HHsearch alignment for GI: 254780746 and conserved domain: PRK03761

>PRK03761 organic solvent tolerance protein; Provisional.
Probab=98.36  E-value=5.6e-05  Score=46.93  Aligned_cols=127  Identities=9%  Similarity=0.070  Sum_probs=91.5

Q ss_pred             CEEEEEECCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEEECCCC------EEEEECCEE
Q ss_conf             10899884998889999601133588987449999568999816884567999934589973564------699977779
Q gi|254780746|r   70 KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH------TLYISQPFK  143 (215)
Q Consensus        70 ~P~~~G~~~~g~~~~itA~~A~~~~~~~~~~i~L~~v~a~i~~~~g~~~~i~i~A~~G~y~~~~~------~l~L~g~V~  143 (215)
T Consensus        40 ~~~~~~-~~~~~pi~i~AD~~~~~---~~~~~~~~---GnV~i~~g~---~~l~Ad~v~~~q~~~~~~~~~~~~a~Gnv~  109 (782)
T PRK03761         40 RPLVTG-DPNDLPVTINADNAEAN---YPDKAVYT---GNVDIKQGN---SRLQADEVQLHQQEAPGEPVRTVDAEGNVH  109 (782)
T ss_pred             CCCCCC-CCCCCCEEEEECCEEEC---CCCEEEEE---EEEEEEECC---EEEECCEEEEECCCCCCCCCEEEEEECCEE
T ss_conf             674269-98888479993324625---89779999---339999799---899956799952378666502899868989


Q ss_pred             EEECCCCEEEEEEEEEEEEEEEEEECCC-EEEEECCCEEEEEEEEEEECCCEEEEECCEEEEECH
Q ss_conf             9951573999821279972038995385-899907718997079999278689998896999831
Q gi|254780746|r  144 MKVKDNLRLDFETAVLDVKNITINSSDP-VIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP  207 (215)
Q Consensus       144 i~~~~G~~l~t~~~~~d~~~~~i~s~~~-V~~~~~~g~i~A~~m~i~~~~~~i~F~g~V~l~i~p  207 (215)
T Consensus       110 ~~-~~~~~~~g~~~~~~~~~~~~~~~~~~y~~~~~~~~g~A~~~~~~~~~~~~~l~~~~yTtC~p  173 (782)
T PRK03761        110 YD-DNQIILKGPKAWSNLNTKDTNVWNGDYQMVGRQGRGKADLMKQRGENRYTILENGSFTSCLP  173 (782)
T ss_pred             EE-CCCEEEEECEEEEECCCCEEEEECCEEEEECCCCEEEEEEEEECCCCCEEEECCEEECCCCC
T ss_conf             96-89618981469995377645996248999737860470025991798489981718830899