HHsearch alignment for GI: 254780746 and conserved domain: PRK10894

>PRK10894 hypothetical protein; Provisional.
Probab=98.59  E-value=9.7e-06  Score=51.23  Aligned_cols=116  Identities=14%  Similarity=0.106  Sum_probs=70.2

Q ss_pred             EEEEEECC-CCCEEEEEEEEEEECCCC-CCCE--EEEEEEEEEEE--ECCCCEEEEEEEEEEEEEECCCCEEEEECCEEE
Q ss_conf             08998849-988899996011335889-8744--99995689998--168845679999345899735646999777799
Q gi|254780746|r   71 FILSDYSK-DRVKYSLVAERAKTSFNS-GKGI--IFLQDFELTVP--TQRSEYGDMYLFAHSARFNLANHTLYISQPFKM  144 (215)
Q Consensus        71 P~~~G~~~-~g~~~~itA~~A~~~~~~-~~~~--i~L~~v~a~i~--~~~g~~~~i~i~A~~G~y~~~~~~l~L~g~V~i  144 (215)
T Consensus        52 avytGNVvitQGsl~I~ADkv~v~~~~~~~~~~~i~a~G~pA~f~Q~~~~g~~--i~a~A~~i~Y~~~~~~i~L~GnA~L  129 (184)
T PRK10894         52 VTFTGNVVVTQGTIKINADKVVVTRPGGEQGKEVIDGYGNPATFYQMQDNGKP--VKGHASKMHYELAKDFVVLTGNAYL  129 (184)
T ss_pred             EEEEEEEEEEEEEEEEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECCCCCC--EEEEEEEEEEECCCCEEEEECCEEE
T ss_conf             99992599996259999358999976997537999996893799996568981--3769748999826999999765899


Q ss_pred             EECCCCEEEEEEEEEEEEEEEEEECCCEEEEECCCEEEEEEEEEEECCCEEEEECCEEEEECHHHHCCCC
Q ss_conf             9515739998212799720389953858999077189970799992786899988969998311320125
Q gi|254780746|r  145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE  214 (215)
Q Consensus       145 ~~~~G~~l~t~~~~~d~~~~~i~s~~~V~~~~~~g~i~A~~m~i~~~~~~i~F~g~V~l~i~p~~~~~~~  214 (215)
T Consensus       130 ~Q~~-~~v~G~~I~Ydl~~~~~~a~s------~-------------~------~~RV~~vi~P~~~~~k~  173 (184)
T PRK10894        130 EQLD-SNIKGDKITYLVKEQKMQAFS------D-------------K------GKRVTTVLVPSQLQDKN  173 (184)
T ss_pred             EECC-CEEEECEEEEEECCCEEEEEC------C-------------C------CCEEEEEECCCCCCCCC
T ss_conf             9689-989937899990667999967------9-------------9------98079998940158655