQVPTATAQSAGGNRPLSIRSDVQEYDAKTQVITARGNV 71

Query: 68  FMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRI 127
            M      LQA      Y                                      ++R 
Sbjct: 72  QMLYPARQLQATAAQAQY------------------------------------FSKERR 95

Query: 128 LVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
           +  +G+     IL++  N+    K+   ID          + QV+S+   D 
Sbjct: 96  IDFSGNVY---ILQQGNNSIRAEKVTYLIDEGRFIALPQSNRQVESVYMVDD 144


>gi|152978020|ref|YP_001343649.1| organic solvent tolerance protein [Actinobacillus succinogenes
           130Z]
 gi|150839743|gb|ABR73714.1| Organic solvent tolerance protein [Actinobacillus succinogenes
           130Z]
          Length = 793

 Score = 57.6 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 55/156 (35%), Gaps = 17/156 (10%)

Query: 3   AFLNSIHLYIHLLALVFVLLKADLSQA---------AASYMTRFKVLGN---EKIHIKAD 50
           A  +S + +I L  L  +      + A              T   V G+   + ++I+AD
Sbjct: 6   AMKHSSYSFISLAILTALYSGGAWANADNLHRRCLSGVPQFTGEPVSGDANEQPVYIEAD 65

Query: 51  MLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG 110
             ++     +A + G+V + Q +  LQA ++ +         +N +           +  
Sbjct: 66  SADII-NPSRATYSGDVDIKQGNRHLQAPQVVVTQKGE---GANALRHAYANGAFNYRDE 121

Query: 111 EINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
            I +   N  ++       +  +   + + ++   T
Sbjct: 122 LILLKGENARINLNNNDADIT-NSDYQFVGRQGRGT 156


>gi|323493623|ref|ZP_08098744.1| LPS assembly outer membrane complex protein LptD [Vibrio
           brasiliensis LMG 20546]
 gi|323312146|gb|EGA65289.1| LPS assembly outer membrane complex protein LptD [Vibrio
           brasiliensis LMG 20546]
          Length = 788

 Score = 57.6 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 55/143 (38%), Gaps = 18/143 (12%)

Query: 38  KVLGNE-KIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKI 96
               N+  ++++AD LE      KA ++GNV + Q    +QAD +T+   +         
Sbjct: 48  PDNPNQLPVNVEADSLEAI-NGDKATYRGNVVVVQGKKRMQADNVTLHQQDNI------- 99

Query: 97  NRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKL 152
             +  E N+    GE+  I+     +     + L  +   + + +             K 
Sbjct: 100 --VVAEGNVTFSDGEVKTISDKATNNLTTEEVTLE-NTNYQFLCEPGRGEAVYVAKTGKA 156

Query: 153 IVNIDTSFASL--QGCESDQVQS 173
           +  I+    +   +G  S ++++
Sbjct: 157 VYEIEDGTITSCPEGDSSWRMRA 179


>gi|83313034|ref|YP_423298.1| hypothetical protein amb3935 [Magnetospirillum magneticum AMB-1]
 gi|82947875|dbj|BAE52739.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 321

 Score = 57.6 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 52/146 (35%), Gaps = 10/146 (6%)

Query: 22  LKADLSQAAASYMTRFKVLGNEKIHIKADM-LEVKDAVQKAFFKGNVFMTQEDFSLQADK 80
             + L+Q            G+++I + AD  +E      +   +GN    + + ++ AD 
Sbjct: 19  PGSALAQGFE-----MSKSGDQQIQVYADNGIEWHSEELRVIARGNAHAIRGNMTVDADV 73

Query: 81  MTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVIL 140
           +T  Y        ++I R+D + N+ I+S            D  K I VL G  A  V  
Sbjct: 74  LTAHYRKGP--KGDEIWRLDADGNVVIRSPNDTATGHKAIYDLDKSIFVLKGAPAKMVTP 131

Query: 141 KEKLNTFLGCKLIVNIDTSFASLQGC 166
                      L        A L+G 
Sbjct: 132 T--DTFTATESLEYWELKKMAVLRGD 155



 Score = 53.4 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 52/160 (32%), Gaps = 32/160 (20%)

Query: 50  DMLEVKDAVQKAFFKGNVFMTQ-EDFSLQADKMTIDYNNTNRDV---------------- 92
           + LE  +  + A  +G+    Q    +L+ D +T  + +  +D                 
Sbjct: 139 ESLEYWELKKMAVLRGDAVAVQEGGKTLKGDVLTAHFKDKEKDKPAPARPGAKPAQAGQP 198

Query: 93  ------SNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNT 146
                   ++ R D   ++ I S    V    G  + +  I  ++G        +E  N 
Sbjct: 199 SGGDGGGLELQRADAYGHVVILSASETVTGDRGDYNAETGIATVSGSVKIS---REGGNQ 255

Query: 147 FLGCKLIVNIDTSFASLQ------GCESDQVQSIIRYDGR 180
             G    VN++T  + L            +VQ +     +
Sbjct: 256 LEGGWAHVNLNTGVSKLFPTAAGAAESGQRVQGVFIPQKK 295


>gi|262275061|ref|ZP_06052872.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Grimontia hollisae CIP 101886]
 gi|262221624|gb|EEY72938.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Grimontia hollisae CIP 101886]
          Length = 783

 Score = 57.6 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/143 (16%), Positives = 51/143 (35%), Gaps = 15/143 (10%)

Query: 31  ASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNR 90
                  + + N  I I+AD  E   A ++A ++G+V +TQ + +++AD  T+       
Sbjct: 51  NPAKGSAEDINNLPIKIEADSAEA-KANERAIYRGDVVVTQGNRTVKADTATLRQPENI- 108

Query: 91  DVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILK----EKLNT 146
                   +  + N++   GEI V   +   +       L  +   K++      +    
Sbjct: 109 --------VTADGNVYFHDGEIAVSGKSLQTNLDNEDTTLT-EAYYKMMCTPGRGQAKRV 159

Query: 147 FLGCKLIVNIDTSFASLQGCESD 169
           F        ++    +    +  
Sbjct: 160 FKNGTTFYEMEDGTYTTCPDDDK 182


>gi|124514201|gb|EAY55716.1| putative OstA family protein [Leptospirillum rubarum]
          Length = 209

 Score = 57.6 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 64/172 (37%), Gaps = 22/172 (12%)

Query: 7   SIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIH--IKADMLEVKDAVQKAFFK 64
             H    L A+VF L+        + ++   K  G + +   I AD +  ++   +  F 
Sbjct: 22  KRHALRSLEAVVFFLVLPG-----SFFLLVGKAWGEQPVSTVINADRMLAENIQNEIHFV 76

Query: 65  GNVFMTQEDFSLQADKMTIDY-----------NNTNRDVSNKINRMDVERNIFIQSGEIN 113
           G+V + +++  L++D + + +           N   R  S KI  M    +++I+ G   
Sbjct: 77  GHVHLVKKNLVLKSDNLDVFFVPPSRGATLMDNMHARQKSQKIQTMIAIGHVYIKKGNRI 136

Query: 114 VIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFASLQG 165
             A       Q    VL        ++ +  +   G K+        + +QG
Sbjct: 137 AYAGKAVYIAQGHYFVLT----RLPVVIQNGDRISGEKITFFTRIDKSLVQG 184


>gi|254473355|ref|ZP_05086752.1| organic solvent tolerance protein [Pseudovibrio sp. JE062]
 gi|211957471|gb|EEA92674.1| organic solvent tolerance protein [Pseudovibrio sp. JE062]
          Length = 800

 Score = 57.6 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 14/89 (15%), Positives = 35/89 (39%)

Query: 10  LYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFM 69
           L +   A + VL    ++Q   S      +  ++ + ++A  L            G+V +
Sbjct: 30  LALLCGAGLMVLSAPAVAQIDLSQTATQSIDTSQPMLLEAKELRYDFDNDVIIASGSVEI 89

Query: 70  TQEDFSLQADKMTIDYNNTNRDVSNKINR 98
             ++++L AD++T +  +        +  
Sbjct: 90  YFDNYTLLADRVTYNRKDGKFSAHGNVQM 118


>gi|312883923|ref|ZP_07743640.1| organic solvent tolerance protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368381|gb|EFP95916.1| organic solvent tolerance protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 819

 Score = 57.6 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 48/141 (34%), Gaps = 17/141 (12%)

Query: 39  VLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINR 98
               E + + AD LE     +KA +KGNV   Q    + AD M                 
Sbjct: 78  SSKQEPVVVDADHLEAI-NGEKATYKGNVVAIQGQKRMLADNMVYHQKEEI--------- 127

Query: 99  MDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIV 154
           +  E N+    G+I  I+          ++ L  +     + +             K + 
Sbjct: 128 VVAEGNVTFSDGQIKTISDKATNKLNSDLVTLE-NTRYNFLCEPGRGEAVYVSKTGKAVY 186

Query: 155 NIDTSFASL--QGCESDQVQS 173
            I+    +   +G +S ++++
Sbjct: 187 EIEDGTITSCPEGDKSWRMRA 207


>gi|148239648|ref|YP_001225035.1| hypothetical protein SynWH7803_1312 [Synechococcus sp. WH 7803]
 gi|147848187|emb|CAK23738.1| Conserved hypothetical protein [Synechococcus sp. WH 7803]
          Length = 137

 Score = 57.2 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/167 (14%), Positives = 52/167 (31%), Gaps = 41/167 (24%)

Query: 14  LLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQED 73
           +  +    +    SQ+  + M +   + +  I I++D     +        GNV +    
Sbjct: 1   MALVAVGSIGLARSQSLPAPMNQSGPIDDGLITIESDSQSADNVTGVVTASGNVRIVY-- 58

Query: 74  FSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGD 133
                                              +  +   +       ++  LVL+GD
Sbjct: 59  ----------------------------------PARGMVATSRQAQYFSREGRLVLSGD 84

Query: 134 RADKVILKEKLNTFLGCKLIVNIDTSFASLQGCESDQVQ--SIIRYD 178
                ++++  +T    ++  N+D   A     E  QV+   I+R D
Sbjct: 85  VD---VIQDDGSTLRAERVTYNLDDERALAVPSEGTQVRATMILRPD 128


>gi|30248885|ref|NP_840955.1| putative organic solvent tolerance transmembrane protein
           [Nitrosomonas europaea ATCC 19718]
 gi|75540814|sp|Q82W18|LPTD_NITEU RecName: Full=LPS-assembly protein lptD; AltName: Full=Organic
           solvent tolerance protein; Flags: Precursor
 gi|30138502|emb|CAD84792.1| putative organic solvent tolerance transmembrane protein
           [Nitrosomonas europaea ATCC 19718]
          Length = 723

 Score = 57.2 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 62/160 (38%), Gaps = 25/160 (15%)

Query: 5   LNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFK 64
           +N++ L + L A + +L    +S   +           + I+I+AD ++     Q+    
Sbjct: 1   MNTLKLCLILYACLVLLPVRVMSADLSPA-----SSERQPIYIEADHIDGHYQ-QEIEAI 54

Query: 65  GNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQ 124
           GNV M + D +L AD++    +N N         ++VE N  ++  +  +  S   ++  
Sbjct: 55  GNVRMRRGDQTLTADRVKYYQSNEN---------VEVEGNAQLERPDDILWGSYLQMNLN 105

Query: 125 KRILVLN----------GDRADKVILKEKLNTFLGCKLIV 154
                L+          G     ++L E  N +   K   
Sbjct: 106 DNTGQLSEPRYLQKDGNGRGDGNLLLLEGENQYRFKKARY 145


>gi|311280963|ref|YP_003943194.1| Organic solvent tolerance protein [Enterobacter cloacae SCF1]
 gi|308750158|gb|ADO49910.1| Organic solvent tolerance protein [Enterobacter cloacae SCF1]
          Length = 800

 Score = 57.2 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 57/185 (30%), Gaps = 30/185 (16%)

Query: 1   MSAFLNSIHLYIHLLALVFVLLKADLSQAAASYMTRFKV---------LGNEKIHIKADM 51
           M   + +  L   ++A      +   +  A+  M                +  + I AD 
Sbjct: 1   MKKRIPT--LLATMIASALYSQQGAAADLASQCMLGVPTYNRPLVQGDTNSLPVTINADH 58

Query: 52  LEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSGE 111
            +       A F GNV + Q +  LQAD++ +         +       +          
Sbjct: 59  AKGNYPDN-AVFTGNVDVNQGNSRLQADEVQLHQKEAPGQATPVRTVDAL---------- 107

Query: 112 INVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNID-TSFASLQGCESDQ 170
                  G V +    ++L G +A   +  +  N + G   +V       A L     D 
Sbjct: 108 -------GNVHYDDNQVILTGPKAWSNLNTKDTNVWKGDYQMVGRQGRGTADLMKQRGDN 160

Query: 171 VQSII 175
             +I+
Sbjct: 161 RYTIL 165


>gi|15807310|ref|NP_296040.1| hypothetical protein DR_2319 [Deinococcus radiodurans R1]
 gi|6460132|gb|AAF11868.1|AE002063_11 hypothetical protein DR_2319 [Deinococcus radiodurans R1]
          Length = 303

 Score = 57.2 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 42/124 (33%), Gaps = 7/124 (5%)

Query: 43  EKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVE 102
           + ++I A  + +      +   G V +   + + +ADK+  D +     ++         
Sbjct: 138 DPVNISAAQMSLDVDTNVSTSTGGVKLVSGEQTGRADKLIFDEDRELAQLTGTPTLTRA- 196

Query: 103 RNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLNTFLGCKLIVNIDTSFAS 162
                   E+ +         + + L ++G     V L +   T  G  +  N D   A 
Sbjct: 197 --AKQGQKELVISGDEVRALTKDKTLYVSG----GVKLVQGTTTTTGDAVYYNDDKDVAY 250

Query: 163 LQGC 166
           + G 
Sbjct: 251 VVGN 254


>gi|261209785|ref|ZP_05924090.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC341]
 gi|260841175|gb|EEX67688.1| Imp required for envelope biogenesis/organic solvent tolerance
           protein precursor [Vibrio sp. RC341]
          Length = 783

 Score = 57.2 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/139 (18%), Positives = 53/139 (38%), Gaps = 17/139 (12%)

Query: 41  GNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMD 100
           G + I+++AD LE     QKA + GNV + Q    + AD +T+               + 
Sbjct: 52  GQQPINVEADKLEAI-NGQKATYSGNVVVVQGKKRIAADNVTLHQQENV---------VV 101

Query: 101 VERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN----TFLGCKLIVNI 156
            E N+    GEI  +++          + L  + + K + +             K +  I
Sbjct: 102 AEGNVQFSDGEIKTLSTKATNHLNTDEMTLE-NTSYKFLCEPGRGEAVYVSKTGKAVYEI 160

Query: 157 DTSFASL--QGCESDQVQS 173
           +    +    G  + ++++
Sbjct: 161 EDGSITSCPDGDNAWRMRA 179


>gi|167944993|ref|ZP_02532067.1| cell envelope biogenesis protein YhbN [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 52

 Score = 57.2 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 33 YMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
                    + I+++AD +E+ +A   + + GNV ++Q    L+ADKM I
Sbjct: 2  QARALSGDREQPIYLEADSVEIDEASGVSVYIGNVVVSQGSMRLEADKMWI 52


>gi|75907861|ref|YP_322157.1| hypothetical protein Ava_1639 [Anabaena variabilis ATCC 29413]
 gi|75701586|gb|ABA21262.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 165

 Score = 56.9 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 46/156 (29%), Gaps = 39/156 (25%)

Query: 24  ADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTI 83
                   S +T     GN  + I++D+ E     Q    +GNV M      +Q      
Sbjct: 28  TVALPNQLSSVTAQTPGGNRPLTIRSDIQEYDAKNQVITARGNVQMLYPARQIQ------ 81

Query: 84  DYNNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEK 143
                                           ++      ++R +  +G+     IL++ 
Sbjct: 82  ------------------------------ATSAQAQYFSKERRIDFSGNVY---ILQQG 108

Query: 144 LNTFLGCKLIVNIDTSFASLQGCESDQVQSIIRYDG 179
            N+    K+   ID          + QV+SI   D 
Sbjct: 109 GNSIRAEKVTYLIDEGRFVALPQSNRQVESIYMVDD 144


>gi|163759134|ref|ZP_02166220.1| putative outer membrane protein involved in envelope biosynthesis
           [Hoeflea phototrophica DFL-43]
 gi|162283538|gb|EDQ33823.1| putative outer membrane protein involved in envelope biosynthesis
           [Hoeflea phototrophica DFL-43]
          Length = 785

 Score = 56.5 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 35/110 (31%), Gaps = 5/110 (4%)

Query: 6   NSIHLYIHLL-----ALVFVLLKADLSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQK 60
           + +H +  +L         +      + A  +      V  ++K+ + +D L   +    
Sbjct: 4   SKVHAFAGVLCAGAAICSLLAAMPSEASAQTALPGGLSVPEDQKMLLASDELTYNNDTGV 63

Query: 61  AFFKGNVFMTQEDFSLQADKMTIDYNNTNRDVSNKINRMDVERNIFIQSG 110
               G V +    + L AD++  D N         +  ++   N      
Sbjct: 64  VIATGGVQIDYGSYKLVADRVEYDQNTGRMRAIGSVEMIEPTGNRIYADE 113


>gi|94984261|ref|YP_603625.1| OstA-like protein protein [Deinococcus geothermalis DSM 11300]
 gi|94554542|gb|ABF44456.1| OstA-like protein protein [Deinococcus geothermalis DSM 11300]
          Length = 297

 Score = 56.5 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/140 (15%), Positives = 46/140 (32%), Gaps = 7/140 (5%)

Query: 26  LSQAAASYMTRFKVLGNEKIHIKADMLEVKDAVQKAFFKGNVFMTQEDFSLQADKMTIDY 85
           LS    +          + + I A  + +      +   GNV +T    S QA+++  D 
Sbjct: 115 LSANPTATFVPEDKSSGDTVTISAAQMSLDVDNNVSTSTGNVRLTNGSQSGQAERLVFDE 174

Query: 86  NNTNRDVSNKINRMDVERNIFIQSGEINVIASNGYVDFQKRILVLNGDRADKVILKEKLN 145
           +     ++   +     ++      E+ +           + L + G     V L +   
Sbjct: 175 DKELAQLTGTPSLT