HHsearch alignment for GI: 254780746 and conserved domain: COG3117

>COG3117 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=97.34  E-value=0.0085  Score=34.60  Aligned_cols=152  Identities=14%  Similarity=0.105  Sum_probs=106.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-----------CCCC----------------CCEEEEECEEE
Q ss_conf             68899999999999999999876420034444454431-----------3455----------------43058711089
Q gi|254780746|r   21 VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI-----------DLLD----------------FEPMIMKKFIL   73 (215)
Q Consensus        21 Sr~V~~lKi~Lpl~al~i~~~~~~~~~~~~~~~~~~~~-----------~~~~----------------~~~~~m~~P~~   73 (215)
T Consensus         4 ~Rw~~~ILll~a~~~~~w~~~~~~~~~~~v~~~~d~p~Y~~e~~~~~~~de~G~~~y~l~a~~~eh~~~~~~t~ft~P~l   83 (188)
T COG3117           4 RRWVYLILLLAALALSGWLLGLEQDEIEQVRPNPDEPAYTMEGLDTTVYDEQGKLKYRLTAQHVEHYSDSSDTHFTAPVL   83 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCEEEECCCCCEEEEEEHHHHHHCCCCCCEEEECCEE
T ss_conf             52999999999999999876201355244104999864020574236777776056776323454154566557715359


Q ss_pred             EEECCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEEECCCCEEEEECCEEEEECCCCEEE
Q ss_conf             98849988899996011335889874499995689998168845679999345899735646999777799951573999
Q gi|254780746|r   74 SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLD  153 (215)
Q Consensus        74 ~G~~~~g~~~~itA~~A~~~~~~~~~~i~L~~v~a~i~~~~g~~~~i~i~A~~G~y~~~~~~l~L~g~V~i~~~~G~~l~  153 (215)
T Consensus        84 ~lf~e~~q~w~v~Ad~a~l~--~d~~l~l~~~vvv~~~t~d~~-q~~~l~T~~~~V~l~tqd~~te~~V~l~~~-~~~~t  159 (188)
T COG3117          84 TLFRENRQTWTVQADRAKLT--KDGKLYLLGDVVVVALTPDSG-QLQRLTTESAQVNLKTQDAQTEDPVTLYGG-QFVST  159 (188)
T ss_pred             EEECCCCCCEEEEHHHHEEC--CCCEEEEEECEEEEEECCCCC-CCCEEEEEEEEECCCCCCEECCCCEEEECC-CCCCC
T ss_conf             98838876279981020215--785599871206775147766-764587102376133100003775667435-44023


Q ss_pred             EEEEEEEEEEEEEEECCCEEEEE
Q ss_conf             82127997203899538589990
Q gi|254780746|r  154 FETAVLDVKNITINSSDPVIITH  176 (215)
Q Consensus       154 t~~~~~d~~~~~i~s~~~V~~~~  176 (215)
T Consensus       160 g~gm~~n~k~~~a~L~~kV~t~y  182 (188)
T COG3117         160 ANGMTGNLKTQQANLLSKVRTRY  182 (188)
T ss_pred             CCCEEEEHHHHHHHHHHCCCCEE
T ss_conf             20147754655666421245178