HHsearch alignment for GI: 254780746 and conserved domain: PRK04423

>PRK04423 organic solvent tolerance protein; Provisional.
Probab=97.84  E-value=0.00024  Score=43.36  Aligned_cols=79  Identities=10%  Similarity=-0.027  Sum_probs=56.9

Q ss_pred             EEEEEEEEEEEEECCCCEEEEECCEEEEECCCCEEEEEEEEEEEEEEEEEECCCEEEEECCCEEEEEEEEEEECCCEEEE
Q ss_conf             67999934589973564699977779995157399982127997203899538589990771899707999927868999
Q gi|254780746|r  118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF  197 (215)
Q Consensus       118 ~~i~i~A~~G~y~~~~~~l~L~g~V~i~~~~G~~l~t~~~~~d~~~~~i~s~~~V~~~~~~g~i~A~~m~i~~~~~~i~F  197 (215)
T Consensus        58 ~p~~v~aD~~~~~~--~~~~f~GnV~i~qg~-~~l~AD~v~ydq~~~~v~A~GnV~~~~~~~~~~g~~~~~~l~~~~g~~  134 (798)
T PRK04423         58 LPTDIEGDQLSGTS--TTPQYQGNVALKRGD-QFLGADNLRMDTETGNYIAEGNVRYQDTSIRMVADRAEGNQDTDTHKI  134 (798)
T ss_pred             CCEEEECCCCCCCC--CCCEEEEEEEEEECC-EEEEEEEEEEECCCCEEEEECCEEEECCCCEEECCEEEEECCCCEEEE
T ss_conf             98588764023557--751798559999799-899911799986789899977789967985898142899826764799


Q ss_pred             EC
Q ss_conf             88
Q gi|254780746|r  198 AG  199 (215)
Q Consensus       198 ~g  199 (215)
T Consensus       135 ~~  136 (798)
T PRK04423        135 TN  136 (798)
T ss_pred             EC
T ss_conf             66