HHsearch alignment for GI: 254780746 and conserved domain: PRK10893

>PRK10893 hypothetical protein; Provisional.
Probab=99.83  E-value=3.2e-18  Score=121.82  Aligned_cols=182  Identities=14%  Similarity=0.176  Sum_probs=142.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEECEEEEEECCCCC-EEEEEEEEEEECCCCCCC
Q ss_conf             6889999999999999999987642003444445443134554305871108998849988-899996011335889874
Q gi|254780746|r   21 VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKG   99 (215)
Q Consensus        21 Sr~V~~lKi~Lpl~al~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~P~~~G~~~~g~-~~~itA~~A~~~~~~~~~   99 (215)
T Consensus         2 ~~~~~w~~~~l~~~a~~l~~w~~~----~~~~~~-~~~~~~~~P~y~a~~l~t~~y~~~G~lsy~i~A~~~-eHY~-~~~   74 (190)
T PRK10893          2 SKTRRWVIIVLSLAALVLIGWNMA----DKDDTA-QVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHV-EYYS-DQA   74 (190)
T ss_pred             CHHHHHHHHHHHHHHHHHHEEEEC----CCCCCC-CCCCCCCCCCEEEECCEEEEECCCCCEEEEEEECHH-HHCC-CCC
T ss_conf             525779999999999998505510----368765-565789999669753368889999978589997142-0131-379


Q ss_pred             EEEEEEEEEEEEECCCCEEEEEEEEEEEEEECCCCEEEEECCEEEEEC--CC--CEEEEEEEEEEEEEEEEEECCCEEEE
Q ss_conf             499995689998168845679999345899735646999777799951--57--39998212799720389953858999
Q gi|254780746|r  100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK--DN--LRLDFETAVLDVKNITINSSDPVIIT  175 (215)
Q Consensus       100 ~i~L~~v~a~i~~~~g~~~~i~i~A~~G~y~~~~~~l~L~g~V~i~~~--~G--~~l~t~~~~~d~~~~~i~s~~~V~~~  175 (215)
T Consensus        75 ~T~F~~Pvl~ly~~~~-~~~W~VsA~~a~L~~d-~~L~L~gnV~i~~L~~~s~iq~I~T~~l~idL~tqd~~SD~~VtI~  152 (190)
T PRK10893         75 VSWFTQPVLTTFDKDK-VPTWSVKADKAKLTND-RMLYLYGHVEVNALTPDSQLRRITTDNAQINLVTQDVTSDDLVTLY  152 (190)
T ss_pred             CEEEECCEEEEECCCC-CCCEEEEECEEEECCC-CEEEEECCEEEEECCCCCCCCEEECCCEEEECCCCEEECCCEEEEE
T ss_conf             5898186599988999-5327999456798648-8899977799985389754538982758980466468638709998


Q ss_pred             ECCCEEEEEEEEEEECCCEEEEECCEEEEECHHHHC
Q ss_conf             077189970799992786899988969998311320
Q gi|254780746|r  176 HSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ  211 (215)
Q Consensus       176 ~~~g~i~A~~m~i~~~~~~i~F~g~V~l~i~p~~~~  211 (215)
T Consensus       153 G~~f~s~G~gm~anL~~~~a~L~~~Vkt~YEi~~~~  188 (190)
T PRK10893        153 GTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQ  188 (190)
T ss_pred             CCCCEEEEEEEEEEHHHCEEEEHHHCCEEEECCCCC
T ss_conf             798399861089993658889045061999636003