HHsearch alignment for GI: 254780746 and conserved domain: TIGR03002

>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli. It is implicated in cell envelope integrity, and has numerous homologues in other Proteobacteria in a conserved location near lipopolysaccharide inner core biosynthesis genes. This entry is distantly related to the organic solvent tolerance protein (OstA)..
Probab=97.91  E-value=0.0013  Score=39.29  Aligned_cols=94  Identities=10%  Similarity=0.104  Sum_probs=62.5

Q ss_pred             EEEEEEEEEEEEEECCCCEEEEECCEEEEECCCCEEEEEEEEEEE--EE---EEEEECCC--EEEEE----CC--CEEEE
Q ss_conf             567999934589973564699977779995157399982127997--20---38995385--89990----77--18997
Q gi|254780746|r  117 YGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV--KN---ITINSSDP--VIITH----SD--FVLSA  183 (215)
Q Consensus       117 ~~~i~i~A~~G~y~~~~~~l~L~g~V~i~~~~G~~l~t~~~~~d~--~~---~~i~s~~~--V~~~~----~~--g~i~A  183 (215)
T Consensus         7 ~qPi~I~Ad~~~~D~~~~~~~f~GnV~itQG~-~~I~ADkv~v~~~~~~~~~~~~~A~G~~PA~F~q~~d~g~~~~~g~A   85 (150)
T TIGR03002         7 EQPIEIEADSQTLDDKKNVVTFTGNVVITQGT-LKIRADKVVVTRPNDGGGIEKATATGNKPATFRQKLDDGKEYIEGQA   85 (150)
T ss_pred             CCCEEEEEEEEEEECCCCEEEEECCEEEEECC-EEEECCEEEEEECCCCCCEEEEEEECCCCEEEEEEECCCCEEEEEEC
T ss_conf             68689994006654028838886565878297-59852288988268878608999980781898899559982799971


Q ss_pred             EEEEEEECCCEEEEECCEEEEECH-HHHC
Q ss_conf             079999278689998896999831-1320
Q gi|254780746|r  184 NFARIENSSRSAVFAGQVSVVVNP-GVLQ  211 (215)
Q Consensus       184 ~~m~i~~~~~~i~F~g~V~l~i~p-~~~~  211 (215)
T Consensus        86 ~~i~Y~~~~~~~~Ltg~A~v~Q~~k~~~~  114 (150)
T TIGR03002        86 NRIEYDPAKDTVVLTGNARVKQGGKNEVS  114 (150)
T ss_pred             CEEEEECCCCEEEEECCEEEEECCCCEEE
T ss_conf             18999325779999123499788977787