HHsearch alignment of GI: 254780746 and MMDB domain: 2r19_A_

>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A
Probab=98.76  E-value=1.8e-08  Score=66.26  Aligned_cols=126  Identities=6%  Similarity=0.035  Sum_probs=97.5

Q ss_pred             CCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEEECCCCEE-----------EEECCEEEEE
Q ss_conf             99888999960113358898744999956899981688456799993458997356469-----------9977779995
Q gi|254780746|r   78 KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL-----------YISQPFKMKV  146 (215)
Q Consensus        78 ~~g~~~~itA~~A~~~~~~~~~~i~L~~v~a~i~~~~g~~~~i~i~A~~G~y~~~~~~l-----------~L~g~V~i~~  146 (215)
                      ....++.|+|+++.-+.  ..+.+.+.+ .+.+  ..+.   ..|+|++..|+..++..           ...|+|++. 
T Consensus         5 ~~~~~i~i~Ad~~~~~~--~~~~~~~~G-nV~i--~~~~---~~l~ad~~~~~~~~~~~~~~~~~~~~~~~~~g~v~~~-   75 (159)
T 2r19_A            5 DTDQPIHIESDQQSLDM--QGNVVTFTG-NVIV--TQGT---IKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDN-   75 (159)
T ss_dssp             GGGSCEEEEESEEEEET--TTTEEEEEE-EEEE--EETT---EEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTT-
T ss_pred             CCCCCEEEEECEEEEEC--CCCEEEEEC-CEEE--EECC---EEEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECCC-
T ss_conf             77899799956599235--699999975-6899--8086---7999989999977886642578751341189995168-


Q ss_pred             CCCCEEEEEEEEEEEEEEEEEECCCEEEEECCCEEEEEEEEEEECCCEEEEECC----EEEEECHHHHCC
Q ss_conf             157399982127997203899538589990771899707999927868999889----699983113201
Q gi|254780746|r  147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ----VSVVVNPGVLQK  212 (215)
Q Consensus       147 ~~G~~l~t~~~~~d~~~~~i~s~~~V~~~~~~g~i~A~~m~i~~~~~~i~F~g~----V~l~i~p~~~~~  212 (215)
                      .++..++++.+.|+.+++.+...++|.+..+.+.++|+.+.++.+.+.+...+.    +++.+.|..+.+
T Consensus        76 ~~~~~~~~~~~~y~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~  145 (159)
T 2r19_A           76 GKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQD  145 (159)
T ss_dssp             SCCEEEECSEEEEEGGGTEEEEEEEEEEEETTEEEEEEEEEEETTTTEEEEECSSSCCCCCCC-------
T ss_pred             CCEEEEEEEEEEEECCCCEEEEECCEEEEECCCEEEECEEEEEECCCEEEEECCCCCCEEEEECCCCCCC
T ss_conf             8339999845799746888998067899958999996789999168999996589994599999876676