BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780746|ref|YP_003065159.1| hypothetical protein
CLIBASIA_03165 [Candidatus Liberibacter asiaticus str. psy62]
         (215 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|13472791|ref|NP_104358.1| hypothetical protein mll3200 [Mesorhizobium loti MAFF303099]
 gi|14023538|dbj|BAB50144.1| mll3200 [Mesorhizobium loti MAFF303099]
          Length = 237

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 91/201 (45%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL--DFEPMIMKKFIL 73
           + ++H R ++ LKF  P A   I   F + S++          +        ++M    L
Sbjct: 30  RAQRHSRRVRVLKFAVPLAAGLIAVAFPVYSYLAAPVSVAVQSEGAAFSNGKLVMANPKL 89

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + ++K +  YS+ A RA     + +GII L+  +  VP        +   A    ++   
Sbjct: 90  NGFTKQKQPYSMTALRAIQDV-NTQGIIELEGIDAKVPVGPDNVAAIK--ASHGIYDRDG 146

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +T+ ++    +   D ++  F++  LD+   T+ + DPV ++     ++A+   ++++ +
Sbjct: 147 NTMKMTSDVMITTTDGMQAKFKSVFLDMGKGTMKTDDPVDVSSGGSQITADSLSVQDNGK 206

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             VF  +V V ++P  ++  E
Sbjct: 207 ILVFEKRVRVNIDPASVKAAE 227


>gi|254718371|ref|ZP_05180182.1| hypothetical protein Bru83_02283 [Brucella sp. 83/13]
 gi|265983332|ref|ZP_06096067.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839602|ref|ZP_07472406.1| protein of unknown function DUF1239 [Brucella sp. NF 2653]
 gi|264661924|gb|EEZ32185.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405300|gb|EFM61575.1| protein of unknown function DUF1239 [Brucella sp. NF 2653]
          Length = 240

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|306844423|ref|ZP_07477013.1| protein of unknown function DUF1239 [Brucella sp. BO1]
 gi|306275236|gb|EFM56986.1| protein of unknown function DUF1239 [Brucella sp. BO1]
          Length = 240

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|256112660|ref|ZP_05453581.1| hypothetical protein Bmelb3E_08255 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265994100|ref|ZP_06106657.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765081|gb|EEZ11002.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 240

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|189023407|ref|YP_001934175.1| hypothetical protein BAbS19_I01470 [Brucella abortus S19]
 gi|254690459|ref|ZP_05153713.1| hypothetical protein Babob68_09884 [Brucella abortus bv. 6 str.
           870]
 gi|254694948|ref|ZP_05156776.1| hypothetical protein Babob3T_09882 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696579|ref|ZP_05158407.1| hypothetical protein Babob28_02380 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700964|ref|ZP_05162792.1| hypothetical protein Bsuib55_08914 [Brucella suis bv. 5 str. 513]
 gi|254705334|ref|ZP_05167162.1| hypothetical protein Bsuib36_15718 [Brucella suis bv. 3 str. 686]
 gi|254731492|ref|ZP_05190070.1| hypothetical protein Babob42_09909 [Brucella abortus bv. 4 str.
           292]
 gi|256060297|ref|ZP_05450470.1| hypothetical protein Bneo5_08035 [Brucella neotomae 5K33]
 gi|256258715|ref|ZP_05464251.1| hypothetical protein Babob9C_15481 [Brucella abortus bv. 9 str.
           C68]
 gi|260546429|ref|ZP_05822169.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260756011|ref|ZP_05868359.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759235|ref|ZP_05871583.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760957|ref|ZP_05873300.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260885031|ref|ZP_05896645.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215287|ref|ZP_05929568.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261324269|ref|ZP_05963466.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751482|ref|ZP_05995191.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261756045|ref|ZP_05999754.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|189018979|gb|ACD71701.1| hypothetical protein BAbS19_I01470 [Brucella abortus S19]
 gi|260096536|gb|EEW80412.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260669553|gb|EEX56493.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671389|gb|EEX58210.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676119|gb|EEX62940.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874559|gb|EEX81628.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916894|gb|EEX83755.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261300249|gb|EEY03746.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261741235|gb|EEY29161.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745798|gb|EEY33724.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 240

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|163842425|ref|YP_001626829.1| hypothetical protein BSUIS_A0156 [Brucella suis ATCC 23445]
 gi|163673148|gb|ABY37259.1| protein of unknown function DUF1239 [Brucella suis ATCC 23445]
          Length = 240

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|237814625|ref|ZP_04593623.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237789462|gb|EEP63672.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 255

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 53  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 112

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 113 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 169

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 170 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 229

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 230 VLIFENNVHMTVDGNTLSANK 250


>gi|148559427|ref|YP_001258188.1| hypothetical protein BOV_0150 [Brucella ovis ATCC 25840]
 gi|148370684|gb|ABQ60663.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 255

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 53  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 112

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 113 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 169

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 170 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 229

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 230 VLIFENNVHMTVDGNTLSANK 250


>gi|260460502|ref|ZP_05808753.1| protein of unknown function DUF1239 [Mesorhizobium opportunistum
           WSM2075]
 gi|259033607|gb|EEW34867.1| protein of unknown function DUF1239 [Mesorhizobium opportunistum
           WSM2075]
          Length = 237

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 92/201 (45%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL--DFEPMIMKKFIL 73
           + ++H R ++ LKF  P A   I   F + S++          +        ++M    L
Sbjct: 30  RAQRHSRRVRVLKFAVPLAAALIAVAFPVYSYLAAPVSVAVQAEGTAFSNGKLVMANPKL 89

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + ++K +  YS+ A RA    ++ +GII L+  +  VP        +   A    ++   
Sbjct: 90  NGFTKLKQPYSMTALRAIQDVST-QGIIELEGIDAKVPIAPDNVAAVK--ASHGTYDRDG 146

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +T+ ++    +   D L+  F++  LD+   T+ + DPV ++     ++A+   ++++ +
Sbjct: 147 NTMKLNSDVTITTTDGLQAKFKSVFLDMGKGTMKTDDPVDVSRGGSQITADSMSVQDNGK 206

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             VF  +V V ++P  L+  E
Sbjct: 207 VLVFENKVRVNIDPAALKAAE 227


>gi|254709304|ref|ZP_05171115.1| hypothetical protein BpinB_03361 [Brucella pinnipedialis B2/94]
 gi|256030827|ref|ZP_05444441.1| hypothetical protein BpinM2_09278 [Brucella pinnipedialis
           M292/94/1]
 gi|256158852|ref|ZP_05456709.1| hypothetical protein BcetM4_08193 [Brucella ceti M490/95/1]
 gi|256254233|ref|ZP_05459769.1| hypothetical protein BcetB_08050 [Brucella ceti B1/94]
 gi|260169731|ref|ZP_05756542.1| hypothetical protein BruF5_15498 [Brucella sp. F5/99]
 gi|261221382|ref|ZP_05935663.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261316813|ref|ZP_05956010.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261759269|ref|ZP_06002978.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265987882|ref|ZP_06100439.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265997343|ref|ZP_06109900.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260919966|gb|EEX86619.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261296036|gb|EEX99532.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261739253|gb|EEY27249.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|262551811|gb|EEZ07801.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264660079|gb|EEZ30340.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 240

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 87/201 (43%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S+         +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASSVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|297247547|ref|ZP_06931265.1| hypothetical protein BAYG_00458 [Brucella abortus bv. 5 str. B3196]
 gi|297174716|gb|EFH34063.1| hypothetical protein BAYG_00458 [Brucella abortus bv. 5 str. B3196]
          Length = 250

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 48  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 107

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 108 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 164

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 165 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 224

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 225 VLIFENNVHMTVDGNTLSANK 245


>gi|225626694|ref|ZP_03784733.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225618351|gb|EEH15394.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 255

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 87/201 (43%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S+         +   ++MK   L
Sbjct: 53  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASSVKVEVNTGGETGKLVMKSPHL 112

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 113 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 169

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 170 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 229

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 230 VLIFENNVHMTVDGNTLSANK 250


>gi|254713273|ref|ZP_05175084.1| hypothetical protein BcetM6_07962 [Brucella ceti M644/93/1]
 gi|254716374|ref|ZP_05178185.1| hypothetical protein BcetM_08050 [Brucella ceti M13/05/1]
 gi|261218156|ref|ZP_05932437.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320996|ref|ZP_05960193.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260923245|gb|EEX89813.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293686|gb|EEX97182.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 240

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 85/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +    +MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKFVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|161618143|ref|YP_001592030.1| hypothetical protein BCAN_A0160 [Brucella canis ATCC 23365]
 gi|260567207|ref|ZP_05837677.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161334954|gb|ABX61259.1| protein of unknown function DUF1239 [Brucella canis ATCC 23365]
 gi|260156725|gb|EEW91805.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 240

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVCVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFENNVHMTVDGNTLSANK 235


>gi|294851555|ref|ZP_06792228.1| hypothetical protein BAZG_00463 [Brucella sp. NVSL 07-0026]
 gi|294820144|gb|EFG37143.1| hypothetical protein BAZG_00463 [Brucella sp. NVSL 07-0026]
          Length = 250

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 48  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 107

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 108 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 164

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 165 GRLQLDKDFTVTTDNGLRAQLHSAEVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 224

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 225 VLIFENNVHMTVDGNTLSANK 245


>gi|23501066|ref|NP_697193.1| hypothetical protein BR0155 [Brucella suis 1330]
 gi|62289131|ref|YP_220924.1| hypothetical protein BruAb1_0151 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699070|ref|YP_413644.1| hypothetical protein BAB1_0154 [Brucella melitensis biovar Abortus
           2308]
 gi|256368619|ref|YP_003106125.1| hypothetical protein BMI_I158 [Brucella microti CCM 4915]
 gi|23346933|gb|AAN29108.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195263|gb|AAX73563.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615171|emb|CAJ10110.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|255998777|gb|ACU47176.1| hypothetical protein BMI_I158 [Brucella microti CCM 4915]
          Length = 217

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 15  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 74

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 75  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 131

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 132 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 191

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 192 VLIFENNVHMTVDGNTLSANK 212


>gi|225851688|ref|YP_002731921.1| hypothetical protein BMEA_A0161 [Brucella melitensis ATCC 23457]
 gi|256045947|ref|ZP_05448819.1| hypothetical protein Bmelb1R_15659 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256264799|ref|ZP_05467331.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563228|ref|ZP_05833714.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265992357|ref|ZP_06104914.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225640053|gb|ACN99966.1| protein of unknown function DUF1239 [Brucella melitensis ATCC
           23457]
 gi|260153244|gb|EEW88336.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263003423|gb|EEZ15716.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095210|gb|EEZ18879.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 240

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 215 VLIFEYNVHMTVDGNTLSANK 235


>gi|326537890|gb|ADZ86105.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 252

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 50  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 109

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 110 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 166

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 167 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 226

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 227 VLIFEYNVHMTVDGNTLSANK 247


>gi|326408177|gb|ADZ65242.1| conserved hypothetical protein [Brucella melitensis M28]
          Length = 250

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 48  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 107

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 108 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 164

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 165 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 224

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 225 VLIFEYNVHMTVDGNTLSANK 245


>gi|254780746|ref|YP_003065159.1| hypothetical protein CLIBASIA_03165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040423|gb|ACT57219.1| hypothetical protein CLIBASIA_03165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 215

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 215/215 (100%), Positives = 215/215 (100%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60
           MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL
Sbjct: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60

Query: 61  LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
           LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM
Sbjct: 61  LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
           YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV
Sbjct: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
           LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN
Sbjct: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215


>gi|17988075|ref|NP_540709.1| hypothetical protein BMEI1792 [Brucella melitensis bv. 1 str. 16M]
 gi|17983825|gb|AAL52973.1| hypothetical protein BMEI1792 [Brucella melitensis bv. 1 str. 16M]
          Length = 217

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 15  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 74

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 75  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 131

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 132 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 191

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F   V + V+   L   +
Sbjct: 192 VLIFEYNVHMTVDGNTLSANK 212


>gi|154250651|ref|YP_001411475.1| hypothetical protein Plav_0195 [Parvibaculum lavamentivorans DS-1]
 gi|154154601|gb|ABS61818.1| protein of unknown function DUF1239 [Parvibaculum lavamentivorans
           DS-1]
          Length = 239

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 77/209 (36%), Gaps = 5/209 (2%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSS-WIRISTFSKSSIDLLDFE--P 65
           + +  R    ++  F+  +K   P   + ++G  L+ S         + +   +D +   
Sbjct: 32  RPVQDRPVNSRYSSFVSLMKVGLPVGAIVLLGVVLVYSGVFDSDDRLEVTFREIDTQPSD 91

Query: 66  MIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH 125
           + M    L   + D   Y + A+ A     S    + L + +  +     E   + L A 
Sbjct: 92  LRMVSPRLDGVTSDGKPYVITADNATQDPAS-PNFVTLDNIQADIKF-NEEEDWLSLTAT 149

Query: 126 SARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANF 185
           S R++    TL +S+   +       +  E A +D     + S   V        L A+ 
Sbjct: 150 SGRYDSEAQTLNLSRQIDIFTTWGYEVHGEEATVDFDQGMLTSEKEVTGQGPLGTLRADR 209

Query: 186 ARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
            R  N+++   F G V +++ P    + +
Sbjct: 210 MRAHNATQVLRFDGNVKMLILPDQPSEGD 238


>gi|153007512|ref|YP_001368727.1| hypothetical protein Oant_0167 [Ochrobactrum anthropi ATCC 49188]
 gi|151559400|gb|ABS12898.1| protein of unknown function DUF1239 [Ochrobactrum anthropi ATCC
           49188]
          Length = 237

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 84/201 (41%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS--TFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   +++            +  +   ++M    L
Sbjct: 38  AAQRHSIRVRVLKTALPVAAIIVGAVFSWYTFLATPNAPVKVEVNNGGESGKLVMTSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P        +   +    ++ AN
Sbjct: 98  NGYTKDNRPYSMTASKATQDAKN-SGAISLEGISAELPVGDKGTAKVEATS--GVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   D LR    +A +++K+  I +  PV I      + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDDGLRAVLRSADVNLKSGQITTDKPVDIRSGSTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F  +V + V+  V+   +
Sbjct: 215 VLIFENKVRMTVDGSVVSPNK 235


>gi|254708605|ref|ZP_05170433.1| hypothetical protein BpinM_17082 [Brucella pinnipedialis
           M163/99/10]
          Length = 226

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/192 (21%), Positives = 84/192 (43%), Gaps = 5/192 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S+         +   ++MK   L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASSVKVEVNTGGETGKLVMKSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVV 205
             +F   V + V
Sbjct: 215 VLIFENNVHMTV 226


>gi|261316111|ref|ZP_05955308.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261305137|gb|EEY08634.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 241

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/192 (21%), Positives = 84/192 (43%), Gaps = 5/192 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S+         +   ++MK   L
Sbjct: 53  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASSVKVEVNTGGETGKLVMKSPHL 112

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 113 NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 169

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +
Sbjct: 170 GRLQLDKDFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGK 229

Query: 194 SAVFAGQVSVVV 205
             +F   V + V
Sbjct: 230 VLIFENNVHMTV 241


>gi|239787678|emb|CAX84186.1| conserved uncharacterized protein [uncultured bacterium]
          Length = 227

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 82/216 (37%), Gaps = 10/216 (4%)

Query: 1   MDHLDRRNKILLQ---RSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSS----WIRISTF 53
           +  + R   +L     + +  ++ RF+  +K   P     ++G  L+             
Sbjct: 10  LKSVHRARDLLAAGDIKERDPRYTRFVGMMKVLLPAVAALVLGLVLIWPQIVGRDERFRV 69

Query: 54  SKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQ 113
           S S+I+  D + + M          +   +S+ A+ A    + G   + L+  +  + T 
Sbjct: 70  SFSNINAKDVDTLSMVNARYFGTDTNNQPFSVTADMA-NEASRGAKAVELESPKADIMTH 128

Query: 114 RSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVI 173
             ++  + L A +  ++  + TL +     +       +   +A  D+K    +  DPV 
Sbjct: 129 DGQW--LALSADNGLYSQPSSTLDLLGNVNLFHDKGYEIHTTSAQADLKMGAASGDDPVR 186

Query: 174 ITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
                  L+A   R+ +     VF G+  +V++P  
Sbjct: 187 GQGPFGALTAEGFRLYDKGSRIVFTGKSHLVLDPKA 222


>gi|316931443|ref|YP_004106425.1| hypothetical protein Rpdx1_0048 [Rhodopseudomonas palustris DX-1]
 gi|315599157|gb|ADU41692.1| protein of unknown function DUF1239 [Rhodopseudomonas palustris
           DX-1]
          Length = 242

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 66/206 (32%), Gaps = 8/206 (3%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
            + +   +H R ++ L+   P   V  +   +  S                  ++    +
Sbjct: 10  ARFAAAARHSRLVRTLRVAVPLVVVLSMAVIVAISIFNPFRYLTNLPLDIGDLVVSGTKI 69

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   ++ ++ D   Y + A  A     + +  + L      V ++      + + A  
Sbjct: 70  TMESPHMAGFTNDGRPYEMWARSATQDL-TSQDHVDLHTLRAKVQSED--QSTVVIEARE 126

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            +F      L +++   +            A +D+   T+ S  PV +      L     
Sbjct: 127 GQFQTKAQLLKLNKDVYLHNSSGTEAWMTQADVDMGQGTVTSDAPVDVKWEGGTLRGQRM 186

Query: 187 RIENSSRSAVFAGQVSVVVNPGVLQK 212
           RI        F G V + ++   L +
Sbjct: 187 RITEKGDLIRFEGGVVMNLDNAALAE 212


>gi|319781469|ref|YP_004140945.1| hypothetical protein Mesci_1740 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167357|gb|ADV10895.1| protein of unknown function DUF1239 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 237

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 92/201 (45%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL--DFEPMIMKKFIL 73
           + ++H R ++ LKF  P A   I   F + S++      K   +        ++M    L
Sbjct: 30  RAQRHSRRVRVLKFAVPVAAALIAVAFPVYSYLAAPVSVKIQAEGTAFSNGKLVMANPKL 89

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + ++K +  YS+ A RA    ++ +GII L+  +  VP        +   A    ++   
Sbjct: 90  NGFTKQKQPYSMTALRAIQDVST-QGIIELEGIDAKVPIASDNVAAVK--ASHGTYDRDG 146

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +T+ ++    +   D ++  F++  LD+   T+ + DPV ++     ++A+   ++++ +
Sbjct: 147 NTMNLTSDVTITTTDGMQAKFKSVFLDMGKGTMKTGDPVDVSRGGSRITADTMSVQDNGK 206

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             VF  +V V ++   L+  +
Sbjct: 207 ILVFENKVRVNIDSAALKAAQ 227


>gi|49473701|ref|YP_031743.1| hypothetical protein BQ00140 [Bartonella quintana str. Toulouse]
 gi|49239204|emb|CAF25521.1| hypothetical protein BQ00140 [Bartonella quintana str. Toulouse]
          Length = 222

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 78/197 (39%), Gaps = 8/197 (4%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF-----EPMIMK 69
            K  +H   I  LKFF P   +     F   ++  +       I   +        + M 
Sbjct: 27  KKASRHSYRIGILKFFLPLCALATALVFCWFTFFFVPAACDPVILNDEENGAMAMKLTML 86

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
              L  Y++    Y   AE+A     +  G++ LQ+          + G +++ A    +
Sbjct: 87  NPKLEGYTRSHEPYWFKAEKAFQD-RTRSGVVGLQNITAETFV--GKQGRVFIDAQGGVY 143

Query: 130 NLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
           +  N  L +++PF +   D +   F TA + +    +++   V I  +   L+AN  +I 
Sbjct: 144 DNINGCLQLNKPFTITTSDGMIAQFMTADISLSEGQLSTDQRVNIQRAGLHLAANGLQIR 203

Query: 190 NSSRSAVFAGQVSVVVN 206
              ++  F G V +V++
Sbjct: 204 KKGQNIYFYGGVHLVLD 220


>gi|39933127|ref|NP_945403.1| hypothetical protein RPA0047 [Rhodopseudomonas palustris CGA009]
 gi|39652752|emb|CAE25491.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 246

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 65/204 (31%), Gaps = 8/204 (3%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
            + +   +H R ++ L+   P   V  +   +  S                  ++    +
Sbjct: 15  ARFAAAARHSRLVRTLRLAVPLVVVLSMAVIIAISIFNPFRYLSKLPIDVGDLVVSGTKI 74

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   L+ ++ D   Y + A  A     + +  + L      V ++      + + +  
Sbjct: 75  TMESPHLAGFTNDGRPYEMWARTATQDL-TSQDHVDLHTLRAKVQSED--QSTVIIESRE 131

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            +F      L +++   +            A +D+   T+ S  PV +      L     
Sbjct: 132 GQFETKAQLLKLNKDVYLHNSTGTEAWMTQADIDMGKGTVTSDSPVDVKWDGGTLRGQRM 191

Query: 187 RIENSSRSAVFAGQVSVVVNPGVL 210
           RI        F G V + ++   L
Sbjct: 192 RITEKGDLIRFEGGVVMNIDNASL 215


>gi|90421942|ref|YP_530312.1| hypothetical protein RPC_0418 [Rhodopseudomonas palustris BisB18]
 gi|90103956|gb|ABD85993.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 244

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 66/201 (32%), Gaps = 8/201 (3%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
            + +   +H R ++ L+   P A +  +   +  S                  ++    +
Sbjct: 11  TRFAAAARHSRLVRLLRVAVPLAVLLAMAAIVAVSVFNPFRFLAKLPVDMGNLVVSGTKI 70

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   LS +S D+  Y L A+ A     +    + L      + TQ      + + A  
Sbjct: 71  TMESPHLSGFSPDQRPYELWAKTATQDL-TTPDHVDLATLRAKLLTQD--QATVTVDARQ 127

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
             F+     L + +   +            A +D+   T+ S +PV +      L     
Sbjct: 128 GLFDTKAQLLDLRKDVYLLSSTGYEAWMTRAFIDIGKGTVVSDEPVDVKWQGGTLRGQRM 187

Query: 187 RIENSSRSAVFAGQVSVVVNP 207
           R+        F G V + ++ 
Sbjct: 188 RVTEKGEIVRFEGGVVMNLDG 208


>gi|192288481|ref|YP_001989086.1| hypothetical protein Rpal_0048 [Rhodopseudomonas palustris TIE-1]
 gi|192282230|gb|ACE98610.1| protein of unknown function DUF1239 [Rhodopseudomonas palustris
           TIE-1]
          Length = 246

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 65/204 (31%), Gaps = 8/204 (3%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
            + +   +H R ++ L+   P   V  +   +  S                  ++    +
Sbjct: 15  ARFAAAARHSRLVRTLRLAVPLVVVLSMAVIIAISIFNPFRYLSKLPIDVGDLVVSGTKI 74

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   L+ ++ D   Y + A  A     + +  + L      V ++      + + +  
Sbjct: 75  TMESPHLAGFTNDGRPYEMWARTATQDL-TSQDHVDLHTLRAKVQSED--QSTVIIESRE 131

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            +F      L +++   +            A +D+   T+ S  PV +      L     
Sbjct: 132 GQFETKAQLLKLNKDVYLHNSTGTEAWMTQADIDMGKGTVTSDSPVDVKWDGGTLRGQRM 191

Query: 187 RIENSSRSAVFAGQVSVVVNPGVL 210
           RI        F G V + ++   L
Sbjct: 192 RITEKGDLIRFEGGVVMNIDNASL 215


>gi|49474846|ref|YP_032887.1| hypothetical protein BH00150 [Bartonella henselae str. Houston-1]
 gi|49237651|emb|CAF26831.1| hypothetical protein BH00150 [Bartonella henselae str. Houston-1]
          Length = 216

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 79/197 (40%), Gaps = 6/197 (3%)

Query: 13  QRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI---DLLDFEPMIMK 69
              K  +H R I  LKF  P   +T    F   ++  +       I   +  +   + M 
Sbjct: 21  AFKKASRHSRSISILKFLLPLCALTTALVFCWFTFFFVPVAFDPVISKDEESEMMKLTML 80

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
              L  Y++    Y L AE+A    ++  G+I LQ+          +   ++L A    +
Sbjct: 81  NPKLEGYTRSHEPYWLKAEKAFQD-HTRSGVIGLQNITAEAFL--GKQRRVFLDAQGGNY 137

Query: 130 NLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
           +  N  L + +PF++   D +   F  A +++    +N+   V I  +   L+AN  +I 
Sbjct: 138 DNMNGCLQLDKPFRITTNDGMIAQFMAADINLSEGQLNTDKRVNIRRAGLHLAANALQIR 197

Query: 190 NSSRSAVFAGQVSVVVN 206
              +   F G V +V +
Sbjct: 198 EKGQEMYFHGGVHLVFD 214


>gi|115522455|ref|YP_779366.1| hypothetical protein RPE_0427 [Rhodopseudomonas palustris BisA53]
 gi|115516402|gb|ABJ04386.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 232

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 68/200 (34%), Gaps = 8/200 (4%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
            + +   +H R ++ L+   P A    +   +  S                  ++    +
Sbjct: 15  ARFAVAARHSRLVRILRVAVPLAVALAMAGIVAVSVFNPFRLLAKLPLDMGNLVVSGTRV 74

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   LS +S D   Y L A+ A     +    + L      V T       + + A +
Sbjct: 75  TMEAPHLSGFSPDGRPYELWAKAATQDL-TRPDHVDLATIRAKVVTDD--QSTVTIDARN 131

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
             F+     L + +   ++     +     A++D+   T+NS +PV +      L     
Sbjct: 132 GVFDTKAQLLDLRKDVYLQSSGGYQAWMTQALVDLGKGTVNSDEPVDVVWQGGTLRGQKL 191

Query: 187 RIENSSRSAVFAGQVSVVVN 206
           RI        F G V + ++
Sbjct: 192 RISERGELIRFEGGVVMNLD 211


>gi|222147330|ref|YP_002548287.1| hypothetical protein Avi_0408 [Agrobacterium vitis S4]
 gi|221734320|gb|ACM35283.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 221

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 85/203 (41%), Gaps = 5/203 (2%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFI 72
            K   H   ++ L+   P   V +   F+  S +R        I+   ++   ++M K  
Sbjct: 22  RKAVGHSHRVRRLRIALPALAVVLSLGFVAVSVVRAYLPDNIKIEGAKIEDGKVVMAKPA 81

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
           +S  + +   YS+ A RA     +   +I L+    T+P       D+   A    ++ +
Sbjct: 82  ISGRNSNGAPYSMNAVRALQDIKN-PNLITLETITATMPVNDDTSADIK--AQRGTYDRS 138

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
              + + +PF + +   +  +F++A LDVK   + ++ PV I   +  + A    + +  
Sbjct: 139 TDKMVLDRPFTIHLSSGVDAEFQSADLDVKAGKLKTNQPVSIKTKESSIVAQSMDMTDKG 198

Query: 193 RSAVFAGQVSVVVNPGVLQKKEN 215
           ++    G V + + P  LQK  N
Sbjct: 199 QTITLTGAVRLNIAPTALQKPGN 221


>gi|91974657|ref|YP_567316.1| hypothetical protein RPD_0175 [Rhodopseudomonas palustris BisB5]
 gi|91681113|gb|ABE37415.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 256

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 73/206 (35%), Gaps = 8/206 (3%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLD----FEPM 66
            + +   +H R ++ L+   P    +++     +S +      SK  ID+ D       +
Sbjct: 15  ARFAAAARHSRLVRTLRVAVPLVVALSLAAILAISIFNPFRLLSKLPIDIGDLVVSGTKI 74

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   L+ ++ D   Y + A  A     + +  + L      V +       + + A  
Sbjct: 75  TMESPHLAGFTNDGRPYEMWARSATQDL-TSQDHVDLHTLRAKVVSDD--QSTVLIQARD 131

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            +FN     L + +   ++           A +D+    ++S +PV +      L     
Sbjct: 132 GKFNTKAQLLNLQKDVYLRTSTGSEAWMTQADIDMGKGNVSSDEPVDVKWLGGTLRGQRL 191

Query: 187 RIENSSRSAVFAGQVSVVVNPGVLQK 212
           RI        F G V + ++   L +
Sbjct: 192 RITEKGDVIRFEGGVVMNLDNANLPE 217


>gi|86747784|ref|YP_484280.1| hypothetical protein RPB_0658 [Rhodopseudomonas palustris HaA2]
 gi|86570812|gb|ABD05369.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 243

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 28/200 (14%), Positives = 66/200 (33%), Gaps = 8/200 (4%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
           ++ +   +H R ++ L+   P      +   +  S             +    ++    +
Sbjct: 3   VRFAAAARHSRLVRTLRIAVPLVVALSMAAIIAISLFNPFRLLSKLPLEVGDLVVSGTKI 62

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M+   ++ ++ D   Y + A  A     + +  + L      V +       + + A  
Sbjct: 63  TMESPHMAGFTDDGRPYEMWARSATQDL-TSQDHVDLHTLRAKVVSDD--QSTVLIEARD 119

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            +FN     L + +   ++           A +D+   T+ S +PV +      L     
Sbjct: 120 GKFNTKAQLLNLQKDVYLRTSTGSEAWMTQADIDMSKGTVASDEPVDVKWLGGTLRGQRL 179

Query: 187 RIENSSRSAVFAGQVSVVVN 206
           RI        F G V + ++
Sbjct: 180 RITEKGDVIRFEGGVVMNLD 199


>gi|86356058|ref|YP_467950.1| hypothetical protein RHE_CH00401 [Rhizobium etli CFN 42]
 gi|86280160|gb|ABC89223.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 221

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 89/196 (45%), Gaps = 5/196 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDYS 77
           H   ++ LK   P A + + G     + + +        +   ++   ++M+K  ++  +
Sbjct: 27  HSARVRRLKILLPLAALIVAGALATVALVSLYLPENVKFEGAKIENGKVVMEKPAIAGRN 86

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            D V YS++AERA     +   +I L+  +  VP        +   A +A +N A   L+
Sbjct: 87  SDGVNYSMLAERALQDIRN-PDLITLETIKAAVPMNDGLIARVI--ASTADYNRATDNLH 143

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++ PF + +   L   F++A LD+K   + S DPV IT  +  + A    I +  R   F
Sbjct: 144 MTAPFTLVLSSGLNAQFQSARLDIKGGNMRSDDPVTITKDNASIVAKTLEITDKGRVITF 203

Query: 198 AGQVSVVVNPGVLQKK 213
            G V + V+P  + K+
Sbjct: 204 EGNVRMNVDPSTIHKQ 219


>gi|163867320|ref|YP_001608514.1| hypothetical protein Btr_0015 [Bartonella tribocorum CIP 105476]
 gi|161016961|emb|CAK00519.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 215

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 82/196 (41%), Gaps = 7/196 (3%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI----DLLDFEPMIMKK 70
            K  QH R I  LK F P + +     F   ++  +   + + I    +  +   + +  
Sbjct: 21  KKASQHSRRISLLKIFLPLSALVSALIFCWFTFFSVPHVTSNPIPLNNEESEVMNLTILN 80

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
             L  Y++    Y L AE+A    ++  GII LQ+          +   ++L A    ++
Sbjct: 81  PKLEGYTRAHEPYWLKAEKAFQD-HTRSGIIGLQNITAK--ASMGQQRQIFLAAQGGVYD 137

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
             N  L + +PF +   D +   F +A +++    + +   V I  + F L+AN  +I  
Sbjct: 138 NINGFLQLDKPFTITTNDGMMAQFMSADINLSEGQLKTDQYVNIQRAGFHLAANALQIRE 197

Query: 191 SSRSAVFAGQVSVVVN 206
             ++  F G V +V+ 
Sbjct: 198 KGKNMYFHGGVHLVLQ 213


>gi|90420562|ref|ZP_01228469.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335290|gb|EAS49043.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 260

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 85/208 (40%), Gaps = 6/208 (2%)

Query: 8   NKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEP 65
           ++   + ++ R+H R ++ LK   P     IV   +  +W+  S     S++   ++   
Sbjct: 49  SRASHEFARARRHSRLVRILKIGLPALAAIIVVGGIAVTWVARSLPEDFSVNGTSIEDGR 108

Query: 66  MIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH 125
           ++M+   +S        Y LVAERA  +   G   + L+     +        D+   A 
Sbjct: 109 IVMQDPRMSGIDGKNRPYELVAERAIQALGGGG--VDLETIAAKIAIDDEISADIK--AA 164

Query: 126 SARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANF 185
           S +++    TL ++   ++   + + +    A +D+ +  +    PV I   +  + A+ 
Sbjct: 165 SGKYDPTAETLVLAGGVRVATTNGITISLSAADIDIASGALKGEGPVRIETPEQTIEASS 224

Query: 186 ARIENSSRSAVFAGQVSVVVNPGVLQKK 213
             + N      F G+V +++ P    + 
Sbjct: 225 LNLTNGGDVITFGGRVKMLLRPDKSSQA 252


>gi|227820607|ref|YP_002824577.1| hypothetical protein, putative transmembrane protein [Sinorhizobium
           fredii NGR234]
 gi|227339606|gb|ACP23824.1| hypothetical protein, putative transmembrane protein [Sinorhizobium
           fredii NGR234]
          Length = 239

 Score =  147 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 90/200 (45%), Gaps = 5/200 (2%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFI 72
           +   +H   ++ LK   PFA   I   F   S++R        ++   ++   ++M+   
Sbjct: 40  ASAARHSARVKRLKIVLPFAAGVIALVFAAISFVRAFLPEDLQLETATIENGKIVMQNPA 99

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
           +S  ++  + YS+ A+RA     +   II L+     +P   +      + A S  ++  
Sbjct: 100 ISGRNRQDISYSMKAQRALQDIAN-PDIITLEQIHAEMPVNDTLVA--TVDATSGIYDRG 156

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
            +TL ++ PF + + + +  DF++A LD+    + +  P+ I+ +   + A   R+ +  
Sbjct: 157 ANTLDMNAPFTISMNNGVNADFQSAYLDIDAGEMETKHPIAISMNGGSIIAQSLRMTDKG 216

Query: 193 RSAVFAGQVSVVVNPGVLQK 212
           R   F G V V V P  ++K
Sbjct: 217 RIVTFEGMVRVNVEPSAIRK 236


>gi|306842558|ref|ZP_07475209.1| Hypothetical protein BIBO2_2337 [Brucella sp. BO2]
 gi|306287414|gb|EFM58894.1| Hypothetical protein BIBO2_2337 [Brucella sp. BO2]
          Length = 197

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/194 (21%), Positives = 83/194 (42%), Gaps = 5/194 (2%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            ++ LK   P A + +   F   ++     S          +   ++MK   L+ Y+KD 
Sbjct: 2   RVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHLNGYTKDN 61

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN  L + +
Sbjct: 62  RPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNANGRLQLDK 118

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
            F +   + LR    +A +++K+  I +  PV I +    + A+  +++++ +  +F   
Sbjct: 119 DFTVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGKVLIFENN 178

Query: 201 VSVVVNPGVLQKKE 214
           V + V+   L   +
Sbjct: 179 VHMTVDGNTLSANK 192


>gi|218458734|ref|ZP_03498825.1| hypothetical protein RetlK5_04413 [Rhizobium etli Kim 5]
          Length = 231

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 87/196 (44%), Gaps = 5/196 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDYS 77
           H   ++ LK   P A + +       + + I        +   ++   ++M+K  ++  +
Sbjct: 37  HSARVRRLKILLPVAALIVAAGLTAVALVSIYLPENVKFEGAKIENGKVVMEKPAIAGRN 96

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            D + YS++AERA     +    I L+  +  VP          + A +A +N A   L+
Sbjct: 97  SDGINYSMLAERALQDIRN-PDFITLETIKAAVPMNDGLIA--RVVASTADYNRATDNLH 153

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++ PF + +   L   F++A LD+K   + S DPV IT  +  + A    I +  R   F
Sbjct: 154 MTAPFTLVLSSGLNAQFQSARLDIKGGNMRSDDPVTITKDNASIVAKTLEITDKGRVITF 213

Query: 198 AGQVSVVVNPGVLQKK 213
            G V + V+P  + K+
Sbjct: 214 EGNVRMNVDPSTIHKQ 229


>gi|163757834|ref|ZP_02164923.1| hypothetical protein HPDFL43_20527 [Hoeflea phototrophica DFL-43]
 gi|162285336|gb|EDQ35618.1| hypothetical protein HPDFL43_20527 [Hoeflea phototrophica DFL-43]
          Length = 226

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 96/206 (46%), Gaps = 5/206 (2%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSID--LLDFEPM 66
           +   +  + + H R ++ LK   P A+V +V  F+  S++        +I+   +    +
Sbjct: 18  RSHAEYRRAQTHSRRVRALKILLPLASVLVVIGFVAVSFVDTLVPEGVAIESVAVRDGKL 77

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
           +M+  ++S  + D   Y L A RA     +   +I L+D    +P    E     L A S
Sbjct: 78  VMQNPVMSGQTSDARSYRLEALRAIQDLAT-PDVIVLEDILAELPVSAGETA--VLEATS 134

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
           A F+    TL   +PFK++ +     + ++A +D+    +++SDPV I   +  + A   
Sbjct: 135 ATFDRGAQTLVFREPFKVQSEGGFSAEMQSADIDMATSEMSTSDPVTIRSGEASVVAKSM 194

Query: 187 RIENSSRSAVFAGQVSVVVNPGVLQK 212
           ++++  R  +   QV + +NP  +++
Sbjct: 195 KMQDKGRLIILENQVRMTINPSAIKQ 220


>gi|190890073|ref|YP_001976615.1| hypothetical protein RHECIAT_CH0000443 [Rhizobium etli CIAT 652]
 gi|190695352|gb|ACE89437.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327193443|gb|EGE60341.1| hypothetical protein RHECNPAF_159006 [Rhizobium etli CNPAF512]
          Length = 221

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 88/196 (44%), Gaps = 5/196 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDYS 77
           H   ++ LK   P A + +       + + I        +   ++   ++M+K  ++  +
Sbjct: 27  HSARVRRLKILLPVAALIVAAGLTAVALVSIYLPENVKFEGAKIENGKVVMEKPAIAGRN 86

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            D + YS++AERA     +   +I L+  +  VP          + A +A +N A   L+
Sbjct: 87  SDGINYSMLAERALQDIRN-PDLITLETIKAAVPMNDGLIA--RVVASTADYNRATDNLH 143

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++ PF + +   L   F++A LD+K   + S DPV IT  +  + A    I +  R   F
Sbjct: 144 MTAPFTLVLSSGLNAQFQSARLDIKGGNMRSDDPVTITKDNASIVAKTLEITDKGRVITF 203

Query: 198 AGQVSVVVNPGVLQKK 213
            G V + V+P  + K+
Sbjct: 204 EGNVRMNVDPSTIHKQ 219


>gi|92115810|ref|YP_575539.1| hypothetical protein Nham_0178 [Nitrobacter hamburgensis X14]
 gi|91798704|gb|ABE61079.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 258

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 70/201 (34%), Gaps = 8/201 (3%)

Query: 10  ILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFE 64
           +  + ++  +H R ++ L+   P     ++   +  +             +    ++   
Sbjct: 17  LEARFARAARHSRMVRALRIAVPAVVGLVMAALIAVAVFNPFRALAKLPLEMDNLVVSGT 76

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M+   LS ++ D+  Y + A  A     +    + L      V  +      + L +
Sbjct: 77  KITMESPHLSGFTPDKRPYEMQATTATQDI-TDPDHVELHTLRAKVLMEDR--STVTLNS 133

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
            +  F+     L + +   M+           A++D+   T+ S  PV +   +  L+A+
Sbjct: 134 RTGVFDTKTQMLDLHKDILMQSSTGYEARLSHALVDMGQGTVTSDQPVDVKLLNGTLTAD 193

Query: 185 FARIENSSRSAVFAGQVSVVV 205
             ++        F   V + +
Sbjct: 194 TMKVTEKGDVVRFENNVVMHL 214


>gi|116250188|ref|YP_766026.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254836|emb|CAK05910.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 221

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 90/196 (45%), Gaps = 5/196 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDYS 77
           H   ++ LK   P A + I       + + I       ++   ++   ++M+K  +S  +
Sbjct: 27  HSARVRRLKILLPVAALIIAASLTAVALVSIYLPENVKMEGAKIENGKVVMEKPAISGRN 86

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            D + YS++AERA     +   +I L+  +  VP          + A +A +N     L+
Sbjct: 87  SDGINYSMLAERALQDIRN-PNLITLETIKAAVPMNDGLIA--RVVASTADYNRTTDNLH 143

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++ PF + +   L  +F++A LD+K   + S DPV IT  +  + A   +I +  R   F
Sbjct: 144 MTAPFTLVLSSGLNANFQSAELDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITF 203

Query: 198 AGQVSVVVNPGVLQKK 213
            G V + V+P  + K+
Sbjct: 204 EGNVRMNVDPSTIHKQ 219


>gi|241202815|ref|YP_002973911.1| hypothetical protein Rleg_0061 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856705|gb|ACS54372.1| protein of unknown function DUF1239 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 221

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 91/196 (46%), Gaps = 5/196 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDYS 77
           H   ++ LK   P A + +       + + I       ++   ++   ++M+K  +S  +
Sbjct: 27  HSARVRRLKILLPVAALIVAASLTAVALVSIYLPENIKMEGAKIENGKVVMEKPAISGRN 86

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            D + YS++AERA     +   +I L+  +  VP          + A +A +N A   L+
Sbjct: 87  SDGINYSMLAERALQDIRN-PDLITLETIKAAVPMNDGLIA--RVVASTADYNRATDNLH 143

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++ PF + +   L  +F++A LD+K   + S DPV IT  +  + A   +I +  R   F
Sbjct: 144 MTAPFTLVLSSGLNANFQSAQLDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITF 203

Query: 198 AGQVSVVVNPGVLQKK 213
            G V + V+P  + K+
Sbjct: 204 EGNVRMNVDPSTIHKQ 219


>gi|240849696|ref|YP_002971084.1| hypothetical protein Bgr_00140 [Bartonella grahamii as4aup]
 gi|240266819|gb|ACS50407.1| hypothetical protein Bgr_00140 [Bartonella grahamii as4aup]
          Length = 214

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/195 (21%), Positives = 80/195 (41%), Gaps = 6/195 (3%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKS---SIDLLDFEPMIMKKF 71
            K  +H R I  LK F P   +     F   ++  +   S S   + +      + M   
Sbjct: 21  KKASRHSRRISVLKIFLPLLALISALVFCWFTFFLVPVTSDSMPLNNEESGVVNLTMLNP 80

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
            L  Y++    Y L AE+A    ++  G+I LQ+          +   ++L A    ++ 
Sbjct: 81  KLEGYTRAHEPYWLKAEKAFQD-HTHSGMIGLQNITAK--AFMGQQKQVFLAAQGGVYDN 137

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
            N  L + +PF +   D + + F +A +++    + +   V I  +   L+AN  +I   
Sbjct: 138 INGFLQLDKPFTITTNDGIMVQFMSASINLSEGQLKTDQRVNIQQAGLHLAANALQIREK 197

Query: 192 SRSAVFAGQVSVVVN 206
            ++  F G V +V+ 
Sbjct: 198 GKNMYFHGGVHLVLQ 212


>gi|150395246|ref|YP_001325713.1| hypothetical protein Smed_0018 [Sinorhizobium medicae WSM419]
 gi|150026761|gb|ABR58878.1| protein of unknown function DUF1239 [Sinorhizobium medicae WSM419]
          Length = 222

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 88/196 (44%), Gaps = 5/196 (2%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDY 76
           +H   ++ LK   P     I   F   S++R     +  ++   ++   ++M+   +S  
Sbjct: 27  RHSARVKRLKVILPLIAGLIALVFAAVSFVRAFLPEELQLETATIENGKIVMQNPAISGR 86

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +K  + YS+ A+RA     +   II L+     +P   +      + A S  ++   +TL
Sbjct: 87  NKQDISYSMKAQRALQDIAN-PNIITLETIHAEMPVNDTLIA--TVDAQSGVYDRGANTL 143

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            ++ PF + + + +  DF++A LD+    + +  P+ I+ +   + A   R+ +  R   
Sbjct: 144 DMNAPFTISMNNGVIADFQSAYLDINAGEMETKHPIAISMTGGSIIAQKLRMTDKGRVVT 203

Query: 197 FAGQVSVVVNPGVLQK 212
           F G V V + P  ++K
Sbjct: 204 FEGMVRVNIEPSAIRK 219


>gi|239831004|ref|ZP_04679333.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823271|gb|EEQ94839.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 237

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 84/201 (41%), Gaps = 5/201 (2%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSK--SSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A V +   F   +++            +  +   ++M    L
Sbjct: 38  AAQRHSVRVRVLKTALPVAAVIVAAVFSWYTFLATPNTPIKVEVNNGGESGKLVMTSPHL 97

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P        +   +    ++ AN
Sbjct: 98  NGYTKDNRPYSMTAAKATQDAKN-SGAISLEGISAELPVGEKGMAKVEATS--GVYDNAN 154

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L + + F +   D LR    +A +++K+  I +  PV I      + A+  +++++ +
Sbjct: 155 GRLQLDKDFTVTTDDGLRAVMHSADVNLKSGQITTDKPVDIRSGSTHILADSMQVKDNGK 214

Query: 194 SAVFAGQVSVVVNPGVLQKKE 214
             +F  +V + V+  V+   +
Sbjct: 215 VLIFENKVRMTVDGSVVSPNK 235


>gi|254471142|ref|ZP_05084545.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211960284|gb|EEA95481.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 217

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 79/211 (37%), Gaps = 5/211 (2%)

Query: 5   DRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTF-SKSSIDLLDF 63
           + + ++   R   R+H   ++ L+F  P   + I    +     +            L  
Sbjct: 11  EAQTRLEKARKAARRHSILVRLLRFALPAGGLLIAAGVIAMVVFQNILAGLSIGDISLTT 70

Query: 64  EPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123
           E ++M    LS    D   Y++ A+RA     +   +I L++    +     E   + + 
Sbjct: 71  EGLVMSNPHLSGNDGD-RSYNVQADRAIQRI-TNPQVIDLENIVAEITIAPGE--TVSIT 126

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
           + +  F+    TL ++    +        +FE   +D+K  TI ++D V +T     + A
Sbjct: 127 SRNGTFDTEMETLNLTNGITVAYSKGYSAEFEYLDIDMKTGTIQTNDTVDVTSEGGYIDA 186

Query: 184 NFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
                +  +    F   V + + P  L+  +
Sbjct: 187 GSMEFDQKNNVLNFRRGVKMKLLPWALENGQ 217


>gi|110635995|ref|YP_676203.1| hypothetical protein Meso_3670 [Mesorhizobium sp. BNC1]
 gi|110286979|gb|ABG65038.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 235

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 85/211 (40%), Gaps = 4/211 (1%)

Query: 6   RRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDF 63
           R  +     ++  +H R ++ LKF  P   V I G FL  S                ++ 
Sbjct: 19  RSERGAEAFARAARHSRRVRVLKFVLPAVAVAISGLFLGYSLIAPTGIHALNLDSATIEG 78

Query: 64  EPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123
             ++M    L+ ++   + YS+ A  A+    +  G I L+  + T+P          + 
Sbjct: 79  GSLVMHNPSLNGFTSGNLPYSVTAALARQEVGADSGPIELEKIQATLPIDSGRQA--LVT 136

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
           A    FN A + L ++    ++    +    ++A +D+ +  +++ +PV I  +   + A
Sbjct: 137 AGGGVFNQATNQLLLNNAITVESNAGISAQLKSAAVDMSSGNLSTDEPVDIEVNGMRVRA 196

Query: 184 NFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
                 +     VF   V + ++P  +++ +
Sbjct: 197 KSFHTVDGLERLVFENGVRLEIDPASVRRAQ 227


>gi|209883610|ref|YP_002287467.1| hypothetical protein OCAR_4456 [Oligotropha carboxidovorans OM5]
 gi|209871806|gb|ACI91602.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 230

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 76/203 (37%), Gaps = 8/203 (3%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPMIMKK 70
           +  +H R +++L+   P   V  +   + +S               S   +    + M  
Sbjct: 17  RAARHSRRVRWLRRAVPAIVVVALALIIGASVFNPFRFLNKLPIDLSKLSVSGTKITMDA 76

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
             L+ +  D+  Y + A+ A     +    + + +    V  +      + L A +  FN
Sbjct: 77  PHLAGFLPDQRPYEVWAKAATQDV-TDPTKVDMLNIRAQVQLED--KSTVRLDAQNGHFN 133

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
                L ++    ++           A +D+ +  I+S  PV +  ++  L++   RI  
Sbjct: 134 TKTQLLDLTNDILLQTTSGYEARLSQARVDMGSGVISSDQPVAVKLTNGTLNSQNLRITE 193

Query: 191 SSRSAVFAGQVSVVVNPGVLQKK 213
              SAVF G V++++ P   +  
Sbjct: 194 HGASAVFGGGVTMMLEPPAEKPA 216


>gi|46201482|ref|ZP_00054960.2| hypothetical protein Magn03009616 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 238

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 22/197 (11%), Positives = 69/197 (35%), Gaps = 7/197 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRI----STFSKSSIDLLDFEPMIMKKFILSD 75
           H  F+  +K   P   V ++G  ++   +         S +++     + ++MK      
Sbjct: 33  HSHFVSVMKIALPALAVFLLGLVVIWPKLSQLESGFKLSFANLSPKSVDTLVMKNARYFG 92

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
             +    +++ ++ A       + +I+L + +    +      ++ + A +  ++ +   
Sbjct: 93  VDESNRPFAVTSDTATQ-LPDNQDLIYLVNPKADFTSNSG--ANIVVDAVAGIYHQSTKV 149

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
           L +S    +       +   TA++++   +    +PV        + +    I       
Sbjct: 150 LDLSGGVNLYHDSGYEIHTPTAIVELATNSARGFEPVEGHGPQGAIRSIGFEITGKRHDI 209

Query: 196 VFAGQVSVVVNPGVLQK 212
            F G+  + +     + 
Sbjct: 210 TFTGKSQLNLRAVSKKA 226


>gi|121602696|ref|YP_989617.1| hypothetical protein BARBAKC583_1370 [Bartonella bacilliformis
           KC583]
 gi|120614873|gb|ABM45474.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 214

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 87/190 (45%), Gaps = 6/190 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMI---MKKFILSDY 76
           H R+I  LK F PF    I   F   ++  +ST  ++ I     + +    M    L  Y
Sbjct: 26  HSRWIHVLKIFLPFFAFIIALVFCWFTFFSVSTSFETVILNNGEDGITALTMVDPRLEGY 85

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +     Y L AE+A    +   G++ L++    VP   S+   ++L A    ++ +N  L
Sbjct: 86  TSSNQPYQLKAEKAFQD-HMRLGVVELENITAEVPA--SKQVSVFLQAQRGIYDNSNTHL 142

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +++PF MK KD L   F  A +++    + +   V I ++DF L+A   R+    +   
Sbjct: 143 QLNKPFTMKTKDGLVAQFMAADINLSEGQLKTDQRVDIYNADFSLTAGNLRVCEKGQIMH 202

Query: 197 FAGQVSVVVN 206
           F G V ++++
Sbjct: 203 FQGGVHLLIS 212


>gi|158425552|ref|YP_001526844.1| hypothetical protein AZC_3928 [Azorhizobium caulinodans ORS 571]
 gi|158332441|dbj|BAF89926.1| putative uncharacterized protein [Azorhizobium caulinodans ORS 571]
          Length = 240

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 74/211 (35%), Gaps = 8/211 (3%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIR-----ISTFSKSSIDLLDF 63
           +      K  +H   ++ +K   P   V  +   +    +R     +          L  
Sbjct: 21  RAAPDFRKATRHSARVRLVKRVLPVLIVVALVLMVSIPLLRNLTMTMELPFDLGRLSLSG 80

Query: 64  EPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123
             + M+   LS ++ D   Y++ A  A     +   +I L D    +      +    + 
Sbjct: 81  TRLTMEAPKLSGFTDDNRAYTITAGSAVQDV-TKPDLIGLTDVFAKMELANKGWA--TVK 137

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
           + +   +     + +S    +          + A +DVK  T+ +  PV++T+ D  L A
Sbjct: 138 SRTGSLDTKTQFITLSDGVDLATNSGYAGQMQDAGVDVKAGTVTTDHPVVLTYMDGRLVA 197

Query: 184 NFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           +  +I +    A F G V +      L K E
Sbjct: 198 DKLQITDRGGRAFFDGHVQLDFRLSSLPKSE 228


>gi|85714032|ref|ZP_01045021.1| hypothetical protein NB311A_07748 [Nitrobacter sp. Nb-311A]
 gi|85699158|gb|EAQ37026.1| hypothetical protein NB311A_07748 [Nitrobacter sp. Nb-311A]
          Length = 218

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 70/201 (34%), Gaps = 8/201 (3%)

Query: 10  ILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFE 64
           +  + ++  +H R ++ L+   P A    +   +  +                  ++   
Sbjct: 5   LEARFARAARHSRMVRVLRIAVPGAVGLAMAALIGIATFNPFHALANLPLDMDNLVVSGT 64

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M+   L+ ++ D+  Y + A  A     +    + L      V  +      + L +
Sbjct: 65  KITMESPRLAGFTPDKRPYEMQATTATQDV-TDPDRVELHTLRAKVLMEDD--STVTLNS 121

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
           H+  FN     L + +   M+           A++D+   T+ S  PV +   +  L+A+
Sbjct: 122 HTGMFNTKTQILDLQKDIFMRSSTGYEARLTHAMVDMGRGTVTSDQPVDVKLLNGTLTAD 181

Query: 185 FARIENSSRSAVFAGQVSVVV 205
             ++        F   V + +
Sbjct: 182 TMQVTEKGDVVRFENNVVMHL 202


>gi|299133325|ref|ZP_07026520.1| protein of unknown function DUF1239 [Afipia sp. 1NLS2]
 gi|298593462|gb|EFI53662.1| protein of unknown function DUF1239 [Afipia sp. 1NLS2]
          Length = 233

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 80/209 (38%), Gaps = 8/209 (3%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFEPM 66
            +  +  +H R +++L+   P   +  +   + +S               S   +    +
Sbjct: 13  PRFVRAARHSRRVRWLRRAVPAVVILSLALIIGASVFNPFRFLKKLPIDLSKLSVSGTKI 72

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
            M    L+ Y  DR  Y + A+ A     +    + + D    V  Q      + + A +
Sbjct: 73  TMDAPHLAGYLPDRRPYEVWAKAATQDV-TDPTKVDMLDIRAQVQMQD--KSTLRVDAQN 129

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
             F+     L ++    ++     +     A +D+    I+S  PV +  ++  L++   
Sbjct: 130 GHFDTKTQLLDLTNQILLQTTTGYQAQLTQARVDLATGIISSDQPVAVKLTNGTLNSQNL 189

Query: 187 RIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
           RI +   SAVF G V+++++P   +   +
Sbjct: 190 RITDHGASAVFGGGVTMLLDPPADKTNAD 218


>gi|75674371|ref|YP_316792.1| hypothetical protein Nwi_0172 [Nitrobacter winogradskyi Nb-255]
 gi|74419241|gb|ABA03440.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 230

 Score =  141 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 67/201 (33%), Gaps = 8/201 (3%)

Query: 10  ILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-----TFSKSSIDLLDFE 64
           +  + ++  +H R ++ L+   P A    +   +  +                  ++   
Sbjct: 17  LEARFARAARHSRMVRTLRIAVPAAVGLAMAGLIGVAAFNPFRTLANLPLDMDNLVVSGT 76

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M+   L+ ++ D+  Y + A  A          + L      V  +      + L +
Sbjct: 77  KITMESPRLAGFTPDKRPYEMQATTATQDVA-DPDHVELHTLRAKVLMEDRT--TVTLNS 133

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
            +  FN     L + +   M            A++D+   T+ S  PV +   +  L+A+
Sbjct: 134 RTGVFNTKTQVLDLRKDILMLSSTGYEARLTHAIVDMGRGTVTSDQPVDVKLLNGTLTAD 193

Query: 185 FARIENSSRSAVFAGQVSVVV 205
             ++        F   V + +
Sbjct: 194 TMQVTEKGDVVRFENNVVMHL 214


>gi|15964137|ref|NP_384490.1| hypothetical protein SMc01136 [Sinorhizobium meliloti 1021]
 gi|307301282|ref|ZP_07581044.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307317953|ref|ZP_07597390.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|15073313|emb|CAC41821.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896355|gb|EFN27104.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306903738|gb|EFN34325.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 222

 Score =  141 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 88/196 (44%), Gaps = 5/196 (2%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDY 76
           +H   ++ LK   P     +   F+  S++R     +  ++   ++   ++M+   +S  
Sbjct: 27  RHSARVRRLKVMLPLIAGAVALIFVTVSFVRAFLPEELQLETATIENGKIVMQNPAISGR 86

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +K  + YS+ A+RA     +   +I L+     +P   +      + A S  ++   +TL
Sbjct: 87  NKQDISYSMKAQRALQDIAN-PNLITLETIHAEMPVNDTLIA--TVDATSGIYDRGANTL 143

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            ++ PF + + + +  DF++A LD+    + +  P+ I+     + A   R+ +  R   
Sbjct: 144 DMNAPFTISMNNGVNADFQSAYLDINAGEMETKHPIAISMKGGSIIAQKLRMTDKGRVVT 203

Query: 197 FAGQVSVVVNPGVLQK 212
           F G V V + P  ++K
Sbjct: 204 FEGMVRVNIEPSAIRK 219


>gi|148251745|ref|YP_001236330.1| hypothetical protein BBta_0124 [Bradyrhizobium sp. BTAi1]
 gi|146403918|gb|ABQ32424.1| hypothetical protein BBta_0124 [Bradyrhizobium sp. BTAi1]
          Length = 233

 Score =  141 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 78/202 (38%), Gaps = 8/202 (3%)

Query: 10  ILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL-----LDFE 64
           +  + +   +H RF++ L+   P A    +   +  +         ++ +L     +   
Sbjct: 13  LQARFAVAARHSRFVRVLRVAVPAAVGLAMAVVIGVALFNPFHMEINTKNLTGNLVISGR 72

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M+   L+ ++ D+  Y LVA+ A     +    + L      V  +      + L A
Sbjct: 73  KITMETPHLTGFTPDQRPYDLVAKSAVQDL-TDPDHVELNILRAKVLMED--QSTVTLNA 129

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
            +  F+     L + +   +            A +D+   T++S + V +  ++  LSA+
Sbjct: 130 KTGVFDTKQQQLDLKKDILLTTSSGYEARLSRAFVDMAKGTVSSDERVDVKLTNGTLSAD 189

Query: 185 FARIENSSRSAVFAGQVSVVVN 206
             RI ++     F G V + ++
Sbjct: 190 RLRITDNGDVVRFEGNVVMNLD 211


>gi|27375831|ref|NP_767360.1| hypothetical protein blr0720 [Bradyrhizobium japonicum USDA 110]
 gi|27348969|dbj|BAC45985.1| blr0720 [Bradyrhizobium japonicum USDA 110]
          Length = 244

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 75/194 (38%), Gaps = 9/194 (4%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS------TFSKSSIDLLDFEPMIMKKFI 72
           +H R ++ L+   P A +  +   +  S               S   ++    + M+   
Sbjct: 22  RHSRLVRILRVAVPGAVLLSLAAIVGVSIFNPFRMLLPKLPLDSGNLVVSGTKITMESPH 81

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
           L+ Y+ DR  Y L A+ A     +    + L D    V  +      ++L A + RF+  
Sbjct: 82  LAGYTPDRRPYELWAKTATQDI-TDPDHVDLSDLRAKVLMED--QSTLFLDARTGRFDNK 138

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
              L + +   ++          +A +D+   T++S + V +  ++  L+A+  RI    
Sbjct: 139 QQQLDLHKDIFLRTSTGYEARLNSAFVDMGKGTVSSDERVDVKLTNGTLTADRLRITEGG 198

Query: 193 RSAVFAGQVSVVVN 206
               F G V + ++
Sbjct: 199 DLIRFEGNVVMHLD 212


>gi|83591353|ref|YP_425105.1| hypothetical protein Rru_A0013 [Rhodospirillum rubrum ATCC 11170]
 gi|83574267|gb|ABC20818.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 274

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 25/216 (11%), Positives = 61/216 (28%), Gaps = 10/216 (4%)

Query: 6   RRNKILLQRSKYRQHVRFIQFLKFFFP-FATVTIVGWFLLSSWIRISTFSKSSIDLLDFE 64
           R  K     +  + + RF+  +K   P  A   +            +         LD  
Sbjct: 36  RPRKTRPAGASPQGYSRFVALMKLLLPSLAAAMLGVVLAWPQIADRTESLNLDFSALDPS 95

Query: 65  PMIMK---KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY 121
            + +K                +++ A+ A     +G     L + +  +     ++  + 
Sbjct: 96  AIDLKSVVNPRYLGTDSTDQPFTVTADLAT-EMGAGDERTRLTNPKGDLTQSSGKW--LS 152

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L +           + +     +   D  +     A + +         PV        +
Sbjct: 153 LSSDLGYLTDQKQVVDLESGVLLYRDDGFQFQTNAARIHLDTDEAMGDQPVKGQGPGLEI 212

Query: 182 SANFARIENSSRSAVFAGQVSVVV---NPGVLQKKE 214
            +   R+ +     +F G+  +VV   +P      +
Sbjct: 213 VSEGFRVLDGGNRILFTGKAKLVVTESDPAAPSPAK 248


>gi|307943001|ref|ZP_07658346.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773797|gb|EFO33013.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 223

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 84/209 (40%), Gaps = 6/209 (2%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFP-FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP 65
           R +  +QR+  R+H R ++ L+F FP    +   G   L     + +   ++  +L  + 
Sbjct: 19  RPETPVQRA-ARRHSRLVKTLRFLFPALGALIFAGMIGLIVLFNLFSSMGAANVILTADG 77

Query: 66  MIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH 125
           ++M   +LS +  +   Y++ A RA    +    I+ L+  +  +     E  ++   A 
Sbjct: 78  LVMDYPVLSGHDGE-KSYNVTARRAIQRLS-DPRILDLEFIDADIVLGPDEKANV--TAV 133

Query: 126 SARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANF 185
              +N A  TL +    ++       ++     +D+K+  + +S+PV I      L    
Sbjct: 134 KGIYNNAGETLKLYDGVQVDWSQGYEVEVSEVDIDMKSGALKTSEPVAIDSDKGRLLGGK 193

Query: 186 ARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
              +  +    F   V + + P     +E
Sbjct: 194 MDYDQDNGIVRFTDGVKMTIAPSAQASQE 222


>gi|222084666|ref|YP_002543195.1| hypothetical protein Arad_0623 [Agrobacterium radiobacter K84]
 gi|221722114|gb|ACM25270.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 228

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 53/209 (25%), Positives = 100/209 (47%), Gaps = 8/209 (3%)

Query: 12  LQRSKYRQ---HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPM 66
           L+R+ Y+    H   ++ LK F P A + +   F+  S +R        I+   ++   +
Sbjct: 16  LERNAYKDAIFHSTRVRKLKLFLPLAALIVSLIFIAVSLVRAYLPENIQIEGARIEDGKV 75

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
           +M++  ++  +KD + YS++AE+A     +   +I L+  + ++P        +   A S
Sbjct: 76  VMERPAIAGRNKDGINYSMLAEKALQDIKN-PNMITLKSIKASMPVNSDVIAHV--TAES 132

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
           A F+    TL ++ PF + + + LR +F TA LDVK   ++S D V I      + A   
Sbjct: 133 ADFDRQADTLKLTDPFTILMDNGLRAEFRTAFLDVKKGDLSSQDQVAIYRGGMSVVAQSL 192

Query: 187 RIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
           ++ +      F GQV + ++P  L  K +
Sbjct: 193 KMTDKGSVIEFDGQVRMNIDPTTLHNKAS 221


>gi|298290362|ref|YP_003692301.1| hypothetical protein Snov_0349 [Starkeya novella DSM 506]
 gi|296926873|gb|ADH87682.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 325

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 71/204 (34%), Gaps = 8/204 (3%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFPFATV-TIVGWFLLSSWIRISTFSKSSIDLL---- 61
           R+K + +     +H R ++F ++  P      +     ++     S       +L     
Sbjct: 33  RSKTVARFKAAARHSRRVRFFRWALPVGVTTALGLTLAVNYLDPFSIAVDLPFELGRISL 92

Query: 62  DFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY 121
               + M+   L  ++ D   YS+ AE A     +    I L+     +      +  + 
Sbjct: 93  SGSKVKMEFPKLHGFTSDNRGYSVTAEAAYQDL-TKPDAIDLETIAAKLELADHGW--VN 149

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L A +  ++     L +    +           + A +D+K   + S  PV  T+ D  L
Sbjct: 150 LVAATGHYDTKTEKLMLDGGIRFDTSSGYGGHLQNASVDIKGGKLVSKKPVEFTYLDGKL 209

Query: 182 SANFARIENSSRSAVFAGQVSVVV 205
           +A+   +      A+  G V +  
Sbjct: 210 TADSIEVTQKDSRALLVGNVQLDF 233


>gi|254477121|ref|ZP_05090507.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214031364|gb|EEB72199.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 199

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 62/200 (31%), Gaps = 11/200 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           + R + +LK   P   + ++    L S                        +     S  
Sbjct: 4   YSRLVAYLKVLLPLTALALMSTVFLLSRGVETDAVIPFAQKDLKDRTSGQQITAPFFSGT 63

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +    +  + A+ A+    +G         +L    + +E G +++ +            
Sbjct: 64  TTQGDEIMVTAQSARPGGANGP----ATAIDLQAEIRMAEGGTIHVSSDIGELRPEKEIA 119

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS-- 194
                 ++   D LR+  +     +  +  +S  PV        L+A    I+  + +  
Sbjct: 120 SFRGDVEILSSDGLRVTTQELNAALNGVKADSPGPVEARGPIGTLTAGAMEIDTKTENGP 179

Query: 195 --AVFAGQVSVVVNPGVLQK 212
              VF   V ++ +P   ++
Sbjct: 180 VHMVFNKGVKLLYDPQQSER 199


>gi|83944936|ref|ZP_00957302.1| hypothetical protein OA2633_09914 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851718|gb|EAP89573.1| hypothetical protein OA2633_09914 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 241

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 29/212 (13%), Positives = 71/212 (33%), Gaps = 4/212 (1%)

Query: 8   NKILLQRSKYRQHVRFIQFLKFFFPFATVTIVG---WFLLSSWIRISTFSKSSIDLLDFE 64
            +     +  R   RF+  L+     A   +       ++ S  R +   + ++     E
Sbjct: 15  QRRAKSLATARARSRFVAGLRLVLLAAGAVVALNALVQIVLSGGRSAPSPEVALSATAGE 74

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
              +     +   +    Y + AE A+    + + +I L+   L             + A
Sbjct: 75  SERIINPRFTGRDEGGTPYVITAETAERRSGAEQALIDLEGPTLDYALLDDGADASRVLA 134

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
               F+ +N +L++    ++  +     D ++A L ++   +    PV        + A+
Sbjct: 135 RHGVFDESNLSLHLETDVRLTTRSGYVFDTQSATLFLREGVVTGPQPVHGLAPWGAVRAD 194

Query: 185 FARIENSSRSAVFAGQVSVVVN-PGVLQKKEN 215
              +    +  +  G V    N P     +++
Sbjct: 195 RFEVREDGQHIILQGDVRTRFNAPASSDTQQD 226


>gi|15887686|ref|NP_353367.1| hypothetical protein Atu0335 [Agrobacterium tumefaciens str. C58]
 gi|15155241|gb|AAK86152.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 235

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 95/197 (48%), Gaps = 6/197 (3%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDY 76
           +H   ++ LK   P +   I   F+  S IR     K S++   ++   ++M+K  ++  
Sbjct: 41  RHSARVKRLKIILPLSAAIISLAFIAVSVIRTWAPEKVSLESARIEDGKIVMEKPAVAGR 100

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           ++  + YS+ A+RA     +   ++ L+     VP   S    +   A    F+ + +TL
Sbjct: 101 NEKGIDYSMNADRALQDIAN-PNLMTLEKVLAAVPVNDSVAQVI---AQEGIFDRSTNTL 156

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            ++ PF + + + ++  F++A +D+K   ++S +PV I  +D  + A    I ++ ++  
Sbjct: 157 KMTAPFDINLSNGIQAKFQSADVDLKAGKMSSKEPVSIKTNDGSIVAQSIDIADNGKTIT 216

Query: 197 FAGQVSVVVNPGVLQKK 213
           F+GQV   +    ++ +
Sbjct: 217 FSGQVRARIAASNIKNE 233


>gi|146337289|ref|YP_001202337.1| hypothetical protein BRADO0116 [Bradyrhizobium sp. ORS278]
 gi|146190095|emb|CAL74087.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 236

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 76/202 (37%), Gaps = 8/202 (3%)

Query: 10  ILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSS-----IDLLDFE 64
           +  + +   +H RF++ L+   P      +   +  ++      +  +       ++   
Sbjct: 13  LQARFAVAARHSRFVRALRIAVPAVVGVAMTVVIYVAFFNDFRVAVDTGNLTGNVVISGR 72

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M+   L+ ++ D+  Y LVA  A     +    + L      V  +      + L A
Sbjct: 73  KITMETPHLTGFTPDQRPYDLVAHSAVQDL-TDPDHVELNILRAKVLMED--QSTVTLKA 129

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
            +  F+     L + +   +            A +D+   T++S + V +  ++  LSA+
Sbjct: 130 ATGLFDTKQQQLELKKDILLTTSTGYEARLSRASVDMAKGTVSSDERVDVKLTNGTLSAD 189

Query: 185 FARIENSSRSAVFAGQVSVVVN 206
             RI ++     F G V + ++
Sbjct: 190 RLRITDNGEVIRFEGNVVMNLD 211


>gi|114568662|ref|YP_755342.1| hypothetical protein Mmar10_0108 [Maricaulis maris MCS10]
 gi|114339124|gb|ABI64404.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 237

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 70/197 (35%), Gaps = 1/197 (0%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM 68
           +  L  S  R+   F++ ++ FF  A + I G  +    +     +    + +    + M
Sbjct: 24  RRALALSVARKRTAFVRGMRLFFTAAALAITGLLVAQLVLGSGGPTTGETEAVSE-DVRM 82

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
                +   ++   Y + A+ A    ++  G+  L+   L      +      + A S R
Sbjct: 83  TNPRFTGRDENLTPYVVTADTAIRRRDAADGVTELEHPRLDYNFLETGTDVSRVLAESGR 142

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
           ++L N  L +      + +         A + ++   +   + V  T     + A+   I
Sbjct: 143 YDLPNRILDLHSDVNFRTRAGYTFQSNHARIFLREERVTGEESVEGTGPMGTIRADSYEI 202

Query: 189 ENSSRSAVFAGQVSVVV 205
            +     VF+G V   +
Sbjct: 203 TDGGNRIVFSGNVRARL 219


>gi|170743377|ref|YP_001772032.1| hypothetical protein M446_5274 [Methylobacterium sp. 4-46]
 gi|168197651|gb|ACA19598.1| protein of unknown function DUF1239 [Methylobacterium sp. 4-46]
          Length = 245

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/206 (17%), Positives = 80/206 (38%), Gaps = 7/206 (3%)

Query: 8   NKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD----F 63
           ++ L    + + H   ++FL+   P  +   +   +  +W+        ++ L +     
Sbjct: 21  SRRLRAHRRAQAHSARVRFLRRAIPLGSAAAILAVVAVTWLDPFGALGVTVTLGEVSVSG 80

Query: 64  EPMIMKKFILSDYS-KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
             + M++  L+ Y  KD   Y + A  A         +I LQ     +          +L
Sbjct: 81  SKVTMERPRLTGYRGKDGRPYEVTARAALQDVR-RPTVIELQSMRGQM-QSDEAGTLSHL 138

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A S  F+    +L +S+  ++           +A ++ K  T+ S +PV +T  +  + 
Sbjct: 139 EAQSGVFDTQRESLDLSRSIRLWTDKGQEARLSSAQVNFKAGTLTSREPVSVTLPNGTIQ 198

Query: 183 ANFARIENSSRSAVFAGQVSVVVNPG 208
           A+   +  + ++  F G V  V + G
Sbjct: 199 ADALDVVENGKTISFIGNVKTVFDGG 224


>gi|85705766|ref|ZP_01036863.1| hypothetical protein ROS217_10712 [Roseovarius sp. 217]
 gi|85669756|gb|EAQ24620.1| hypothetical protein ROS217_10712 [Roseovarius sp. 217]
          Length = 204

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 64/204 (31%), Gaps = 11/204 (5%)

Query: 15  SKYRQ-HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKK 70
           ++ +  + R + ++K   P   + ++    L S       +            + +   K
Sbjct: 2   ARAQNTYSRIVAWMKIILPLTALGLLSTLFLFSRTVDPTQTVPIDQLDLEQRAQDLGATK 61

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
              +  + D  + +  AE A+    +    +  +D    +         + + + +A   
Sbjct: 62  PRFAGVTADGDEITFAAEIARPDRKT-PDQLIAEDITAQLRLSAGTV--IDITSANAEMQ 118

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
             + T  ++    +       +D E     +  +   +   V  T     ++A    + N
Sbjct: 119 QGDMTASLTGRVHITTSTGYEIDTERLNAKLDEVYAETPGRVEATGPLGEVTAGRMLLHN 178

Query: 191 SSR----SAVFAGQVSVVVNPGVL 210
           +S       +F   V ++  P   
Sbjct: 179 NSESATPELLFTEGVKLIYRPEEA 202


>gi|325291770|ref|YP_004277634.1| hypothetical protein AGROH133_03501 [Agrobacterium sp. H13-3]
 gi|325059623|gb|ADY63314.1| hypothetical protein AGROH133_03501 [Agrobacterium sp. H13-3]
          Length = 221

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 95/200 (47%), Gaps = 6/200 (3%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFIL 73
           +  +H   ++ LK   P     I   F+  S IR     + S++   ++   ++M+K  +
Sbjct: 24  RALRHSARVKRLKIILPLGAAIISFAFVAVSLIRTWAPEEVSLESARIEDGKIVMEKPAV 83

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           +  ++  + YS+ A+RA     +   ++ L+     VP   S    +   A    F+ A 
Sbjct: 84  AGRNEKGIDYSMNADRALQDIAN-PNLMTLERVLAAVPVNDSVAQVI---AKEGIFDRAT 139

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +TL ++ PF + + + ++  F++A +D+K   ++S +PV I  +D  + A    I ++ +
Sbjct: 140 NTLKMTAPFDINLSNGIQAKFQSADVDLKAGKMSSKEPVSIKTNDGAIVAQSIDIADNGK 199

Query: 194 SAVFAGQVSVVVNPGVLQKK 213
           +  F+GQV   +    ++ +
Sbjct: 200 TITFSGQVRARIAASNIKNE 219


>gi|319898206|ref|YP_004158299.1| hypothetical protein BARCL_0015 [Bartonella clarridgeiae 73]
 gi|319402170|emb|CBI75696.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 216

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/190 (22%), Positives = 81/190 (42%), Gaps = 6/190 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPM---IMKKFILSDY 76
           H   ++ L+   P   + I   F   ++  I     + +   + E +    M    L  Y
Sbjct: 26  HSYQVRLLRICLPIFALIIALVFCWFTFFSIFVPFDNVLLRHEEEKIAQLTMLNPRLEGY 85

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +     Y + AE+A     S  GII L++    +PT   + G +++ A    ++  N  L
Sbjct: 86  TNFYKPYWIKAEKAFQDRKS-SGIIGLKNITAELPT--GKQGQLFINAEEGAYDNINSRL 142

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            + +PF +  KD +   F TA +++    +N+  PV I  + F L AN  ++    +   
Sbjct: 143 QLDKPFTVTTKDGIIAQFMTANINLSTNQLNTDQPVNIQSTGFHLMANALQVCEKEQVMY 202

Query: 197 FAGQVSVVVN 206
           F   V ++++
Sbjct: 203 FQRGVHIILD 212


>gi|304392223|ref|ZP_07374165.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303296452|gb|EFL90810.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 250

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 81/201 (40%), Gaps = 5/201 (2%)

Query: 8   NKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI--DLLDFEP 65
            +     ++ ++H   ++  ++  P     +V  F   +    +      +    +    
Sbjct: 35  RRTPEDFARAQRHSVAVRISRWALPGVATFMVLVFAGQTLWNWTPLGNIQVLSSAISNGK 94

Query: 66  MIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH 125
           ++M++  +  +  ++  Y + A RA     +  G + L   +  +P   + +  +   A 
Sbjct: 95  LVMEEPKMKGFDANKRPYDVKAARAVQDL-TKPGFVELTAIDAKLPMDANSFAQV--DAG 151

Query: 126 SARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANF 185
           S  ++    T+ +     +     + +  + A +D+K+ ++ S  PV +   +  + A  
Sbjct: 152 SGVYDQKAETMRLFDSVVITGARGMDIRLDDAEIDIKSGSMKSDKPVTVVRGETTIDAAS 211

Query: 186 ARIENSSRSAVFAGQVSVVVN 206
             ++++ +  +F  +V +++N
Sbjct: 212 VEVQDNGKRVLFKERVKMIIN 232


>gi|154244025|ref|YP_001414983.1| hypothetical protein Xaut_0067 [Xanthobacter autotrophicus Py2]
 gi|154158110|gb|ABS65326.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 306

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/213 (18%), Positives = 79/213 (37%), Gaps = 8/213 (3%)

Query: 8   NKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIR-----ISTFSKSSIDLLD 62
            +     S  R+H + ++++K   P + V  V      S +      I    +     L 
Sbjct: 52  QRASPDFSSARRHSKRVRWIKRLLPLSIVVAVVAIGAVSILSRLKLSIELPFEIGHLTLS 111

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
              + M+   LS ++ D   Y + A  A     +   +I L D E  +      +    +
Sbjct: 112 GSRLTMELPKLSGFTDDNRGYRVTARTATQDL-THPDLIDLTDIEARLEMTDKGWA--KV 168

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A    F+     + +     + +        + A +DVK  TI + +PV+ T+ D  L 
Sbjct: 169 AAKVGTFDTKKQFITLGDGVDLAMNGGYGGRLQDAEVDVKAGTIATENPVVFTYLDGRLV 228

Query: 183 ANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
           A+   + +    A+F G V +      L  +++
Sbjct: 229 ADRLHVGDRGTRALFEGNVQLDFRMSNLPGQKS 261


>gi|163794942|ref|ZP_02188911.1| hypothetical protein BAL199_08703 [alpha proteobacterium BAL199]
 gi|159179761|gb|EDP64288.1| hypothetical protein BAL199_08703 [alpha proteobacterium BAL199]
          Length = 224

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 67/192 (34%), Gaps = 7/192 (3%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWI----RISTFSKSSIDLLDFEPMIMKKFIL 73
            +  R +  +K   P   + +V   ++   +    +        I+  D + + +     
Sbjct: 29  ARASRLVAAMKMLLPAIALCLVALVVIWPQLLQEAQKYPMRGKPINASDADTLRVANPRF 88

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
               +    Y ++A  A+    S    + L+  +  + T + ++  + L A    ++  +
Sbjct: 89  IGVDEKDRPYEIIATSARQESESA-DAVHLERPQADMITDKGDW--VTLTAGQGVWHKRD 145

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             + ++    +  +   +L  +TA + +   T  S D          +     R+ +   
Sbjct: 146 EVVDLAGGVSVFHEAGHQLVSDTARISLGAGTAESDDATSGQSPGGNVQGEGFRLFDRGA 205

Query: 194 SAVFAGQVSVVV 205
             VF G+   V+
Sbjct: 206 RIVFTGRAKAVL 217


>gi|149201445|ref|ZP_01878420.1| hypothetical protein RTM1035_17507 [Roseovarius sp. TM1035]
 gi|149145778|gb|EDM33804.1| hypothetical protein RTM1035_17507 [Roseovarius sp. TM1035]
          Length = 204

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 66/203 (32%), Gaps = 11/203 (5%)

Query: 15  SKYRQ-HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKK 70
           ++ +  + R + ++K   P + + ++    L S      +S  S         + +    
Sbjct: 2   ARAQNTYSRIVAWIKIILPLSALGLLSTLFLFSRTVDPTLSVPSSQIDLEQRAQDLGATN 61

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
              +  +++  +    AE A+ + ++ + +I        +         + + A  A   
Sbjct: 62  PRFAGVTQEGDEIRFAAEFARPNRDTPENLI-ADGVTAQLRLNAGTV--IDITAGQADMQ 118

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
               T  +     +       +D E     +  +   +   V  T     L+A    + N
Sbjct: 119 QGQMTASLMGQVHITTSTGYVIDTERLNSRLDEVYAETPGQVTATGPIGTLTAGRMLLHN 178

Query: 191 SSR----SAVFAGQVSVVVNPGV 209
           ++       +F   V ++  PG 
Sbjct: 179 NAESGEPELLFTEGVKLIYQPGE 201


>gi|220925752|ref|YP_002501054.1| hypothetical protein Mnod_5923 [Methylobacterium nodulans ORS 2060]
 gi|219950359|gb|ACL60751.1| protein of unknown function DUF1239 [Methylobacterium nodulans ORS
           2060]
          Length = 240

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 78/194 (40%), Gaps = 7/194 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD----FEPMIMKKFILSD 75
           H   ++FL+   P  +   V      +W+        ++ L +       + M+   L+ 
Sbjct: 28  HSAQVRFLRLAIPLGSAAAVLAVAAVTWLDPFGALGVTVSLGEVSVSGSKVTMESPRLTG 87

Query: 76  YS-KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
           Y  KD   Y + A+ A         +I LQ+ +  +          +L A S  F+    
Sbjct: 88  YRGKDGRPYEVTAKAALQDVR-RPTVIELQNMKGHM-QADETGALSHLEALSGVFDTQKE 145

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           +L +S+  ++           +A ++ K  T+NS +PV +T  +  + ++   + ++ R+
Sbjct: 146 SLELSRSIRLWTDKGQEARLSSAQVNFKAGTMNSREPVTVTLPNGTIRSDGLEVVDNGRT 205

Query: 195 AVFAGQVSVVVNPG 208
             F G V  V + G
Sbjct: 206 ISFIGNVKTVFDGG 219


>gi|114799884|ref|YP_758936.1| hypothetical protein HNE_0203 [Hyphomonas neptunium ATCC 15444]
 gi|114740058|gb|ABI78183.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 225

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 66/204 (32%), Gaps = 10/204 (4%)

Query: 6   RRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP 65
           RR   L Q    R+    +++L++    A    +G FL                + D + 
Sbjct: 16  RRQLTLAQ---ARRRSERVKYLRYALVGAAAVSIGLFLGYIVRSAIGQESRPPPVDDSQA 72

Query: 66  MIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH 125
           + M     +        +++ A+ AK    +  G + L    L       +     + A 
Sbjct: 73  VTMVNPRFTGRDAAGQIFTITADTAKRR-RTRDGAVDLTGPILR------DSKGTEVQAP 125

Query: 126 SARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANF 185
           S  ++     L + +  ++        + + A + V    +    P+        + A+ 
Sbjct: 126 SGFYDRDLGILELYEDVRISDAAGYMFNSQGARVHVAEDRVEGLSPLEGQGPLGDIKADS 185

Query: 186 ARIENSSRSAVFAGQVSVVVNPGV 209
             I +     VF G V  V+ P  
Sbjct: 186 YEILDGGDRIVFKGNVQTVIYPSN 209


>gi|163851921|ref|YP_001639964.1| hypothetical protein Mext_2498 [Methylobacterium extorquens PA1]
 gi|218530672|ref|YP_002421488.1| hypothetical protein Mchl_2721 [Methylobacterium chloromethanicum
           CM4]
 gi|240139044|ref|YP_002963519.1| hypothetical protein MexAM1_META1p2463 [Methylobacterium extorquens
           AM1]
 gi|254561639|ref|YP_003068734.1| hypothetical protein METDI3226 [Methylobacterium extorquens DM4]
 gi|163663526|gb|ABY30893.1| protein of unknown function DUF1239 [Methylobacterium extorquens
           PA1]
 gi|218522975|gb|ACK83560.1| protein of unknown function DUF1239 [Methylobacterium
           chloromethanicum CM4]
 gi|240009016|gb|ACS40242.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
 gi|254268917|emb|CAX24878.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 252

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 75/209 (35%), Gaps = 6/209 (2%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFAT----VTIVGWFLLSSWIRISTFSKSSIDLLDFE 64
           +      + R+H   ++ L+   P       + +    L S               +   
Sbjct: 23  RRKRAHGRARRHSAQVRTLRRVIPVTAGIAVLGLAAIVLWSPLTGSIPNVSFGPISVSGT 82

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M+   LS + K    Y +VA+ A+        II LQ  +  V T   + G  YL A
Sbjct: 83  KVTMENPRLSGFRKGERGYEVVADAAQQDVR-KPSIIELQAMKGHVAT-DDKGGRAYLQA 140

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
               F+    +L +    ++       +    A +D K  ++ SS  V +T     + A+
Sbjct: 141 QGGVFDSTRESLNLENDIRLWTDKGEEVRLSVATVDFKTGSLRSSKAVTVTVPSGSIVAD 200

Query: 185 FARIENSSRSAVFAGQVSVVVNPGVLQKK 213
              +  + R   F G+V  V +    +K+
Sbjct: 201 TLDVVENGRVVSFVGRVHAVFHGDEAEKE 229


>gi|254500212|ref|ZP_05112363.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436283|gb|EEE42962.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 203

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 81/202 (40%), Gaps = 5/202 (2%)

Query: 14  RSKYRQHVRFIQFLKFFFPFATVTIVGWFL-LSSWIRISTFSKSSIDLLDFEPMIMKKFI 72
           +   R+H   ++ L+F FP   + I+   +       +     ++  +L  + ++M    
Sbjct: 6   QRSARRHSTLVRVLRFLFPAIGLLILAGMIGAVVLFNVLGSFGAANLVLTSDGIVMDHPK 65

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
           LS    +   Y + A +A     +   II L++    +     E   +   +    +N A
Sbjct: 66  LSGNDGE-RSYQVTARKAIQRL-TDPRIIDLEEIRADIVLAPDEGARII--SLKGIYNNA 121

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
             TL + +  ++   +   +D ET  +D+K   I+S DP+ I   +  L+A     +   
Sbjct: 122 AETLRLYEGVQLNWSEGYTVDVETVDVDLKTGAISSDDPITIGSGEAQLTAGKIDYDKDK 181

Query: 193 RSAVFAGQVSVVVNPGVLQKKE 214
           +   F   V +++ P    + +
Sbjct: 182 QIVWFKEGVKLILYPATEDENQ 203


>gi|319407889|emb|CBI81541.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 81/195 (41%), Gaps = 6/195 (3%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI---DLLDFEPMIMKKF 71
            K   H   I+ LK F P   + I   F    +  +S  S S +   +  +   +IM   
Sbjct: 21  KKAYHHSCRIRLLKIFLPLVALIIALVFSWFIFFSLSASSGSVVLKNEDDEIVKLIMVNP 80

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
            L  Y+     Y L A+ A    +    ++ LQ     +P    + G  +L A S  ++ 
Sbjct: 81  RLESYTSSHKLYWLEAQEAFQD-SLHSEVVGLQGITAEIP--SGKLGTAFLQAQSGTYDH 137

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
            N+ L + +PF +K +DN+   F  A +D+    + +   V I  +   L AN  +I   
Sbjct: 138 INNHLKLDKPFTVKTQDNMVAQFIAADIDLSESQLKTDQCVHIKRAGLSLKANTLQIHEK 197

Query: 192 SRSAVFAGQVSVVVN 206
            +   F G V +V++
Sbjct: 198 GQKIYFQGDVHLVID 212


>gi|182677566|ref|YP_001831712.1| hypothetical protein Bind_0571 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633449|gb|ACB94223.1| protein of unknown function DUF1239 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 241

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 23/196 (11%), Positives = 72/196 (36%), Gaps = 7/196 (3%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSID----LLDFEPMIMKK 70
           +   +H   +++L+  F    V I     + +          +I      ++   + ++ 
Sbjct: 35  AAANRHTSRVRWLRRAFIIVPVVIGLGIFVMTVFDPFRHFPGNISIGRVDIEGSKITVET 94

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
             ++    +   +++ A +A  +      I+ L D    +  +      +   A +  ++
Sbjct: 95  PNITGLQTNGQPFAIRAAKAVQNI-VQPNIVTLTDVNSDLGMEDKSNAHI--TAETGVYD 151

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
                + ++   ++K      +  + + + +K   ++  D V +   D ++ A+   +E+
Sbjct: 152 SKIDRVQLTGKVRIKNIGRYDMRMQRSEIYMKPGILDGWDKVEVLIEDGIIKADSMHLED 211

Query: 191 SSRSAVFAGQVSVVVN 206
           +     FAG V    +
Sbjct: 212 NGHHITFAGNVFSHFD 227


>gi|312114053|ref|YP_004011649.1| hypothetical protein Rvan_1288 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219182|gb|ADP70550.1| protein of unknown function DUF1239 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 271

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 77/205 (37%), Gaps = 11/205 (5%)

Query: 17  YRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIST-----FSKSSIDLLDFEPMIMKKF 71
            R+H R ++ L+   P   + I+  + L S++R+S       +      L+   + M + 
Sbjct: 32  ARRHSRLVRVLRIVLPLMAMGILSLYALPSFLRVSVDKGRGTATVRAIELEKGALKMIEP 91

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
            +   ++    Y   A+ A    +     ++L +    +  Q  +     L A     N 
Sbjct: 92  HVRGVNEKNESYDFTADSATQ-ASVKADEMYLLNVRGRMTGQDGKLT--TLAAPDGTHNS 148

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
               +  +    ++ +  L  +F+TA   +K     S+ PV++   +  + A+   +   
Sbjct: 149 KAEQISFNNGVTIRREPGLAAEFQTATAYMKEQKAVSNTPVVVRLHESTIHADGMTLYWG 208

Query: 192 SRSAVFAGQVSVVV---NPGVLQKK 213
              A+F G V   +    P   + +
Sbjct: 209 ESRAIFEGNVRTHIERQEPAAGEAQ 233


>gi|300021931|ref|YP_003754542.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523752|gb|ADJ22221.1| OstA family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 640

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/208 (17%), Positives = 68/208 (32%), Gaps = 6/208 (2%)

Query: 11  LLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRI---STFSKSSIDLLDFEPMI 67
              R    +H R ++ LK   P      +  FL++    +      +   I  +  E + 
Sbjct: 28  TTSRRVASKHTRTVRRLKVVLPLIAAGTIAVFLMTVLNGVGIGPKIADIQIPQIVAENLK 87

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           MK      +  D  +Y + AE A+    +   ++ L      +     +    +L A   
Sbjct: 88  MKNPHYEGFQSDGGRYWVKAETAQQDLKTLT-VVHLDGITGDLL--DVKKQKTHLVAKRG 144

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
            F+   +TL +     +     L      A++  K   I S  P  IT     + +N   
Sbjct: 145 TFDNKANTLELYDSINVTGDGGLNATLTHALVRTKEGVITSDQPSTITMGAGQILSNQLT 204

Query: 188 IENSSRSAVFAGQVSVVVNPGVLQKKEN 215
           I   ++   F   V   + P       +
Sbjct: 205 IRQKTKEYTFVDNVRTHIKPKEQAPSAD 232



 Score = 44.7 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 14/112 (12%), Positives = 35/112 (31%), Gaps = 2/112 (1%)

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A+ +K +   G   +  +          ++       + +A F+ A     +     +  
Sbjct: 298 ADESKQTPAEGGTKV--KQVVAKESVTLTQASGETATSRTATFDTAAQLAVLEGDVVLTQ 355

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
             + +   + A  D  N  +  + PV++T    VL         ++      
Sbjct: 356 GADKKAVGDRAEYDEANQKLTLTGPVVVTQGQNVLKGRRLVYHRATSKMQLT 407


>gi|209547657|ref|YP_002279574.1| hypothetical protein Rleg2_0045 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533413|gb|ACI53348.1| protein of unknown function DUF1239 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 221

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/196 (25%), Positives = 91/196 (46%), Gaps = 5/196 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL--LDFEPMIMKKFILSDYS 77
           H   ++ LK   P A + I    L  + + I        +   ++   ++M+K  ++  +
Sbjct: 27  HSARVRRLKILLPVAALIIAAALLAVALVSIYLPENVKFEGAKIENGKVVMEKPAIAGRN 86

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            D + YS++AERA     +   +I L+  +  VP          + A +A +N A   L+
Sbjct: 87  SDGINYSMLAERALQDIRN-PDLITLETIKAAVPMNDGLIA--RVVASTADYNRATDNLH 143

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++ PF + +   L  +F++A LD+K   + S DPV IT  +  + A   +I +  R   F
Sbjct: 144 MTAPFTLVLSSGLNANFQSARLDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITF 203

Query: 198 AGQVSVVVNPGVLQKK 213
            G V + V+P  + K+
Sbjct: 204 EGNVRMNVDPSTIHKQ 219


>gi|197103638|ref|YP_002129015.1| hypothetical protein PHZ_c0172 [Phenylobacterium zucineum HLK1]
 gi|196477058|gb|ACG76586.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 214

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 62/213 (29%), Gaps = 5/213 (2%)

Query: 2   DHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL 61
             +D          ++R+  + I+ L+   P     I      S      +         
Sbjct: 6   ASIDATPPRRADFERWRRRSKLIRLLRVLLPALIALIFLGLAGSVVWSTFSSQPQRAASG 65

Query: 62  DFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY 121
           D  P+ +              + L A+ A     +    + L+     +        +M 
Sbjct: 66  DE-PIRLINPRFVGRDDKGRAFVLTADSAIRD-RNDYQRVLLKAP--ALVLDEGGPDEMR 121

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L      F+ A   L +S   K+        D   ++ D K   +  S P+        +
Sbjct: 122 LAGAEGVFHEATGKLSLSGGVKLA-DAKSAFDTAASMFDTKTGELVGSGPIQGAGDLGEI 180

Query: 182 SANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           +A    +       VF G V   + P   Q K+
Sbjct: 181 TAESYGVYGKGDRMVFKGGVRARLQPNQEQPKQ 213


>gi|163745218|ref|ZP_02152578.1| hypothetical protein OIHEL45_06505 [Oceanibulbus indolifex HEL-45]
 gi|161382036|gb|EDQ06445.1| hypothetical protein OIHEL45_06505 [Oceanibulbus indolifex HEL-45]
          Length = 202

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 68/204 (33%), Gaps = 10/204 (4%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFI 72
           K  +H R + +LK  FP   + ++    L S     +                  +    
Sbjct: 2   KGDRHSRVVSWLKVLFPLIALALLSTLFLLSRAIEPQAVIPFADKEVQDRLRDQQITGPF 61

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            S  + D    S  AE+  T+     G    +D E T+  Q      + L + S RF+  
Sbjct: 62  YSGTTADGDLISFSAEK-LTTPGGETGTNEAEDIEATLDLQDG--AKIILQSSSGRFDTG 118

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS- 191
                ++   ++      ++  E    ++  + + S  PV  T     ++A    I N  
Sbjct: 119 AEEAELAGDVRVSTSTGYQILSERMTTNLTTLDLLSPGPVEATSPAGKITAGSMAITNRQ 178

Query: 192 ---SRSAVFAGQVSVVVNPGVLQK 212
                  +F   V ++  P   ++
Sbjct: 179 NSAGSQLLFTKGVKLIYTPQATKE 202


>gi|148260668|ref|YP_001234795.1| hypothetical protein Acry_1671 [Acidiphilium cryptum JF-5]
 gi|326403862|ref|YP_004283944.1| hypothetical protein ACMV_17150 [Acidiphilium multivorum AIU301]
 gi|146402349|gb|ABQ30876.1| protein of unknown function DUF1239 [Acidiphilium cryptum JF-5]
 gi|325050724|dbj|BAJ81062.1| hypothetical protein ACMV_17150 [Acidiphilium multivorum AIU301]
          Length = 246

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 67/215 (31%), Gaps = 16/215 (7%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLS----SWIRISTFSKS 56
           + H   R +  L R +     R +   K   P     ++   ++     S       +  
Sbjct: 30  LAHARDRQRAALGRQR-----RIVGIAKIVLPAIAAVLLFAIVIFPDLRSGASFGRVTYR 84

Query: 57  SIDLLDFEPM-IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRS 115
            +       +  M             K+++ A  A     +G   + L   +  + T+  
Sbjct: 85  ELPQASGAALSRMSTAEYRGVDARGEKFTITARHAVQ---TGGDRLSLTGPKGDITTKGG 141

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT 175
            +    L A +  ++     L ++    +   D   +    A +D++  T +  DPV   
Sbjct: 142 AW--FMLDARNGVYHQKTQRLDLAGKVTLYRADGTTMRTRQATIDIQAGTADGHDPVSAF 199

Query: 176 HSDFVLS-ANFARIENSSRSAVFAGQVSVVVNPGV 209
                L+ A      N  +   F G   +V++   
Sbjct: 200 GPFGTLTSAQGFTARNRGQIITFTGPSHLVLDQAN 234


>gi|170751836|ref|YP_001758096.1| hypothetical protein Mrad2831_5468 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658358|gb|ACB27413.1| protein of unknown function DUF1239 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 239

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 67/197 (34%), Gaps = 5/197 (2%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSK---SSIDLLDFEPMIMKKFILSDY 76
           H   ++ ++   P      V   L   +   +            L    + M+   LS +
Sbjct: 28  HSGRVRAMRRLIPVVAGGAVALLLAYLFNPFAAPLPGVSVGPVTLAGSKVRMENPRLSGF 87

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
            +    Y + A+ A          I LQ     + T   + G   L A S  F+ A   L
Sbjct: 88  RQGTRGYEVTADAALQDVR-KPSQIELQQMRGHIAT-DDQGGIARLSATSGLFDTAREAL 145

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +    ++           +A +  K  +I+S +PV ++     + A+   +  + +   
Sbjct: 146 DLKDDIRIWTDKGEEARLRSAAVAFKTGSISSQEPVTVSSPRANVKADTLDVVENGKRIS 205

Query: 197 FAGQVSVVVNPGVLQKK 213
           F G V VV+      +K
Sbjct: 206 FIGNVHVVIANEEQAEK 222


>gi|319406417|emb|CBI80057.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 216

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/190 (23%), Positives = 81/190 (42%), Gaps = 6/190 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI---DLLDFEPMIMKKFILSDY 76
           H   ++ LK   PF  + I   F   ++  IS      +   +  +   + M    L  Y
Sbjct: 26  HSHKVRLLKICLPFLALIIALIFCWFTFFSISFSFDKVLLSHEEEEIAQLTMLNPRLESY 85

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +     Y + AE+A     S  GII L++    VPT+    G +++ A    ++     L
Sbjct: 86  TNFHKPYWIKAEKAFQDRKS-SGIIGLKNITAEVPTK--GQGQIFIDAQGGVYDNIKSHL 142

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +++PF +  KD +   F  A +D+     N+  PV I  ++F L AN  ++    +   
Sbjct: 143 QLNEPFTVTTKDGIIAKFIAANIDLSKSQFNTDQPVNIQSANFHLIANALQVCEKEQVMY 202

Query: 197 FAGQVSVVVN 206
           F   V +V++
Sbjct: 203 FQRGVRIVLD 212


>gi|310817097|ref|YP_003965061.1| hypothetical protein EIO_2686 [Ketogulonicigenium vulgare Y25]
 gi|308755832|gb|ADO43761.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 219

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 64/205 (31%), Gaps = 11/205 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPM--IMKKFILSDYS 77
           + R I  LK   P   + ++    L +        +     ++       + +   S  +
Sbjct: 8   YSRLIAMLKVVLPMGALAMMATLFLFARSNTP-PEEIPYSDINQIAQDPRISQPRFSGVA 66

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRS---EYGDMYLFAHSARFNLANH 134
            D    S++A+         +G  F  +  +  P   +       + L A    +     
Sbjct: 67  GDGSTLSVIADE-LRPLPGSEGEAFGSNLRMLRPEGDAILPGGRTVSLVAGEGTYASLPQ 125

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE----N 190
             Y      ++  D L ++     +D+   T+ +   +        L+A           
Sbjct: 126 IAYFGGLVHIQSGDGLHMETSGMTIDMPAATLETDGAMEARSPFGQLTAGHMIATSGNAQ 185

Query: 191 SSRSAVFAGQVSVVVNPGVLQKKEN 215
           +    VF+G V ++  P   +  E+
Sbjct: 186 NGVQMVFSGGVRLLYLPQGTRPGED 210


>gi|332187935|ref|ZP_08389668.1| hypothetical protein SUS17_3006 [Sphingomonas sp. S17]
 gi|332012096|gb|EGI54168.1| hypothetical protein SUS17_3006 [Sphingomonas sp. S17]
          Length = 212

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 70/214 (32%), Gaps = 8/214 (3%)

Query: 2   DHLDR-RNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFL---LSSWIRISTFSKSS 57
           D  DR R +  +  +   +H RF+   ++  P A   +  + +   + S   +S      
Sbjct: 3   DIADRVRTQRQVWAAPGSRHDRFVTLARWMLPSAIGVLTAFLVMAPIYSSSEVSFVLDKK 62

Query: 58  IDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEY 117
              +  E M ++             +SL A  A    ++   ++ L      +       
Sbjct: 63  KVEVAQERMKIQAAQYRGVDDKGQPFSLDAGSAIQRSSAEP-VVQLNKLAAEIRLSDG-- 119

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
               + A+S R+++    + +  P   +      L    A +D++   + S   V     
Sbjct: 120 -PATVSANSGRYDMRTEQVKLDGPLDFQSAGGYNLKTHDATIDLQQRMLVSGGAVTGQVP 178

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
                A+  R     R+    G   + + P   +
Sbjct: 179 QGTFRADKLRANLEDRTVTLDGNARLRIVPQSTK 212


>gi|167645655|ref|YP_001683318.1| hypothetical protein Caul_1691 [Caulobacter sp. K31]
 gi|167348085|gb|ABZ70820.1| protein of unknown function DUF1239 [Caulobacter sp. K31]
          Length = 206

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 68/199 (34%), Gaps = 6/199 (3%)

Query: 11  LLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKK 70
            +++    +H + ++ L+   P   + +    +    IR      +    +   P+ M+ 
Sbjct: 12  PVRKKNRNRHRKPVRALRVLLPTLAIGVAAAIIGQGVIRAMAAKDAP--PVANAPLRMEN 69

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
              +   KD   + + A  A     +    +FL++    +          ++ +    + 
Sbjct: 70  PRFTGTLKDGRAFLITASSATRDLANA-DQVFLKNP--QLTRGYGSDKPTHVVSKDGVYQ 126

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS-DFVLSANFARIE 189
               +L ++   K+      +   + A++D +   +     V      +  + A+   + 
Sbjct: 127 EEKGSLLLTGDVKIDNGQGYQFASQKALIDTRTGDLVGGAAVQGAGPNNGAIRADSYSVS 186

Query: 190 NSSRSAVFAGQVSVVVNPG 208
           +     VF G+V   + P 
Sbjct: 187 DKGDRVVFKGRVRTRLTPQ 205


>gi|315121909|ref|YP_004062398.1| hypothetical protein CKC_00795 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495311|gb|ADR51910.1| hypothetical protein CKC_00795 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 215

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 104/214 (48%), Positives = 139/214 (64%), Gaps = 4/214 (1%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60
           M+ LDRR K+LLQR KY QH + I+FLKFF P  +V ++ W   SSW+RI  FSK + D 
Sbjct: 4   MNELDRREKLLLQRKKYNQHFKLIRFLKFFLPTLSVVLLSWLFFSSWVRIKHFSKPAADF 63

Query: 61  LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
           L+FE M++ KFILSDYS+D+ +YSL A+RA       K  I LQD EL +P     Y +M
Sbjct: 64  LNFEFMVINKFILSDYSRDKKRYSLSAKRA-QDNEGSKNTILLQDLELVMPIP--GYDEM 120

Query: 121 YLFAHSARFNLANHTLYISQPFK-MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDF 179
            L A+ A F+L  + L I  PFK +   ++ +L F+TAV+D+K I +NSSD V  T S F
Sbjct: 121 RLLANYASFDLYRNMLNIQHPFKIIFNNNDTQLYFKTAVMDIKKIVLNSSDAVKFTSSTF 180

Query: 180 VLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
            LSA    IEN  + A+F+G VSVV++P +L KK
Sbjct: 181 TLSAQSCSIENDQKRAIFSGDVSVVIHPKILHKK 214


>gi|294675672|ref|YP_003576287.1| hypothetical protein RCAP_rcc00115 [Rhodobacter capsulatus SB 1003]
 gi|294474492|gb|ADE83880.1| protein of unknown function DUF1239 [Rhodobacter capsulatus SB
           1003]
          Length = 199

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 59/201 (29%), Gaps = 11/201 (5%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSS--WIRISTFSKSSIDLLD-FEPMIMKKF 71
           +   +H   + + K   P + + ++    L S      +    S +D+        +   
Sbjct: 2   TAESRHTALVHWAKIALPLSALMLLSTLFLFSGKVDPTTAAIYSKVDVTTLAREQRLTAP 61

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
             S  ++D    ++ A  A                   +        D  L A S R + 
Sbjct: 62  EFSGLTEDGAALTVRAATAAPDPAGKG--ASASQIIAKLEEGPGVVTD--LRAKSGRIDP 117

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
           A   + +     ++     R+  E   +      I +   V        L A   +I+  
Sbjct: 118 AAGQIRLRDGVAVQTSSGYRISTEQLYMATDRTAITAPGAVSAEAPFGNLQAGRMQIDRK 177

Query: 192 ----SRSAVFAGQVSVVVNPG 208
                   VF G V ++ +P 
Sbjct: 178 DAETGSDLVFQGGVKLIYHPQ 198


>gi|146278806|ref|YP_001168965.1| hypothetical protein Rsph17025_2773 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557047|gb|ABP71660.1| hypothetical protein Rsph17025_2773 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 204

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 58/198 (29%), Gaps = 13/198 (6%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMI----MKKFILSD 75
           H R + +LK   P A + ++    L +   I+         +D E ++    +     + 
Sbjct: 10  HSRLVAWLKIVLPLAALAVLSTLFLVAR-TINPDDAIPYAEVDVEGLVREPRITAPTWAG 68

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            + D    S+ A  A     +             + T         L A +   +     
Sbjct: 69  ITSDGAALSVEAAEA-RPGQTAGEEGRAASLRARLETPDGAVA--SLVAATGSLDGEARL 125

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR-- 193
           L +    +++      L  E     +    + S   +  T     + A   R+       
Sbjct: 126 LRLGGGVELETSTGYHLTTEAMTAGLDETDVRSVGALEATGPVGRIDAGSMRLSEDPEAP 185

Query: 194 ---SAVFAGQVSVVVNPG 208
                 F  +V +V +P 
Sbjct: 186 GSYVLTFGNRVKLVYDPT 203


>gi|296115073|ref|ZP_06833715.1| hypothetical protein GXY_04814 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978410|gb|EFG85146.1| hypothetical protein GXY_04814 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 300

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/204 (13%), Positives = 67/204 (32%), Gaps = 9/204 (4%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTF----SKSSIDLLD 62
           R ++L   +   +    ++  K+  P   + ++G       +  +      + + +  + 
Sbjct: 62  RQRLLPNANDLARRRAIMRSAKWALPLTALVLLGSIAAWPAVERAVIMHRGTMAQMSHVR 121

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
            +   M              + + A  A+         I L   +       + +  +Y+
Sbjct: 122 VKSGSMLNATYRGVDDHGHPFMVTASEARQIS---PERIDLTTPQADTLLGPNNW--VYV 176

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A +  +   +  L ++Q   +   D   +   TA +D+K+  I S   +       VL 
Sbjct: 177 TARNGVYIQHSQLLDLTQDVMLYRSDGTTMYSPTADIDMKHGVIVSDSWIHSEGPFGVLD 236

Query: 183 ANFARIENSSRSAVFAGQVSVVVN 206
              A +        F G   +++N
Sbjct: 237 TQGAMLLIRDGIMQFRGPGRLLLN 260


>gi|94495608|ref|ZP_01302188.1| hypothetical protein SKA58_06150 [Sphingomonas sp. SKA58]
 gi|94424996|gb|EAT10017.1| hypothetical protein SKA58_06150 [Sphingomonas sp. SKA58]
          Length = 215

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 72/212 (33%), Gaps = 11/212 (5%)

Query: 6   RRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDLLD 62
           RR+      S    H R ++ LK + P +   +      + +     +S     +   + 
Sbjct: 12  RRHWARPGGS----HDRLVKLLKNWLPVSVGILAALLATAPFTSGDKVSFVLDKNKVEVA 67

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
            E M + + +          +SL A  A    +    I+ L D    +           L
Sbjct: 68  KERMRVSEALYRGEDSKGQPFSLRAGSAVQKSSREP-IVDLNDMSARILLSDG---PAVL 123

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A   R+++ +  + I  P + +     RL      +D+    + S+  V         S
Sbjct: 124 TAQKGRYDMESERVAIEGPVQFQAAGGYRLTTRDVGVDLTTRRMRSAGRVDGRIPIGTFS 183

Query: 183 ANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           A+    +  +R+    G+  + +    L+ ++
Sbjct: 184 ADHLEADMGARTVTLDGRARLRIEQNGLKGQK 215


>gi|255262883|ref|ZP_05342225.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255105218|gb|EET47892.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 199

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 62/193 (32%), Gaps = 10/193 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS---TFSKSSIDLLDFEPMIMKKFILSDY 76
           + +F+ ++K   P A + ++    L +    S               E   +     S  
Sbjct: 6   YSQFVGWMKIILPLAALGLLSTVFLFARAPDSGSDIPYADVDVETLAEEQRINAPNYSGV 65

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           + D     + A  A    N+ +  I        + T   E   + + A     +    T 
Sbjct: 66  ADDGATIKISATSANADPNNDQ-TIEATKVAAQIITVEGE--TIDILASQGTVDSQAQTA 122

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE----NSS 192
            +S   ++       ++      D+++    ++ PV        LSA    IE    +++
Sbjct: 123 RLSGLARIITSTGYEMETNGVDADLESGLFETTGPVEARAPFGTLSAGRLVIEPATADTN 182

Query: 193 RSAVFAGQVSVVV 205
              VF   V ++ 
Sbjct: 183 TQVVFKDGVKLIY 195


>gi|114706453|ref|ZP_01439355.1| hypothetical protein FP2506_01675 [Fulvimarina pelagi HTCC2506]
 gi|114538314|gb|EAU41436.1| hypothetical protein FP2506_01675 [Fulvimarina pelagi HTCC2506]
          Length = 224

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 82/197 (41%), Gaps = 6/197 (3%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI--DLLDFEPMIMKKFIL 73
           +  +  + ++ LK   P     IV   +  + +  +      I    ++   ++M    L
Sbjct: 7   RAARSQKRVRVLKIVLPLIGGIIVLGGIGVTMLARAIPDDVRITGASIEDGRVVMDDPRL 66

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           S    +   + LVA++A  +     G I L+  +  V          ++ A S  ++   
Sbjct: 67  SGVDSNDRPFELVAQKAMQAITG--GAIDLEGIDAKVAVSDETKA--FIRASSGHYDPNA 122

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             L ++    ++  D L+++ ++A +D+   T+ + +PV I  +D  + AN   +  +  
Sbjct: 123 QMLKLAGGMSVETDDGLQVEMKSAGIDLGQGTLTTEEPVHIRTADQEIRANGMSLSENGD 182

Query: 194 SAVFAGQVSVVVNPGVL 210
              F+G VS+ +NP   
Sbjct: 183 RIRFSGGVSMKLNPASA 199


>gi|126734479|ref|ZP_01750226.1| hypothetical protein RCCS2_09969 [Roseobacter sp. CCS2]
 gi|126717345|gb|EBA14209.1| hypothetical protein RCCS2_09969 [Roseobacter sp. CCS2]
          Length = 200

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 17/195 (8%), Positives = 59/195 (30%), Gaps = 8/195 (4%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKS-SIDLLDFEPMIMKKFILSDYSK 78
           + + + + K   P   + ++    L +         + +          +     S  + 
Sbjct: 8   YSQLVGWAKIILPLCALGLLSTLFLFARSTTEPSEIALAEVEAIAREQRVSAPEFSGLTD 67

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
           D     + A  A+  + +    + +    L +        ++ + A     + +      
Sbjct: 68  DGAVIVISANSARPHY-TQPDKVSIDGIRLRMDNTDG--SNIDVTATQGEIDGSTQIASF 124

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI----ENSSRS 194
               ++       ++    + +++   + S+  + I      L+A         E+ ++ 
Sbjct: 125 LGLARLVTSSGYEMETNGLIAELETGLVTSNGLLEIRAPFGQLTAGKVTFQVASEDIAQQ 184

Query: 195 AVFAGQVSVVVNPGV 209
            +F   V ++  P  
Sbjct: 185 MLFTDGVRLLYVPQT 199


>gi|83313033|ref|YP_423297.1| hypothetical protein amb3934 [Magnetospirillum magneticum AMB-1]
 gi|82947874|dbj|BAE52738.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 238

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 23/199 (11%), Positives = 70/199 (35%), Gaps = 7/199 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRI----STFSKSSIDLLDFEPMIMKKFILSD 75
           H  F+  +K   P   V ++G  ++   +         S +++     + ++MK      
Sbjct: 33  HSHFVSVMKIALPALAVLLLGLVVIWPKLSQLESGFKLSFANLSPKSVDTLVMKNARYFG 92

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
             +    +++ ++ A       + +I L + +    +      ++ + A +  ++ +   
Sbjct: 93  VDESNRPFAVTSDTATQ-MPGNQDLIHLVNPKADFTSTSG--ANIVVDAIAGVYHQSTKV 149

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
           L +S    +       +   TA +++ + T    +PV        + +    I       
Sbjct: 150 LDLSGGVNLYHDTGYEIHTPTATVELASNTARGFEPVEGHGPQGAIRSTGFEITGKHHDI 209

Query: 196 VFAGQVSVVVNPGVLQKKE 214
            F G+  + +     + ++
Sbjct: 210 TFTGKSQLNLRAVSHKAQD 228


>gi|188581678|ref|YP_001925123.1| hypothetical protein Mpop_2426 [Methylobacterium populi BJ001]
 gi|179345176|gb|ACB80588.1| protein of unknown function DUF1239 [Methylobacterium populi BJ001]
          Length = 253

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 41/194 (21%), Positives = 71/194 (36%), Gaps = 6/194 (3%)

Query: 21  VRFIQFLKFFFPFAT----VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY 76
              ++ L+   PFA     + + G  L S +             +    + M+   LS +
Sbjct: 35  SAQVRTLRRVIPFAAGFAVLGLAGIVLWSPFSGSIPNVSIGPISVSGTKVTMESPRLSGF 94

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
            K    Y +VAE A+        II LQ  +  V T   + G  YL A    F+    +L
Sbjct: 95  RKGERGYEVVAEAAQQDVR-KPSIIELQAMKGHVAT-DDKGGRAYLQARGGVFDSTRESL 152

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +    ++       +    A +D K  ++ SS  V +T     + A+   +  + R   
Sbjct: 153 NLENDIRLWTDKGEEVRLSVAAVDFKTGSLRSSKAVTVTVPSGSIVADSLDVVENGRVIS 212

Query: 197 FAGQVSVVVNPGVL 210
           F G+V  V +    
Sbjct: 213 FVGRVHAVFHGDEA 226


>gi|58040276|ref|YP_192240.1| hypothetical protein GOX1845 [Gluconobacter oxydans 621H]
 gi|58002690|gb|AAW61584.1| Hypothetical protein GOX1845 [Gluconobacter oxydans 621H]
          Length = 268

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 62/211 (29%), Gaps = 18/211 (8%)

Query: 1   MDHLDRRNKILLQRSK--------YRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIST 52
           +  LD   +   QR +         R+    + F K+  P   + ++        I    
Sbjct: 36  LARLDSLRRAAFQRIRQAPDAEQLARRRS-LLGFAKWALPGLALVLLSSIAAWPEISHLM 94

Query: 53  FSKS----SIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFEL 108
                    +  L  E   M++            Y + A         G   + L D   
Sbjct: 95  NQNRAALKEMARLRVESGNMEQATYRGLDAHNHPYMITARTTHQQ---GPDRVDLVDPVA 151

Query: 109 TVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINS 168
            +    + +  ++  +    +     TL +     +   D L ++  +A LD+K   I S
Sbjct: 152 DIQLSGNSWAHIH--SDRGVYMQHEQTLDLDDHVVLYRDDGLLMNGPSADLDLKADVIAS 209

Query: 169 SDPVIITHSDFVLSANFARIENSSRSAVFAG 199
            D V          A    ++  +    F G
Sbjct: 210 RDWVHAEGPFGRQDAQGYFLDQHAGIMQFTG 240


>gi|85709986|ref|ZP_01041051.1| hypothetical protein NAP1_13913 [Erythrobacter sp. NAP1]
 gi|85688696|gb|EAQ28700.1| hypothetical protein NAP1_13913 [Erythrobacter sp. NAP1]
          Length = 221

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 27/208 (12%), Positives = 71/208 (34%), Gaps = 7/208 (3%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDLLDF 63
           R++     +    H R + FL    P     +    +++       +S     +   +  
Sbjct: 16  RSRRQHFAAPGGNHDRLVAFLARALPMGVGVLAALMIITPLSPRGEVSFLLDRNAVSVID 75

Query: 64  EPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123
           E + +   +          +S+ A  A    ++ +G + + D    +  Q        L 
Sbjct: 76  ERLSVDNAMYRGRDNQGRPFSITAGEAVQRSSA-EGKVRMDDLMAQLLLQDG---PARLM 131

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
           A    +++    + +    +++  D   +       D++  T++    V         SA
Sbjct: 132 APGGVYDINEEVVSVDGELRVRTADGYSMTASGVAFDLETRTMSGEGGVEGAVPAGTFSA 191

Query: 184 NFARIENSSRSAVFAGQVSVVVNPGVLQ 211
           +  + +  +R+ +  G   + + PG L+
Sbjct: 192 DTMQGDLDARTIILDGNARLRMVPGELR 219


>gi|126732864|ref|ZP_01748655.1| hypothetical protein SSE37_18337 [Sagittula stellata E-37]
 gi|126706640|gb|EBA05714.1| hypothetical protein SSE37_18337 [Sagittula stellata E-37]
          Length = 204

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 62/202 (30%), Gaps = 12/202 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRI---STFSKSSIDLLDFEPMIMKKFILSDY 76
           + R I +LK   P A + ++    L +  R    +     ++   +     +     S  
Sbjct: 8   YSRLIAWLKILLPIAALAMLSTIFLLASDREVLENVPFAEALRQGEVASEGVSSPYYSGT 67

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           ++D    ++ A RA    +     I    +   +         + L +  A         
Sbjct: 68  TRDGDMLTMTARRAWPLEDGD---ILADQYSARMQMGDGSV--IQLDSKKATMREGERKA 122

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
           ++    +++      L     V  + ++   +  PV        L A    I  +     
Sbjct: 123 FLDDGVRIESSLGYILTTNAMVSALDSVNAETLGPVAGNGPAEELEAGRMVIAPADGEGA 182

Query: 194 -SAVFAGQVSVVVNPGVLQKKE 214
               F G V ++  P   + +E
Sbjct: 183 VQIHFTGGVKMIYRPADKEVEE 204


>gi|307293723|ref|ZP_07573567.1| protein of unknown function DUF1239 [Sphingobium chlorophenolicum
           L-1]
 gi|306879874|gb|EFN11091.1| protein of unknown function DUF1239 [Sphingobium chlorophenolicum
           L-1]
          Length = 215

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 32/219 (14%), Positives = 77/219 (35%), Gaps = 11/219 (5%)

Query: 1   MDHLDRRNKILLQRSKYR---QHVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFS 54
           M     + +  ++R   R   +H R +  LK + P +   +      + +    ++S   
Sbjct: 1   MSLQADQQR-DVRRHWARPGGRHDRLVGLLKNWLPVSVGVLAALLATAPFTGGDKVSFVL 59

Query: 55  KSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQR 114
             +   +  E M + + +          +SL A  A    +    I+ L D    +    
Sbjct: 60  DKNKVEVAKERMRVTEALYRGEDSKGQPFSLRAGSAVQKSSREP-IVDLNDMSARILLSD 118

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
            +     L A   R+++    + I  P + + +   R+      +D+K+  + S+  V  
Sbjct: 119 GQAL---LRAQKGRYDMDTERVAIDGPVQFQSEGGYRMTTRDVGVDLKSRRMQSAGRVDG 175

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
                  S +    +   R+    G+ ++ +    L+ +
Sbjct: 176 RIPIGTFSGDRLEADLVERTVTLNGRATLRIEQNGLKGR 214


>gi|209966459|ref|YP_002299374.1| hypothetical protein RC1_3200 [Rhodospirillum centenum SW]
 gi|209959925|gb|ACJ00562.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 208

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 25/163 (15%), Positives = 54/163 (33%), Gaps = 3/163 (1%)

Query: 47  WIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDF 106
           W   S    S     D   + M +       K    + + AE+       G G + L + 
Sbjct: 45  WPLFSGRQDSQRAGPDTGQLEMVEARYLGTDKGARPFEVRAEKVVQ-VGGGSGRVDLVNP 103

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITI 166
           +  +  +  ++  + + A    ++  +  L +     +          E A +D +    
Sbjct: 104 QAEITLKGGDW--LTMSARRGNYDQKSGQLVLEGDVTLFQDGGYEFTTEMAQVDTQKGIA 161

Query: 167 NSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
             + PV        + A   RI +   + VF G+  +++  G 
Sbjct: 162 WGNAPVRGQGPVGDIQAGGFRILDDGNTIVFTGRARLLLADGT 204


>gi|83941912|ref|ZP_00954374.1| hypothetical protein EE36_06748 [Sulfitobacter sp. EE-36]
 gi|83847732|gb|EAP85607.1| hypothetical protein EE36_06748 [Sulfitobacter sp. EE-36]
          Length = 202

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 33/204 (16%), Positives = 65/204 (31%), Gaps = 10/204 (4%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFI 72
           +  ++ R I +LK  FP A + ++    L S       +                +    
Sbjct: 2   QGDRYTRLISWLKVLFPLAALGLLSTLFLLSRAIDPGQAIPFAEKEVQDRLRDQQITGPF 61

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            +  + +  + S  A+   T  +   G+   ++   T+ T         L +  A F++A
Sbjct: 62  FTGATSEGDELSFYAD-VLTRPDGQTGMNHAENLRATINTPEG--STFRLQSDLADFDIA 118

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
                +     +      RL  E    ++  + I S   V  T     L A    I  + 
Sbjct: 119 EDVADLLGKVILTTSTGYRLQSEKITSELSGLNIQSPGAVHGTTPGGTLEAGAMSITQTD 178

Query: 193 RSA----VFAGQVSVVVNPGVLQK 212
                  VF  +V ++  P    +
Sbjct: 179 DQIAPQLVFTNRVKLIYKPKSKSE 202


>gi|294013113|ref|YP_003546573.1| hypothetical protein SJA_C1-31270 [Sphingobium japonicum UT26S]
 gi|292676443|dbj|BAI97961.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 215

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 74/211 (35%), Gaps = 11/211 (5%)

Query: 6   RRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFSKSSIDLLD 62
           RR+      S    H R +  LK + P +   +      + +    ++S     +   + 
Sbjct: 12  RRHWARPGGS----HDRLVGLLKNWLPVSVGVLAALLATAPFTGGDKVSFVLDKNKVEVA 67

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
            E M + + +          +SL A  A    +    I+ L D    +     +     L
Sbjct: 68  KERMRVTEALYRGEDSKGQPFSLRAGSAVQKSSREP-IVDLNDMSARILLSDGQAL---L 123

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A   R+++    + I  P + + +   RL      +D+K   + S+  V         S
Sbjct: 124 RAQKGRYDMDTERVAIDGPVQFQSEGGYRLTTRDVGVDLKTRRMQSAGRVDGRIPIGTFS 183

Query: 183 ANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
            +    + S+R+    G+ S+ +    L+ +
Sbjct: 184 GDHLEADLSARTVTLNGRASLRIEQNGLKGQ 214


>gi|296535083|ref|ZP_06897336.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296264591|gb|EFH10963.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 201

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 57/204 (27%), Gaps = 8/204 (3%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS----TFSKSSIDLLDFE 64
           +  L      +    +   K+  P   + ++    L      +      +   +     E
Sbjct: 1   RQTLDAGALARRRFAVAMAKWLLPVGALGLLAAIALWPEFDRAEERGRLAFRRVAQTSAE 60

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + +         +    Y++ A  A          I L      +      +  + L A
Sbjct: 61  ALRLSAARYQGVDEQNRPYTVTAATALQQTQDAP--IELDQPRADMVMGNGAW--VLLEA 116

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
               +      L ++    +   D   L  E A +D+         PV        L + 
Sbjct: 117 RQGEYRRDASKLDLNGDVTLWHDDGSMLRTEMARIDIAAGGATGDRPVAAQGPFGTLVSQ 176

Query: 185 FARIENSSRSAVFAGQVSVVVNPG 208
             R+EN  +  VF GQ   ++   
Sbjct: 177 GFRLENRGQVVVFTGQARALLEGS 200


>gi|296282122|ref|ZP_06860120.1| hypothetical protein CbatJ_00810 [Citromicrobium bathyomarinum
           JL354]
          Length = 222

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 73/198 (36%), Gaps = 7/198 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R I+ L    P AT  IV + +++ +     +S            E + +        
Sbjct: 29  HDRLIKILAVALPMATGVIVAFLVIAPFSPRDEVSFVLDRDKVQEIDERLRIDNATYRGS 88

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
                 +SL A  A    +S +GI+ L      +  Q        L A    + +++  L
Sbjct: 89  DNQGRPFSLTAREAVQR-SSKEGIVRLDTVIARILLQGG---PAQLRAEGGAYKISDEVL 144

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            ++ P  +   D   L      +D+++ T+   + V         SA+  R++  +R+  
Sbjct: 145 DVTGPIILNATDGYNLVARGVSVDLRDQTLVGDEGVSGAVPAGTFSADTLRVDLETRTIT 204

Query: 197 FAGQVSVVVNPGVLQKKE 214
             G   + + PG L+  +
Sbjct: 205 LDGNARLRMVPGRLETMQ 222


>gi|110677768|ref|YP_680775.1| hypothetical protein RD1_0369 [Roseobacter denitrificans OCh 114]
 gi|109453884|gb|ABG30089.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 202

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/203 (13%), Positives = 66/203 (32%), Gaps = 10/203 (4%)

Query: 17  YRQHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++ R + +LK   P   + ++    L S       +     S          +     
Sbjct: 3   ADRYSRMVAWLKVTLPLVALGMLSTLFLISRAVDPPSTIPFADSEVQERLTNQQVTGPYY 62

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           +  S +  + +++AE   T      G    ++ ++ +        ++  + + A  ++AN
Sbjct: 63  TSMSANGDQIAVIAET-MTGPTGVGGTNKGKNVDIEMKMASGT--NITAYGNDALLDIAN 119

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE---- 189
               ++   ++       L  +  ++ +  + + S   V  T     L A   R      
Sbjct: 120 DLSRLTGDVRITTSTGYVLLSDELLMRMSAMDVTSPGAVSATTPLGDLQAGAMRFFVPEG 179

Query: 190 NSSRSAVFAGQVSVVVNPGVLQK 212
                 VF   V +V  P   ++
Sbjct: 180 KEDGQWVFTNGVKLVHTPDKTKE 202


>gi|217976352|ref|YP_002360499.1| protein of unknown function DUF1239 [Methylocella silvestris BL2]
 gi|217501728|gb|ACK49137.1| protein of unknown function DUF1239 [Methylocella silvestris BL2]
          Length = 250

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 28/199 (14%), Positives = 73/199 (36%), Gaps = 8/199 (4%)

Query: 15  SKYRQHVRFIQFLKFFFPFA----TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKK 70
               +H   ++FL++            +    L   + R+          +D   + ++ 
Sbjct: 43  KAAGRHSARVRFLRWSIVIFCVVAGAAVAIVGLFDPFRRLPGNITIGQVHVDGTRITVET 102

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
             +S + +D   Y + A        +   ++ L   +  +  + +    + L A    ++
Sbjct: 103 PKISGFQRDGRPYEITARTGLQDT-TNPNLVELNGIDARIGMRDA--STLKLTAEHGSYD 159

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
             + +L +    +++ +    +  +TA +D K   + S +PV +      ++A+   I N
Sbjct: 160 NQHDSLLLDGSAQIRNEVGYAIFMKTAQMDFKTGGLISREPVKVVLKGGHVAADTMNIGN 219

Query: 191 SSRSAVFAGQVSVVVNPGV 209
                 F G+V   ++ G 
Sbjct: 220 DG-VISFEGEVRSTIDSGS 237


>gi|126724658|ref|ZP_01740501.1| hypothetical protein RB2150_12521 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705822|gb|EBA04912.1| hypothetical protein RB2150_12521 [Rhodobacterales bacterium
           HTCC2150]
          Length = 198

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 68/198 (34%), Gaps = 11/198 (5%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILS 74
           R + RFI ++K   P   + ++   +L S       +     S      +   +     S
Sbjct: 4   RGYSRFITWVKIILPVLALAMLSSLVLFSKRIDPEQAIPFAESDVENLAKNQSIGSPTFS 63

Query: 75  DYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
             +++    S+ A     +  +   + F       +     ++ +  L A +A  + +  
Sbjct: 64  TMTENGAAISISALSVLPNAAN-PDMAFATSITAQIEGGGVDWAE--LKAENAEIDTSAQ 120

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE----- 189
                   +++   N  L  +     +  + +++ + + IT  +F L A    I      
Sbjct: 121 YADFEGNVQIETATNYVLRTQNLHTKLDKVDLSAPNKISITGDNFSLVAGSMNITEIENS 180

Query: 190 NSSRSAVFAGQVSVVVNP 207
           + +   VF   V +V  P
Sbjct: 181 DENHLIVFKQGVKMVYQP 198


>gi|149185092|ref|ZP_01863409.1| hypothetical protein ED21_18602 [Erythrobacter sp. SD-21]
 gi|148831203|gb|EDL49637.1| hypothetical protein ED21_18602 [Erythrobacter sp. SD-21]
          Length = 222

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 32/195 (16%), Positives = 71/195 (36%), Gaps = 7/195 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFL---LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R ++FL    P     +    +   LS    IS     +   +  E + +   +    
Sbjct: 30  HDRLVRFLSRALPMGVGALAAMMIITPLSPRGEISFLLDRNEVAVITERLRVDNALYRGQ 89

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
             +   +SL A  A    ++ +GI+ + D    +           + A   ++++    +
Sbjct: 90  DDEGRPFSLTAGEAVQKSSA-EGIVRMDDLVARMLMADG---PARVEAQGGQYDIDEEIV 145

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            ++   +M+  D   +     VLD+++ T+  +  V          AN    + + R   
Sbjct: 146 AVNGTMRMEAADGYSMRASGVVLDLEDKTLVGAGGVEGAIPAGTFRANRLDADLNQRRIT 205

Query: 197 FAGQVSVVVNPGVLQ 211
            +G   + + PG L+
Sbjct: 206 LSGNARLRMVPGKLR 220


>gi|83855388|ref|ZP_00948918.1| hypothetical protein NAS141_11671 [Sulfitobacter sp. NAS-14.1]
 gi|83843231|gb|EAP82398.1| hypothetical protein NAS141_11671 [Sulfitobacter sp. NAS-14.1]
          Length = 202

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 65/204 (31%), Gaps = 10/204 (4%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFI 72
           +  ++ R I +LK  FP A + ++    L S       +                +    
Sbjct: 2   QGDRYTRLISWLKVLFPLAALGLLSTLFLLSRAIDPGQAIPFAEKEVQDRLRDQQITGPF 61

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            +  + +  + S  A+   T  +   G+   ++   T+ T         L +  A F++A
Sbjct: 62  FTGATSEGDELSFYAD-VLTRPDGQTGMNHAENLRATINTPEG--STFRLQSDLADFDIA 118

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
                +     +      RL  E    D+  + I S   V  T     L A    I  + 
Sbjct: 119 EDVADLLGKVILTTSTGYRLQSEKITSDLSGLNIQSPGAVHGTTPGGTLEAGAMSITQTD 178

Query: 193 R----SAVFAGQVSVVVNPGVLQK 212
                  VF  +V ++  P    +
Sbjct: 179 EQTAPQLVFTNRVKLIYKPKSKSE 202


>gi|85375260|ref|YP_459322.1| hypothetical protein ELI_12165 [Erythrobacter litoralis HTCC2594]
 gi|84788343|gb|ABC64525.1| hypothetical protein ELI_12165 [Erythrobacter litoralis HTCC2594]
          Length = 221

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 68/195 (34%), Gaps = 7/195 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFL---LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R ++FL    P A   +    +   LS    +S         +  E + +   +    
Sbjct: 29  HDRLVKFLGAALPMAVGIVAALMVITPLSPRGEVSFLLDRDTVAVIRERLRVDNALYRGA 88

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
             +   +SL A+ A    +  +GI+ L+D    +           L A    ++L N  L
Sbjct: 89  DNEGRPFSLTADEAVQQSSE-EGIVRLRDVVARILLPDG---PGQLVAEGGAYSLENEVL 144

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +    ++   D  R+      +D+    +  S  V  +      S +   ++ S R   
Sbjct: 145 DVDGALRVTAADGYRIVATGVAIDLAAKKLLGSGGVEGSFPAGTFSGDQLEVDLSERIIA 204

Query: 197 FAGQVSVVVNPGVLQ 211
             G   + + PG L+
Sbjct: 205 LEGNAKLRMVPGELR 219


>gi|119385334|ref|YP_916390.1| hypothetical protein Pden_2607 [Paracoccus denitrificans PD1222]
 gi|119375101|gb|ABL70694.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 193

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 63/196 (32%), Gaps = 14/196 (7%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
             R + +L+   P   + I+    L         S            E   +     +  
Sbjct: 4   RSRIVAWLRVLLPLTALAILSVLFLLGRKPDPEASIPYADVDPRELAERQAVTGPTYAGV 63

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           ++D  + S+ A  A+   + G+GI   Q   +T+  +     D+   A S    L    +
Sbjct: 64  TRDGAQLSISAAEARPGGDKGEGI--AQAVHMTLRARDGRAADVSAGAAS----LQGEQV 117

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
            + +  +M   D   L     +       + S D V +      ++A    +  S +   
Sbjct: 118 RLGEGVRMTTADGWVLTAPDLLASTTEGRLVSEDEVNVLAPFGTMTAGRMELRPSEQGSG 177

Query: 194 --SAVFAGQVSVVVNP 207
                 +G V ++  P
Sbjct: 178 DHVLDLSGGVRLIYRP 193


>gi|21328702|gb|AAM48708.1| hypothetical protein MBMO_EBAC000-60D04.76 [uncultured marine
           proteobacterium]
          Length = 202

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 67/196 (34%), Gaps = 8/196 (4%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           +   + +LK   P A + ++    L S    +  S                + +   +  
Sbjct: 9   YSALVAWLKTLLPIAALGLLSTIFLFSGKVDVTQSLPYAEHNVAEIIREQRITQPYFTGI 68

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           + +  + +  A  A   F +      L+  +L V  + +    + + A     + A  T 
Sbjct: 69  ASNGTEIAFSAAYASPQFENAD---ILEITDLFVVLRSTGDRTVQVTAGQGALDSATQTA 125

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA--RIENSSRS 194
            IS+   +    +  +  E   +++K    ++        +   ++A     ++    + 
Sbjct: 126 QISKNVHIAALPDFWVTTEALDMNLKQGLASAIGGFQGVTALGEITAGEMHLQMTADDQQ 185

Query: 195 AVFAGQVSVVVNPGVL 210
            VF   V +V +P ++
Sbjct: 186 IVFINDVRLVYSPKLI 201


>gi|87201262|ref|YP_498519.1| hypothetical protein Saro_3250 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136943|gb|ABD27685.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 214

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 62/195 (31%), Gaps = 7/195 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R + FL    P A   ++   +++       IS         +  + M +   +    
Sbjct: 22  HDRLVHFLARALPAAVGALLAIMIIAPLSPRGEISFLLDRRKVAVLEDRMQVSSAMYRGQ 81

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
                 +S+ A  A     +   +I L      +           L A    ++     +
Sbjct: 82  DDQGRNFSITAGSAVQRTKA-TQMIQLDQLTARIMLDDG---PALLTAAKGNYDFGREIV 137

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            I  P   +  D  R+      +D+    + S  PV         SA+    + S+RS  
Sbjct: 138 DIVGPINFQTSDGYRMTATNVDIDLGGKRLKSRGPVEGRIPAGTFSADRISADLSARSVT 197

Query: 197 FAGQVSVVVNPGVLQ 211
             G   + + PG +Q
Sbjct: 198 LEGNARLRMVPGRMQ 212


>gi|163733024|ref|ZP_02140468.1| hypothetical protein RLO149_10200 [Roseobacter litoralis Och 149]
 gi|161393559|gb|EDQ17884.1| hypothetical protein RLO149_10200 [Roseobacter litoralis Och 149]
          Length = 205

 Score =  117 bits (294), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 67/201 (33%), Gaps = 10/201 (4%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSD 75
           ++ R + +LK   P   + ++    L S       +     S          +     + 
Sbjct: 8   RYSRMVAWLKVTLPLVALGMLSTLFLISRAVDPPSTIPFADSEVQERLTNQQVTGPYYTS 67

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            S +  + +++AE   T      G    ++ ++ +        ++  + + A  ++AN  
Sbjct: 68  MSANGDQIAVIAET-MTGPTGVGGTNKGKNVDIEMKMASG--SNITAYGNDALIDIANDR 124

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE----NS 191
             ++   K+       L  +  +L +    + S   V  T     L A   R        
Sbjct: 125 STLNGDVKITTSTGYVLYSDELLLRMSVTDVTSPRAVRATTPLGDLEAGAMRFFVPEGQE 184

Query: 192 SRSAVFAGQVSVVVNPGVLQK 212
               VF   V ++ NP  +++
Sbjct: 185 DGQWVFTKGVKLLHNPDNVKE 205


>gi|254418437|ref|ZP_05032161.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196184614|gb|EDX79590.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 222

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 67/205 (32%), Gaps = 10/205 (4%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM 68
           +++L  +++R   R ++  +   P   + + G  L  +  R    S         + + +
Sbjct: 19  RVVLAGARWRARSRRVKLYRRVLPIIILVLAGGVLTWTVFRT-VMSGVERKASQGQEVRL 77

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
            K +          +++ A+ A     +G      +     +           + A    
Sbjct: 78  DKPLFHGQDAQGRAFTVGAQGAIRDPATG----HFRLVGPALKLNLGGRKVTEMTADGGT 133

Query: 129 FNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
           +N    T+ I    ++        L    AV+D     I  S  V        ++A+   
Sbjct: 134 YNEQARTVTIGPNVRISDGGSGFVLTTPEAVVDTSTGIITGSRGVQGAGPIGTINASSYA 193

Query: 188 IENSSRSAVFAG----QVSVVVNPG 208
           I +     VF G    ++S  +NP 
Sbjct: 194 IYDQGERVVFKGSGDTKISGTINPS 218


>gi|254462325|ref|ZP_05075741.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206678914|gb|EDZ43401.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 203

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 54/193 (27%), Gaps = 10/193 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           + R I+ LK   P   + ++    L S       +            E   +        
Sbjct: 8   YTRVIRGLKITLPLVALVLLSTMFLLSKKVDPTAAIALSDHAFRAKIERSQLSNPNYDGT 67

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +      S+ A+ A+      +G  + Q     +  +  E   M + A +   + A   +
Sbjct: 68  TGSGESMSVTAQSARPDPEI-EGKAYGQLVNADINLENGEV--MTVAADTGVVDEAQDLV 124

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS-- 194
            ++    +   D            +  +   S+  V        L A    +     +  
Sbjct: 125 ILNGNVHIITTDGYDFKTSQLTSLISKVEGESAGSVAGFGPPGTLDAGKMFVRTDDDTGN 184

Query: 195 --AVFAGQVSVVV 205
              +F   V +V 
Sbjct: 185 LHLLFTQGVHLVY 197


>gi|254438164|ref|ZP_05051658.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198253610|gb|EDY77924.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 196

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 24/194 (12%), Positives = 64/194 (32%), Gaps = 11/194 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPM-IMKKFILSDYSK 78
           +  F+ FLK   P   + ++    L +       +    ++ +      +    +S  + 
Sbjct: 8   YSNFVGFLKITLPLGALALMSTVFLFARTPTQDNAIPYAEIEEIAREPRLSGARVSGVTD 67

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
           D     L A+ A+        ++ ++    ++         + + A     N A     +
Sbjct: 68  DGSVIELTAQTARPI----GDVLLVETISASIDAVDG--IHINIRAGQGEINNATRIARL 121

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN----SSRS 194
           +   +++  +   ++      ++    I S   + +      L+A    IE     + + 
Sbjct: 122 TGLARVETSNGYEMETAGITANLTTGQIISDGALEVQAPFGSLTAGQMTIETPEGGTGQV 181

Query: 195 AVFAGQVSVVVNPG 208
            +F   V +V  P 
Sbjct: 182 MLFQNGVRLVYTPQ 195


>gi|103487823|ref|YP_617384.1| hypothetical protein Sala_2342 [Sphingopyxis alaskensis RB2256]
 gi|98977900|gb|ABF54051.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 219

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 74/211 (35%), Gaps = 8/211 (3%)

Query: 4   LDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDL 60
           LDR  + +  RS    H R ++ L++  P     +    + S + +   IS         
Sbjct: 14  LDRTMRQMWARS-GSSHDRVVRVLRYGLPLVIGVVAAVLVFSPFTQRAEISFLLAKDKVD 72

Query: 61  LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
           +  E M + +            ++L+A  A    ++   I+ + D    +          
Sbjct: 73  MASERMKVTRAEYRGQDAKGQPFALLAGSAVQKSSAEP-IVRMTDLSGAIRLADGLA--- 128

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + A S  +N+    + +    +++  +  RLD     +D+    +  +  V    +   
Sbjct: 129 TIVAQSGAYNMETERVVVPGTVRVRSANGYRLDASNVAVDLNTRRLIGTGGVEGALNIGQ 188

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
            SAN    +   R     G   + +N G ++
Sbjct: 189 FSANALSADLDKRIVRLEGNARLRINQGAIK 219


>gi|319404927|emb|CBI78527.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 216

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/193 (23%), Positives = 78/193 (40%), Gaps = 6/193 (3%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSI---DLLDFEPMIMKKFILSDY 76
           H   ++ LK F P   + I   F   ++  I       +   +  +   + M    L  Y
Sbjct: 26  HSHQVRLLKIFLPLLALIIALIFCWFTFFSIFVSFDKVLLNHEEEEIAQLTMLNPRLEGY 85

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +     Y + AE+A     S  GII L++    VPT     G +++ A    ++     L
Sbjct: 86  TNFHKPYKIKAEKAFQDRKS-SGIIGLKNITAEVPT--EGRGQIFIDAQGGIYDNIKSHL 142

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            + +PF +  +D +   F TA +D+     N+  PV I  + F L AN  +I    +   
Sbjct: 143 KLDEPFTVTTQDGIIAKFTTAKIDLSKSQFNTDQPVNIQSAGFHLMANALQIYGKEQVMY 202

Query: 197 FAGQVSVVVNPGV 209
           F   V +V++   
Sbjct: 203 FQKGVRIVLDQKE 215


>gi|326388612|ref|ZP_08210205.1| hypothetical protein Y88_3013 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206863|gb|EGD57687.1| hypothetical protein Y88_3013 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 230

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 73/205 (35%), Gaps = 7/205 (3%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDLLDF 63
           R++  ++ +    H R ++FL    P     ++   L+S       IS     +   +  
Sbjct: 9   RSRRQVKAAPGGSHDRMVRFLAVTLPGMIGALLAVMLISPLTPRGEISFLLDRTKVAIVE 68

Query: 64  EPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123
           + M +   +          +S+ A  A     + + ++ ++D    V           L 
Sbjct: 69  DRMRVLGAMYRGEDDHGRTFSITAGSAVQ-HTARENLVQMRDITARVLLDDG---PAILT 124

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
             +  ++     +++     ++  D  R+  + A +D+ +  + S+ PV         +A
Sbjct: 125 TDAGTYDFGQQDIFVPGALNLQTSDGYRMMTKGATIDLDHRRLVSTQPVEGRIPTGTFNA 184

Query: 184 NFARIENSSRSAVFAGQVSVVVNPG 208
           +    +  +R     G   + + PG
Sbjct: 185 DRITADLGTRIVTLDGHAHLRMVPG 209


>gi|261884101|ref|ZP_06008140.1| hypothetical protein CfetvA_02306 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 166

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 63/153 (41%), Gaps = 5/153 (3%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW--IRISTFSKSSIDLLDFEPMIMKKFIL 73
             ++H   ++ LK   P A + +   F   ++     S          +   ++MK   L
Sbjct: 16  AAQRHSVRVRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHL 75

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+KD   YS+ A +A     +  G I L+     +P    E G   + A S  ++ AN
Sbjct: 76  NGYTKDNRPYSMTAAKATQDVKN-SGAITLEGISARLPV--GEKGHATVEAASGVYDNAN 132

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITI 166
             L + + F +   + LR    +  +++K+  I
Sbjct: 133 GRLQLDKDFTVTTDNGLRAQLHSEDVNLKSGQI 165


>gi|302381885|ref|YP_003817708.1| hypothetical protein Bresu_0771 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192513|gb|ADL00085.1| protein of unknown function DUF1239 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 219

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/206 (16%), Positives = 61/206 (29%), Gaps = 10/206 (4%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM 68
           ++  +  ++R   R +Q  +   P   V + G  L  +  R    S       +   + +
Sbjct: 17  RLAAEAGRWRARSRRVQLYRRLLPILIVVLAGGALTWTVFRT-VMSGVERSASESREISL 75

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
              +          + + AE A     +  G   L    L +           L A +  
Sbjct: 76  DNPMFHGQDAQGRSFVIGAEGAVRDPAT--GRFRLNGPVLRL--NLGGTKITELTADAGI 131

Query: 129 FNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
           +N    ++ I    K+        L    AV+D     +     V        +SA    
Sbjct: 132 YNETARSVTIGPNVKISDGGSGFTLTTPEAVVDTATGIVTGDKGVQGRGPLGTISATSYA 191

Query: 188 IENSSRSAVFAG----QVSVVVNPGV 209
           I       VF G    +V   ++P  
Sbjct: 192 IYEQGGRVVFRGSGDNKVQGTISPSS 217


>gi|329888477|ref|ZP_08267075.1| hypothetical protein BDIM_04010 [Brevundimonas diminuta ATCC 11568]
 gi|328847033|gb|EGF96595.1| hypothetical protein BDIM_04010 [Brevundimonas diminuta ATCC 11568]
          Length = 220

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 66/216 (30%), Gaps = 12/216 (5%)

Query: 2   DHLDRRNKILLQRS--KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSID 59
           D   R ++  + R+  ++R   R ++  +   P   + + G  L  +  R    S     
Sbjct: 8   DEQKRADEARVARAGERWRTRSRRVKLYRRVLPIVILMLAGGALTWTVFRT-VMSGVERK 66

Query: 60  LLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGD 119
             +   + +   +          + + A+ A     +G      +     +         
Sbjct: 67  ASESREIRLDNPMFHGQDAQGRSFVIGAQGAVRDPATG----HFRLVGPLLRLNLGARKT 122

Query: 120 MYLFAHSARFNLANHTLYISQPFKMKVK-DNLRLDFETAVLDVKNITINSSDPVIITHSD 178
             L A    +      + I    K+        L    AV+D +   +     V      
Sbjct: 123 TELTADGGTYLETQRKVVIGPNVKISDGGTGWTLVTPEAVVDTETGVVTGDKGVQGRGPL 182

Query: 179 FVLSANFARIENSSRSAVFAG----QVSVVVNPGVL 210
             ++A+   I +  +  VF G    +VS  +NP   
Sbjct: 183 GSINASSYAIYDQGQRVVFNGQGETKVSGTINPAGA 218


>gi|89052718|ref|YP_508169.1| hypothetical protein Jann_0227 [Jannaschia sp. CCS1]
 gi|88862267|gb|ABD53144.1| hypothetical protein Jann_0227 [Jannaschia sp. CCS1]
          Length = 198

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 21/195 (10%), Positives = 62/195 (31%), Gaps = 8/195 (4%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS---TFSKSSIDLLDFEPMIMKKFILSDY 76
           + + + ++K   P   + ++    L +                        + +   +  
Sbjct: 7   YSKAVMWVKIILPLVALGLLSSIFLLANAPDPDDALPYADVDIEQITRRQTVTEPRFAGI 66

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
             D  +  L+A+      +        +  +  +        ++ + A     ++A    
Sbjct: 67  LGDGQEIVLIADTVTADVD-QTDQFLARMVDGRM--DMGLTEELMIRADLGDIDMAAQLA 123

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE--NSSRS 194
            ++    +   D  R+  E  ++ +  + + S  PV +T     ++A+   +   +    
Sbjct: 124 TLTDDVVLHTTDGYRMVSEVVIMALDVVNMRSPVPVHVTGPGIDVTADTMELTGPDGETI 183

Query: 195 AVFAGQVSVVVNPGV 209
             F G V V+ +P  
Sbjct: 184 LHFNGSVRVLYDPQS 198


>gi|254454863|ref|ZP_05068300.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198269269|gb|EDY93539.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 196

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 62/194 (31%), Gaps = 11/194 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW-IRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
           + +F+ FLK   P A + ++    L +      +    +          +    +S  + 
Sbjct: 8   YSKFVGFLKITLPLAALALMSTVFLFARAPTQDSAVPYAEIEEVAREPRLSGAQVSGVAD 67

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
           D     L AE A+         + ++    ++         + + A     N A     +
Sbjct: 68  DGSVIQLTAETARPL----GDFLLVETMFASIDVVNGT--HIDIRAGRGEINNATRIARL 121

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE----NSSRS 194
           +   +++  +   ++      ++    I S   + I      L+A    IE       + 
Sbjct: 122 TGLARIETSNGYEMETAGITANLTTGQITSDGALEIQAPFGSLTAGQMIIETPEGMGGQV 181

Query: 195 AVFAGQVSVVVNPG 208
            +F   V +V  P 
Sbjct: 182 MLFQNGVRLVYTPQ 195


>gi|296446797|ref|ZP_06888735.1| protein of unknown function DUF1239 [Methylosinus trichosporium
           OB3b]
 gi|296255672|gb|EFH02761.1| protein of unknown function DUF1239 [Methylosinus trichosporium
           OB3b]
          Length = 249

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 69/210 (32%), Gaps = 11/210 (5%)

Query: 4   LDRRNKILLQRS----KYRQHVRFIQFLKFFFPF--ATVTIVGWFLLSSWIRISTFSKSS 57
           LDR + ++  R     + R+H + +  L+ F  +  A + +                  S
Sbjct: 11  LDRLDGLIAARPDAIPEARRHTQRVARLRRFLIWGSAGIVVAALLGALVRSLSFLPVNLS 70

Query: 58  IDLL--DFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRS 115
              +      + ++   L  Y KD   Y L A  A    +    I  L + E+ +     
Sbjct: 71  FSRIVTQGTRITIESPKLVAYRKDGRPYELRARTAVQDLD-HPDIYELNELEVRITNDSD 129

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT 175
               + L +    ++       +S    +       +    A +D +   + S+ P  + 
Sbjct: 130 GV--IILTSQRGVYDGGKDEAALSGDAHIYDGTRFDMKTAAATIDFRGGLVTSTTPTTLM 187

Query: 176 HSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             + V++A       + + A F G V    
Sbjct: 188 LDESVVTAQACEFSQTEKRATFTGAVHTTF 217


>gi|77464735|ref|YP_354239.1| hypothetical protein RSP_1154 [Rhodobacter sphaeroides 2.4.1]
 gi|77389153|gb|ABA80338.1| hypothetical protein RSP_1154 [Rhodobacter sphaeroides 2.4.1]
          Length = 204

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 50/197 (25%), Gaps = 11/197 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R + +LK   P A + I+    L +       +                +     +  
Sbjct: 10  HSRLVSWLKVVLPLAALAILSTLFLVARTINPDDAIPYADVDVADRVREPRITAPTWAGI 69

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           + D      V   A     S             + T         + A +   +     L
Sbjct: 70  TSDGAA-LSVEAAAARPGQSPGEEGRAAALRARIDTPDGASA--TMAAETGALDSDARLL 126

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
            +    ++       L  E    D+    + S   +  T     + A   R+        
Sbjct: 127 RLGGGVEVTTSTGYHLTTEAVTADLDATDVRSDSALDATGPLGRIEAGSMRLTEDPEAAG 186

Query: 194 --SAVFAGQVSVVVNPG 208
                F  +V ++ +P 
Sbjct: 187 SYVLTFGNRVKLIYDPK 203


>gi|83950823|ref|ZP_00959556.1| hypothetical protein ISM_06975 [Roseovarius nubinhibens ISM]
 gi|83838722|gb|EAP78018.1| hypothetical protein ISM_06975 [Roseovarius nubinhibens ISM]
          Length = 203

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/205 (12%), Positives = 65/205 (31%), Gaps = 10/205 (4%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKF 71
           ++   H RF+ ++K   P   + ++    L S                    +       
Sbjct: 2   AQGEFHTRFVGWMKIILPVIALGLLSTLFLLSRTVDPTQDIPVTEVDLEQRAQDQGASNP 61

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
             S  ++   + +  A   +   ++   ++        +  +      + + A + R + 
Sbjct: 62  SFSGVTQGGEQVTFEAVMVRPDLSADGQLL-ADRPNAKITLEGGTV--VTVTAANGRTSR 118

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              +  +     +      +L+ +  V + + +T+ S  PV        L A    + +S
Sbjct: 119 NMMSAELLGEVVVTTSQGYQLNSKRIVAEFEPLTVESPGPVTGKGPPGDLEAGRMHLTSS 178

Query: 192 SR----SAVFAGQVSVVVNPGVLQK 212
                   +F G V +V  P   ++
Sbjct: 179 EEEGRTHLLFTGGVKLVYKPRGNEE 203


>gi|149912957|ref|ZP_01901491.1| hypothetical protein RAZWK3B_03175 [Roseobacter sp. AzwK-3b]
 gi|149813363|gb|EDM73189.1| hypothetical protein RAZWK3B_03175 [Roseobacter sp. AzwK-3b]
          Length = 204

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 61/198 (30%), Gaps = 12/198 (6%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMK----KFILSD 75
           H + + +LK   P A +  +   L      I T +      +D E    +        + 
Sbjct: 8   HSQLVAWLKIILPLAALG-LLSTLFLLSRSIDTNNAIPFSDIDIEKRAREQGASNPAFAG 66

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +    +  + A  A    ++    I  +  +  +     E   + + + SA     ++ 
Sbjct: 67  VTDSGDQVIVNARTAWPDLSN-PERILAEAVDAQLLLTTGEV--IDITSDSAEVLQQDYI 123

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS- 194
             +     +      R+  ET       +   S  PV  T     L A    + +   + 
Sbjct: 124 ATLIGNVVVTTSTGYRMTTETLESRFDKLHAESLAPVSGTGPPGKLDAARMLLTSDPDTG 183

Query: 195 ---AVFAGQVSVVVNPGV 209
               +F G V ++  P  
Sbjct: 184 DAHLLFTGGVKLLYQPQN 201


>gi|126463575|ref|YP_001044689.1| hypothetical protein Rsph17029_2815 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640649|ref|YP_002526911.1| hypothetical protein RSKD131_2550 [Rhodobacter sphaeroides KD131]
 gi|332559628|ref|ZP_08413950.1| hypothetical protein RSWS8N_11235 [Rhodobacter sphaeroides WS8N]
 gi|126105239|gb|ABN77917.1| protein of unknown function DUF1239 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161430|gb|ACM02410.1| Hypothetical Protein RSKD131_2550 [Rhodobacter sphaeroides KD131]
 gi|332277340|gb|EGJ22655.1| hypothetical protein RSWS8N_11235 [Rhodobacter sphaeroides WS8N]
          Length = 204

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/197 (12%), Positives = 50/197 (25%), Gaps = 11/197 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R + +LK   P A + I+    L +       +                +     +  
Sbjct: 10  HSRLVSWLKVVLPLAALAILSTLFLVARTINPDDAIPYADVDVADRVREPRITAPTWAGI 69

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           + D      V   A     +             + T         + A +   +     L
Sbjct: 70  TSDGAA-LSVEAAAARPGQAPGEEGRAAALRARIDTPDGASA--TMAAETGALDSDARLL 126

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
            +    ++       L  E    D+    + S   +  T     + A   R+        
Sbjct: 127 RLGGGVEVTTSTGYHLTTEAVTADLDATDVRSDSALDATGPLGRIEAGSMRLTEDPEAAG 186

Query: 194 --SAVFAGQVSVVVNPG 208
                F  +V ++ +P 
Sbjct: 187 SYVLTFGNRVKLIYDPK 203


>gi|148555812|ref|YP_001263394.1| hypothetical protein Swit_2904 [Sphingomonas wittichii RW1]
 gi|148501002|gb|ABQ69256.1| protein of unknown function DUF1239 [Sphingomonas wittichii RW1]
          Length = 231

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 72/216 (33%), Gaps = 8/216 (3%)

Query: 2   DHLDR-RNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFSKSS 57
           +  DR R++  L  +    H R I  L+   P A   +V    L+       IS      
Sbjct: 3   ELADRARSQRQLWAASGSSHDRVIAILRIVLPVAIGVLVVLLALAPLTVGRDISFVLSKD 62

Query: 58  IDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEY 117
              +  E M +              + L A  A  + +    ++ LQ     +       
Sbjct: 63  RVEVARERMRVTAATYRGQDSKGQPFQLTAGSAVQATSRDP-VVRLQKLAAEIQLPEG-- 119

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
               + A   R+++ +  + +  P  ++  D   ++     +D+K   + S  PV    +
Sbjct: 120 -PAKIVAGHGRYDMDSEKVAVDGPVHLRSADGYNIETRDVGIDLKTRQVASQGPVDGRMN 178

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
               S +    + + R  V  G+  + ++    +  
Sbjct: 179 IGTFSGDRFTADLNKRIVVLEGRARLHIDQRQAKAA 214


>gi|114769796|ref|ZP_01447406.1| hypothetical protein OM2255_09516 [alpha proteobacterium HTCC2255]
 gi|114549501|gb|EAU52383.1| hypothetical protein OM2255_09516 [alpha proteobacterium HTCC2255]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/205 (12%), Positives = 61/205 (29%), Gaps = 14/205 (6%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE---PMIMKKFILS 74
           + + R I++ K   P   V ++    +            SID           +     S
Sbjct: 6   KSYSRAIKWAKLIMPVIAVLLLASVFIFGKEDALRSGTLSIDADTINLTTDQKITNPQFS 65

Query: 75  DYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
             +     + L A  A     S    I L    L     +       + + +   N    
Sbjct: 66  GLTNLGDSFILKAIEAMPDSPS-PEKIDLIGPSLEFDALQGVG--FKISSKNGSVNFIKQ 122

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR- 193
           +  ++    + + +  +   E   L++K   + + + V  +     + A    +      
Sbjct: 123 SAELNGNVYIDMTNGYKAISEKIQLNLKLGNLIAPNSVEASGPYGKIIAGSMELFKDFDN 182

Query: 194 -------SAVFAGQVSVVVNPGVLQ 211
                  +  F+  V+++  P  ++
Sbjct: 183 KTSQVSGNLNFSDGVTLIYLPSTVK 207


>gi|118589456|ref|ZP_01546862.1| hypothetical protein SIAM614_07923 [Stappia aggregata IAM 12614]
 gi|118438156|gb|EAV44791.1| hypothetical protein SIAM614_07923 [Stappia aggregata IAM 12614]
          Length = 187

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 75/188 (39%), Gaps = 5/188 (2%)

Query: 23  FIQFLKFFFPFATVTIVGWFL-LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
            ++ +++ FP   + I+   + L     + +   ++  +L  E ++M    LS +  D  
Sbjct: 1   MVRIMRWLFPGVGLLILAVMVGLVVLFNVLSGLGATNVMLTSEGLVMDHPELSGHDGD-R 59

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y + A RA    +    II L+     +   + +   +   A    +N A  +L + + 
Sbjct: 60  SYRVTAYRAIQRLS-DPRIIDLETIRADITLSKDQSAQIV--ALKGTYNNATESLRLYEG 116

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
            +++  +   +D     +D+ N  + +S+ V I      + A     + +     F+  +
Sbjct: 117 IQLEWSEGYTVDLSEVEIDLTNGALKTSNVVSIRSDQGRVVAGKLDYDKAKGIVRFSDGI 176

Query: 202 SVVVNPGV 209
            + +NP  
Sbjct: 177 KMTLNPAS 184


>gi|323136908|ref|ZP_08071988.1| protein of unknown function DUF1239 [Methylocystis sp. ATCC 49242]
 gi|322397669|gb|EFY00191.1| protein of unknown function DUF1239 [Methylocystis sp. ATCC 49242]
          Length = 236

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 73/209 (34%), Gaps = 13/209 (6%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGW----FLLSSWIRISTFSKSSIDLLDFEPMIMKKF 71
           +  +H   +  L+ +  +    +V       L+ S   +      +   L    ++++  
Sbjct: 31  EALRHTARVTRLRRWMLWGAGGVVALVGLGLLIGSLSFLPVDLNLARVALKGTRIVIETP 90

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
            L  Y KD   Y + A            I  L+  ++ V  + ++   + L A    ++ 
Sbjct: 91  KLVGYRKDGRPYEVRARVGVQDIA-KPDIFELEGLDVRV--ENTQDNSIVLTAEKGVYST 147

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
            +    +S    ++   N  +  ++A +D K+  + S  PV +      + A        
Sbjct: 148 KSDYADLSGGVTIRDDKNFDMRLDSASMDFKSSVMKSDKPVTLRIDGGEVVAKSVEFVQK 207

Query: 192 SRSAVFAGQVSVVVN------PGVLQKKE 214
            R A F G V  V+       P  L+  +
Sbjct: 208 ERRATFVGDVHSVLYGEGDVPPDGLRPAQ 236


>gi|260577296|ref|ZP_05845269.1| protein of unknown function DUF1239 [Rhodobacter sp. SW2]
 gi|259020477|gb|EEW23800.1| protein of unknown function DUF1239 [Rhodobacter sp. SW2]
          Length = 209

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 66/196 (33%), Gaps = 12/196 (6%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R + +LK   P   + I+    + S     + +                M +   +  
Sbjct: 10  HSRLVGWLKVLLPLLALVILSTLFMVSRKIDPQDAIPYAEVDVADRIREPRMTEPAYAGV 69

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           ++D    ++ A+ A+   +   G    Q     + T         + A +  F+     +
Sbjct: 70  TEDGASLTVTADAARPDASGKGGT--AQTLRAELDTPDG--AHTSIVAQNGTFDDTARQM 125

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
            ++   ++       +  E  V ++    + S+ PV  T    VLSA   RI  +     
Sbjct: 126 RLNGGVQITTSTGYLMTTEALVSELDRTEVTSAGPVAGTGPLGVLSAGQMRITATEGVSG 185

Query: 194 --SAVFAGQVSVVVNP 207
               VF  +V ++  P
Sbjct: 186 SYVLVFKNRVKLIYRP 201


>gi|328545552|ref|YP_004305661.1| hypothetical protein SL003B_3936 [polymorphum gilvum SL003B-26A1]
 gi|326415293|gb|ADZ72356.1| hypothetical protein SL003B_3936 [Polymorphum gilvum SL003B-26A1]
          Length = 223

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 76/195 (38%), Gaps = 5/195 (2%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWI-RISTFSKSSIDLLDFEPMIMKKFILSDYSKD 79
              ++ L+  FP   V I+       ++  +         +L  E ++M +  LS +  +
Sbjct: 33  SGLVRLLRILFPLLGVAILVAIAGLIFLYNVLNSLGIGNVILTSEGLVMDRPELSGHDGE 92

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              Y + A RA     +   II L+     +     +   +   A    +N    TL +S
Sbjct: 93  -RSYKVSAVRAIQRI-TDPRIIDLETITAEIVLGPDQRAAI--TATKGTYNNGAETLSLS 148

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +  ++      ++ FE+  +D++  T+ +SDP+ I      + A     +       F  
Sbjct: 149 EGIELDWSGTYQVHFESVDVDLRTGTVRTSDPLQINSQQGDIQAGRFAYDQDKGLVRFTD 208

Query: 200 QVSVVVNPGVLQKKE 214
            + +V+ PG  +K +
Sbjct: 209 GIKMVLRPGAQEKTK 223


>gi|288956947|ref|YP_003447288.1| hypothetical protein AZL_001060 [Azospirillum sp. B510]
 gi|288909255|dbj|BAI70744.1| hypothetical protein AZL_001060 [Azospirillum sp. B510]
          Length = 184

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 53/168 (31%), Gaps = 4/168 (2%)

Query: 47  WIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDF 106
           W  +++   + I   D     M K       +    +SLVA +A  S +    I+ L D 
Sbjct: 19  WPSLNSPQGARIT-ADAGQTEMLKPRYFSLDEHNQPFSLVAAKADKSTD-QPDIVLLDDP 76

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITI 166
              +      +  + + +    +N     L +     +   D        A  D++    
Sbjct: 77  RAEMTETTGTW--VTMQSDKGWYNQTTGILLMRGNVHVLRDDGNEFTTSEAEADIRKGNA 134

Query: 167 NSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
               PV        ++A   R+ +  ++ VF  Q    V        +
Sbjct: 135 WGDKPVTGQGPQGEINAIGFRMTDRGKNVVFLNQSKAEVQAAERPGSK 182


>gi|254485995|ref|ZP_05099200.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214042864|gb|EEB83502.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 202

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 64/201 (31%), Gaps = 10/201 (4%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSD 75
           ++ R + +LK  FP A + ++    L S                        +     + 
Sbjct: 5   RYTRIVSWLKVLFPLAALGLLSTLFLLSRAIDPGQVIPFAEKEIQDRLRDQQITAPFFTG 64

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +      S  A+   T+     G    ++   T+ T         L +  A  +LA   
Sbjct: 65  ATAKGDMISFYAD-VLTTPGGQVGSNRAENIRATIKTAEG--VTFRLQSGMADIDLAQDH 121

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI----ENS 191
             ++    +      R+  E    ++ ++ + S   V  T     L A    +     ++
Sbjct: 122 AELTGNVILMTSTGYRVTSERLTSELSSVNLQSPGAVYGTAPGGTLEAGAMTVQQSETDT 181

Query: 192 SRSAVFAGQVSVVVNPGVLQK 212
           S   +F  +V ++  P  L +
Sbjct: 182 SPQLLFTNRVKLIYKPKPLPE 202


>gi|254467110|ref|ZP_05080521.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206688018|gb|EDZ48500.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 199

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 28/200 (14%), Positives = 63/200 (31%), Gaps = 11/200 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           H R + +LK   P A + ++    L S                    +   +     S  
Sbjct: 4   HSRAVAYLKVLLPLAALVLMSTLFLISRGVNTDAVIPFAQKEIEDRMKGQQVTAPFFSGT 63

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +    +  + A  A+   +    +    D    +   +   G + L + +   +      
Sbjct: 64  TASGDEIMVTASLARPGRDGTPAV--ASDLSADIRLAQG--GRITLASETGSIHPDRDIA 119

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
             S   ++   D L ++ E     +  +  +S  PV  T +   L+A    I   +    
Sbjct: 120 QFSGNVQITSADGLVVETEELNTALSGLEADSPGPVRATGAIGELTAGNMHIGVKTEGGP 179

Query: 194 -SAVFAGQVSVVVNPGVLQK 212
              +F   V ++ +P   ++
Sbjct: 180 VHMLFKNGVKLLYDPQQPER 199


>gi|304320834|ref|YP_003854477.1| hypothetical protein PB2503_06347 [Parvularcula bermudensis
           HTCC2503]
 gi|303299736|gb|ADM09335.1| hypothetical protein PB2503_06347 [Parvularcula bermudensis
           HTCC2503]
          Length = 239

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 27/215 (12%), Positives = 71/215 (33%), Gaps = 10/215 (4%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS---TFSKSS 57
           +  + R+++  +      +H  +++ L+   P   V ++  + +S+           +  
Sbjct: 21  LSSVGRKSRRRISPRAAARHSLWVRRLRLIVPALGVGVLIAYAVSATPPTIDRAFVEEFR 80

Query: 58  IDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEY 117
                   + + +     Y  +  +  + AE A+        +I     E        E 
Sbjct: 81  NIDPQSPNLRLNRPRHVGYDLEGNQVEIGAEAAER-LGPDSNLITFDRPEALRRAGEGED 139

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNL---RLDFETAVLDVKNITINSSDPVII 174
               + A +  F+   + L +S   ++  +       L    A +D+   T+ SS+ V  
Sbjct: 140 ---RVRARTGLFDSERNVLDLSDQVEVDYRWGRDTIVLSTPAASVDLNAQTVTSSNGVSG 196

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
                 ++A+           +  G V + ++   
Sbjct: 197 GGERGQIAADRVTAYQDEGRLLLEGNVRLRLDGDA 231


>gi|163738082|ref|ZP_02145498.1| hypothetical protein RGBS107_06709 [Phaeobacter gallaeciensis
           BS107]
 gi|161388698|gb|EDQ13051.1| hypothetical protein RGBS107_06709 [Phaeobacter gallaeciensis
           BS107]
          Length = 199

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 25/200 (12%), Positives = 58/200 (29%), Gaps = 11/200 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           + R + +LK   P   + ++    L S                        +     S  
Sbjct: 4   YSRLVAYLKVLLPLMALALMSTMFLISRGVNTDAVIPFAEQDLEDRTRGQQITAPFFSGT 63

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +    +  + A  A+                L    + +  G   L + +          
Sbjct: 64  TAQGDEIMVTAALARPGGADAP----ATAVNLEAEIKMTGGGRFLLSSDTGALRPDKDMA 119

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
                 ++   D LR+  +     +  +  +S  PV  + +   L+A   +I+  +    
Sbjct: 120 NFRGDVEILSSDGLRVTTQELNAALNGVRADSPGPVQASGAMGDLTAGAMQIDTKTESGA 179

Query: 194 -SAVFAGQVSVVVNPGVLQK 212
              VF   V ++ +P   ++
Sbjct: 180 VHMVFNKGVKLLYDPQQSER 199


>gi|163742522|ref|ZP_02149908.1| hypothetical protein RG210_06534 [Phaeobacter gallaeciensis 2.10]
 gi|161384107|gb|EDQ08490.1| hypothetical protein RG210_06534 [Phaeobacter gallaeciensis 2.10]
          Length = 199

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 25/200 (12%), Positives = 58/200 (29%), Gaps = 11/200 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           + R + +LK   P   + ++    L S                        +     S  
Sbjct: 4   YSRLVAYLKVLLPLMALALMSTMFLISRGVNTDAVIPFAEQDLEDRTRGQQITAPFFSGT 63

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +    +  + A  A+             + E  +       G   L + +          
Sbjct: 64  TAQGDEIMVTAALARPGGADAP--ATAVNLEAEIKMIGG--GRFLLSSDTGALRPDKDMA 119

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
                 ++   D LR+  +     +  +  +S  PV  + +   L+A   +I+  +    
Sbjct: 120 NFRGDVEILSSDGLRVTTQELNAALDGVRADSPGPVQASGAMGDLTAGAMQIDTKTESGA 179

Query: 194 -SAVFAGQVSVVVNPGVLQK 212
              VF   V ++ +P   ++
Sbjct: 180 VHMVFNNGVKLLYDPQQSER 199


>gi|315497169|ref|YP_004085973.1| hypothetical protein Astex_0121 [Asticcacaulis excentricus CB 48]
 gi|315415181|gb|ADU11822.1| protein of unknown function DUF1239 [Asticcacaulis excentricus CB
           48]
          Length = 218

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 77/199 (38%), Gaps = 4/199 (2%)

Query: 2   DHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL 61
           D  D R ++  Q   +++  R I  L+  FP   + ++   ++   I  S  +  ++   
Sbjct: 10  DLADARQRLTTQALAWKKRSRKISRLRIIFPGLIIGLIVV-MIVWIIVQSVINSMNVYSA 68

Query: 62  DFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY 121
             E + M     +D S++  +Y +    A     +   ++ L    L + ++ S      
Sbjct: 69  TGEDIRMTNPFYTDRSRNGERYEMRGLEAVRKGRNAS-VVSLTAPRLEIRSENSR--PSA 125

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L   +  ++       +++   +   + L L    A +D++N  I    PV        +
Sbjct: 126 LEGAAGIYDDTKRRFTVNKDVTLSSGNGLSLRTHAAEVDLQNAVITGDKPVEGRWQTGTV 185

Query: 182 SANFARIENSSRSAVFAGQ 200
           +A   R+E + R   F G+
Sbjct: 186 NAQAFRVEQNGRKVAFYGK 204


>gi|329847151|ref|ZP_08262179.1| hypothetical protein ABI_02140 [Asticcacaulis biprosthecum C19]
 gi|328842214|gb|EGF91783.1| hypothetical protein ABI_02140 [Asticcacaulis biprosthecum C19]
          Length = 223

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/197 (14%), Positives = 67/197 (34%), Gaps = 5/197 (2%)

Query: 5   DRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE 64
           +R  ++  Q +  R+  R I  L+ F P A + ++        +  S  +  ++   +  
Sbjct: 21  ERSQRLGKQVAAVRRRSRLIHSLRTFLPGAIIGLIVLNFGWIIVT-SIINSMNVYDGNSN 79

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            + M        +     Y++    A          + L+   +    +    G   + A
Sbjct: 80  EIRMTNPRYHGQTGKGEHYTISGLEAVRRGK-DATTVMLKSPVMEF--KGDADGTTRVAA 136

Query: 125 HSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
            +  F+  +    ++    +     +     E A++D+ N T+     V  T S   +  
Sbjct: 137 VNGVFDQQSRKFIMTGNVLLVTGGSDFTFKTEEAIVDLDNSTVYGDKHVEGTSSVGHIVG 196

Query: 184 NFARIENSSRSAVFAGQ 200
               I ++  S  F G+
Sbjct: 197 ESFVISDNGNSVRFTGR 213


>gi|254292596|ref|YP_003058619.1| hypothetical protein Hbal_0220 [Hirschia baltica ATCC 49814]
 gi|254041127|gb|ACT57922.1| protein of unknown function DUF1239 [Hirschia baltica ATCC 49814]
          Length = 214

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 68/197 (34%), Gaps = 8/197 (4%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM 68
           + +   ++ R     +  L+  F  A + I   +L+   +  +  S +SI       + M
Sbjct: 15  RRVTTLTQARFRSSLVGLLRMLF-MAGIAISAGWLIGPVVVHAFTSGASIQENSVNGVTM 73

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
                S   ++   ++L A  A+   +       L   +L  P      G + + A +  
Sbjct: 74  LNPRFSGRDENGNAFTLTAGTAQRRID------ELDVVDLQQPVLEDGLGGV-VRARTGV 126

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
           ++     L ++         +  L  ++AV+ +    +  S P+          A+   +
Sbjct: 127 YDKGKEMLTLTDNVHFVDASDYELTTDSAVVFISENRVVGSTPLRGEGPLGEFRADSYEV 186

Query: 189 ENSSRSAVFAGQVSVVV 205
            +  +  +  G V   +
Sbjct: 187 VDGGKRTILIGNVWTQI 203


>gi|254511013|ref|ZP_05123080.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534724|gb|EEE37712.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 202

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 24/205 (11%), Positives = 62/205 (30%), Gaps = 11/205 (5%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFSKSSIDLLDFEPMIMKKF 71
           ++  +H R++QFLK   P   + ++    L S      +S               ++ + 
Sbjct: 2   AEVDRHSRWVQFLKVLLPLVAILLLSSVFLFSRSIDTDVSVPFTGQEIDERLTDQVVTRP 61

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
                ++   +  + A RA       +      +            G++ L + +     
Sbjct: 62  DYKGVTRKGEEIHVEARRASQ--GGAEETPTASEVHGRFGLSNG--GEITLESDTGSIRP 117

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI--- 188
              T        +   D +++  +     +  I  +S   +  T      +A        
Sbjct: 118 DKGTATFVGNVVITTADGIQVTSDLLNTSLDEIRGDSPGQIDGTGPIGNFTAGRMTFGAE 177

Query: 189 -ENSSRSAVFAGQVSVVVNPGVLQK 212
            ++     +F   V ++  P   ++
Sbjct: 178 KKDGPVHILFTDGVKLIYEPQKAER 202


>gi|16125420|ref|NP_419984.1| hypothetical protein CC_1168 [Caulobacter crescentus CB15]
 gi|221234163|ref|YP_002516599.1| hypothetical protein CCNA_01226 [Caulobacter crescentus NA1000]
 gi|13422488|gb|AAK23152.1| hypothetical protein CC_1168 [Caulobacter crescentus CB15]
 gi|220963335|gb|ACL94691.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 210

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 59/177 (33%), Gaps = 4/177 (2%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERA 90
                  +    ++ +  R    SK          +++ K   +   KD   + + AERA
Sbjct: 36  LAVFAAGVAATVIVQAAWRSLASSKLQTQAATAP-LVLDKPRFTGVLKDGRPFLITAERA 94

Query: 91  KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL 150
           +      + I+ L      +     E       A S  +  A +TL ++   K+   +  
Sbjct: 95  ERDAK-DQNIVRLTAP--LLVRGYGEPNPSQATAKSGVYREAENTLLLTDEVKITSAEGF 151

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
             D   A++D++   ++    +  +       A+   + +     V  G V   + P
Sbjct: 152 DFDAPRALIDLRTGAVSGDAGIAGSGPKGSTRASAYEVTDKGDRVVLKGGVRTRLEP 208


>gi|114327363|ref|YP_744520.1| hypothetical protein GbCGDNIH1_0699 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315537|gb|ABI61597.1| hypothetical protein GbCGDNIH1_0699 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 235

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/206 (13%), Positives = 70/206 (33%), Gaps = 11/206 (5%)

Query: 6   RRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSW----IRISTFSKSSIDLL 61
           +R K+   R   ++H R +  +K+  P     ++    +       +  +  +   +   
Sbjct: 22  KRAKVPSPRRIAQRH-RMVMAVKYLLPATAALLLTMLAIWPEIDREVDAARVTYRRLTAT 80

Query: 62  DFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY 121
                 +         +    Y++ A  A+      +  I L   +     Q   +  + 
Sbjct: 81  ASSGTRLTGATYRGVDEQNRPYTVTAHAAEQ---VDQERINLAQPKADATLQNGNW--LM 135

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           + +    +      L ++    +   D   +  +TA L++ +  ++SSD V +      L
Sbjct: 136 VQSKKGVYLQHLGMLDMTGDVTLYRDDGTVMTSQTASLNMHHGAVSSSDKVSVEGPFGTL 195

Query: 182 SAN-FARIENSSRSAVFAGQVSVVVN 206
            A+    + +      F G   +V+N
Sbjct: 196 DASHGFTLLDRGNIMQFHGPSRMVLN 221


>gi|114764077|ref|ZP_01443316.1| hypothetical protein 1100011001333_R2601_15502 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543435|gb|EAU46450.1| hypothetical protein R2601_15502 [Roseovarius sp. HTCC2601]
          Length = 202

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/202 (11%), Positives = 58/202 (28%), Gaps = 10/202 (4%)

Query: 14  RSKYRQHVRFIQFLKFFFPFATVTIVGWFLLS---SWIRISTFSKSSIDLLDFEPMIMKK 70
             +   +   I +LK   P   + ++    L    S   ++                +  
Sbjct: 2   ARRGDTYSYVIGWLKILLPLVALALLSTLFLVGRSSEPTVNIPFADPDGSDGPARQQIVA 61

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
              +  +    +  L A+ A+     G   +     + ++         + L +  A  +
Sbjct: 62  PRYAGLTARGDQLILTADSAEP-LADGMDEVLAHQLDASIDMSDG--SRITLRSDRAVVS 118

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI-- 188
               +  +    +++     R+D E     +  I   +  PV         +A    I  
Sbjct: 119 EGEQSADLEGAVRIESSTGYRIDTERLRAAMDRIEAETLAPVSGEGPAGSFTAGKLTIAP 178

Query: 189 --ENSSRSAVFAGQVSVVVNPG 208
                    +F   V+++ +P 
Sbjct: 179 TETGEDVQLLFTQGVNLIYDPK 200


>gi|260431734|ref|ZP_05785705.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415562|gb|EEX08821.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 199

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 59/201 (29%), Gaps = 11/201 (5%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFSKSSIDLLDFEPMIMKKFILSD 75
           ++ R +QFLK   P   + ++    L S      +S            +  ++ +     
Sbjct: 3   RYSRMVQFLKVLLPLVAILLLSMVFLLSRSIETNVSGPFTEQDLDARVKSQMVTRPRFRG 62

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            ++      + A +A       +G+      +            + L + +   +     
Sbjct: 63  TTRKGEDIQVEAVQASRGSA--EGVPTASRLQGRFGLTNGGV--ITLDSETGMLHPNKGE 118

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI----ENS 191
              S    M   D +R+  +     +  I   +  PV         SA   R      + 
Sbjct: 119 AVFSGDVVMTTTDGIRVTTDLLNTSLDEIRGETPGPVQAFGPIGRFSAGRMRFGAEKTDG 178

Query: 192 SRSAVFAGQVSVVVNPGVLQK 212
               +F   V +V  P   ++
Sbjct: 179 PVHILFTDGVKLVYEPPKTER 199


>gi|56695009|ref|YP_165355.1| hypothetical protein SPO0081 [Ruegeria pomeroyi DSS-3]
 gi|56676746|gb|AAV93412.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 202

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/201 (10%), Positives = 57/201 (28%), Gaps = 12/201 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF----EPMIMKKFILSD 75
           + R +Q+LK   P   + ++    L S     + +       +         +     + 
Sbjct: 6   YSRVVQYLKVLLPLTALGLLSAVFLLSSRGTDSVAPIPFAEDEIADRTRGQQITGPFFTA 65

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +    +  + A  A+    +        D    +     +   + L +      L    
Sbjct: 66  VTPKGEQIQVQATLARPGGENAP--AEATDLIAELLLLGGK--RIRLTSDLGTVQLDKDL 121

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR-- 193
              +    +   D L +  +     +  I+  +   V  T      +A   ++   +   
Sbjct: 122 AIFTGNVVITTSDGLTVTTDQLNAGLSGISGETPGNVRGTGPIGEFTAGSMQMGAENEDG 181

Query: 194 --SAVFAGQVSVVVNPGVLQK 212
                F   V ++ +P   ++
Sbjct: 182 PIHIRFKNGVKLLYDPKAAER 202


>gi|258541778|ref|YP_003187211.1| hypothetical protein APA01_06820 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632856|dbj|BAH98831.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635913|dbj|BAI01882.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638968|dbj|BAI04930.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642022|dbj|BAI07977.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645077|dbj|BAI11025.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648132|dbj|BAI14073.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651185|dbj|BAI17119.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654176|dbj|BAI20103.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 245

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 67/202 (33%), Gaps = 9/202 (4%)

Query: 9   KILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSS----WIRISTFSKSSIDLLDFE 64
           + L   +K  +    +++ K+  P   + ++    +       +  +  +   +  +  E
Sbjct: 35  RKLPDAAKLARRRTMLRWAKWVLPATALLLLATIAVWPEVDRLLSANQTTIKELAKVKIE 94

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
              +         +    + + A+ A    ++   +I     +  + TQ   +  +++ +
Sbjct: 95  SGNLIGATYRGVDEHNRPFMITADSAHQVNDNRMDLIR---PKADLLTQGGSW--LWVES 149

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
               +      L ++    +   D L +    A +DVK   I S   V        L A 
Sbjct: 150 EKGVYMQHAQILDLTGEVTLYRDDGLMMHSPVADIDVKRGIIASDSWVRAEGPFGSLDAK 209

Query: 185 FARIENSSRSAVFAGQVSVVVN 206
              +      A F G   +++N
Sbjct: 210 GYLLAQHEGIAQFRGPGQLILN 231


>gi|99077984|ref|YP_611243.1| hypothetical protein TM1040_3851 [Ruegeria sp. TM1040]
 gi|99034927|gb|ABF61981.1| hypothetical protein TM1040_3851 [Ruegeria sp. TM1040]
          Length = 195

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 57/196 (29%), Gaps = 12/196 (6%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM----KKFILSD 75
           + RFI +LK   P A + +          + +  +       +    I        +   
Sbjct: 4   YSRFIAYLKVLLPTAALGLFSTVFFLWSPKFNEDNAIPYTHDEIIRRINHRQATTPLYLS 63

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +       + A+   T       +   ++    +         + L A  A F   +  
Sbjct: 64  TTAKGHNVRINAD--HTYLGEELSLPIAEEVTGQLDFIDGSI--VTLSADRAVFEEHSDL 119

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR-- 193
           +  S    +   + + L+ +    ++  +T  S  PV  + +   L +   RI       
Sbjct: 120 VNFSGNVVLNSTEGITLESDQLTTNIVALTAYSDVPVRASSALGELRSGNMRITTIHNSG 179

Query: 194 --SAVFAGQVSVVVNP 207
                F   V +   P
Sbjct: 180 HLKMFFGNGVKLTYVP 195


>gi|295690084|ref|YP_003593777.1| hypothetical protein Cseg_2710 [Caulobacter segnis ATCC 21756]
 gi|295431987|gb|ADG11159.1| protein of unknown function DUF1239 [Caulobacter segnis ATCC 21756]
          Length = 212

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 65/177 (36%), Gaps = 4/177 (2%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERA 90
                + I G  +  +  R    SK         P+++ K   +   KD   + + A+RA
Sbjct: 38  LAVFAIIIGGAVVGQASWRSLASSKLQ-TQASTTPLLLDKPRFTGVLKDGRPFLITADRA 96

Query: 91  KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL 150
           +      + ++ L     T+     +       A S  +  A  TL ++Q  K+   +  
Sbjct: 97  ERDSE-DEDLVRLSAP--TLVRGYGQPDASQATAKSGVYREAARTLLLTQDVKITNGEGY 153

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
             D   A++D++   ++    V  +  +    AN   +++     +  G+V   + P
Sbjct: 154 EFDAPRALIDMRTGEVSGDAGVAGSGPNASTRANAYSVKDKGDRVILNGRVRTRLEP 210


>gi|167648910|ref|YP_001686573.1| hypothetical protein Caul_4955 [Caulobacter sp. K31]
 gi|167351340|gb|ABZ74075.1| protein of unknown function DUF1239 [Caulobacter sp. K31]
          Length = 212

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 47/178 (26%), Gaps = 4/178 (2%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
              P A + I+         R  T             + M        S D   + + A 
Sbjct: 30  IVLPVAMIGILVAVGGQVVWRTVTAGDRR-PTESKAQIRMITPRFYGQSSDGRPFIITAR 88

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A     +    +FL    LT+             A    +      L +    +M    
Sbjct: 89  SAVRD-EADLKRVFLDAPTLTLGV--GSPAPTRSTADRGIYREDTLKLQLFGNVRMDDGA 145

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             R     A++D +N        +        + +N   + +     +F G V   ++
Sbjct: 146 GYRFASNEAMVDTRNGNTTGETALQGEGPTGQVQSNAYSVYDKGDRIIFRGGVKTRID 203


>gi|209542517|ref|YP_002274746.1| hypothetical protein Gdia_0335 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530194|gb|ACI50131.1| protein of unknown function DUF1239 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 269

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 72/213 (33%), Gaps = 9/213 (4%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVG----WFLLSSWIRISTFSKS 56
           + H   R + L       +    +++ K+  P A + ++G    W  +   +     +  
Sbjct: 34  LHHRTTRARHLPNPDDIARRRMLVRWAKWVLPAAALALLGSIAAWPAIDRLVNAQRNALH 93

Query: 57  SIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSE 116
            ++ L  E   M              Y + A++A+         I L        TQ ++
Sbjct: 94  EMENLRIESGNMLGATYRGLDDHNRPYMITADQAQQ---VTPDRINLTGPVADTFTQGND 150

Query: 117 YGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITH 176
           +  + + +    +      L +++   +   D + +   TA +D+K   + S   V    
Sbjct: 151 W--LTIRSDQGVYMQHEQLLDLTRNVVLYRADGVIMTGVTADMDLKQGIVASDQWVHAEG 208

Query: 177 SDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
              VL A    +       +F G   +++N   
Sbjct: 209 PFGVLDAQGFILSQHEGIGLFRGPGRLILNDDS 241


>gi|162147900|ref|YP_001602361.1| hypothetical protein GDI_2116 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786477|emb|CAP56059.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 269

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 72/213 (33%), Gaps = 9/213 (4%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVG----WFLLSSWIRISTFSKS 56
           + H   R + L       +    +++ K+  P A + ++G    W  +   +     +  
Sbjct: 34  LHHRTTRARHLPNPDDIARRRMLVRWAKWVLPAAALALLGSIAAWPAIDRLVNAQRNALH 93

Query: 57  SIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSE 116
            ++ L  E   M              Y + A++A+         I L        TQ ++
Sbjct: 94  EMENLRIESGNMLGATYRGLDDHNRPYMITADQAQQ---VTPDRINLTGPVADTFTQGND 150

Query: 117 YGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITH 176
           +  + + +    +      L +++   +   D + +   TA +D+K   + S   V    
Sbjct: 151 W--LTIRSDQGVYMQHEQLLDLTRNVVLYRADGVIMTGVTADMDLKQGIVASDQWVHAEG 208

Query: 177 SDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
              VL A    +       +F G   +++N   
Sbjct: 209 PFGVLDAQGFILSQHEGIGLFRGPGRLILNDDS 241


>gi|99079867|ref|YP_612021.1| hypothetical protein TM1040_0026 [Ruegeria sp. TM1040]
 gi|99036147|gb|ABF62759.1| hypothetical protein TM1040_0026 [Ruegeria sp. TM1040]
          Length = 199

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 61/201 (30%), Gaps = 11/201 (5%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSS---WIRISTFSKSSIDLLDFEPMIMKKFILSD 75
           ++ R + +LK   P   + ++    L S       S                +     + 
Sbjct: 3   RYSRVVSYLKVALPLTALALLSTLFLISHNINTDPSIPFAEIELENRLRGQQVTAPFFTG 62

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +    + ++ A +A              D E  + T       + L +           
Sbjct: 63  TTATGQEITIAATKALP--GGDGEGASASDLEAEILTTEG--RRILLLSDRGSIRPDQDL 118

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS- 194
             +    ++   D  R++ E    ++  + + S  PV         SA   RI   S++ 
Sbjct: 119 AVLVGNVRIITADGTRVESERLNAELSGLQVVSPGPVTAQGPMGDFSAGTMRIFTDSKNA 178

Query: 195 ---AVFAGQVSVVVNPGVLQK 212
                F   V +V +P  +++
Sbjct: 179 PVHIEFTEGVKLVYDPAKIER 199


>gi|260429091|ref|ZP_05783068.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419714|gb|EEX12967.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 202

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 66/200 (33%), Gaps = 10/200 (5%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIST---FSKSSIDLLDFEPMIMKKFI 72
           +   + +FI +LK   P A +T++    L   +             D  D     +    
Sbjct: 4   RGDTYSKFIGWLKLLLPLAALTLLSTMFLLPRVSEPVNKLPFVEGEDPGDATRQQIVAPN 63

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            +  +    + ++ A+RA+    +    +     +  +         + L A  A  +  
Sbjct: 64  FAGTTDKGDRITMTADRAEP-LAADMARLRAHQLDAALDLVDG--SRITLRADQAVVDDT 120

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI--EN 190
           + T  +     +       +D E  ++ +  I   +  PV  +      +A    I  + 
Sbjct: 121 DKTADLEGGVHITSSTGYVIDTERMLISLDRIGAETLTPVSGSGPAGRFTAGKLTIAADE 180

Query: 191 SSR--SAVFAGQVSVVVNPG 208
           +      +F   V+++ +P 
Sbjct: 181 NGENVQLLFTEGVNLIYDPK 200


>gi|295691423|ref|YP_003595116.1| hypothetical protein Cseg_4087 [Caulobacter segnis ATCC 21756]
 gi|295433326|gb|ADG12498.1| protein of unknown function DUF1239 [Caulobacter segnis ATCC 21756]
          Length = 206

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/178 (12%), Positives = 52/178 (29%), Gaps = 4/178 (2%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
              P A   ++   +     R    +           + +        S D   + + A 
Sbjct: 31  IVLPIAIGALLLVVISQVGWRTYMAATHPPTEAK-TEIRLITPRFYGQSTDGRSFMITAR 89

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A    ++    I L +  LT+           + A S  +   +  L +    ++    
Sbjct: 90  SAIRD-DADPRRILLDEPALTLDL--GSPTPTRMTAKSGVYRQDDFGLSLKDDVRLDDGT 146

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             R   E + +D +   +NS   +        + ++   + +     VF G V   + 
Sbjct: 147 GYRFASEESFVDTRTGDVNSESALNGEGPSGQVQSSGYSVYDKGDRIVFRGGVRARLE 204


>gi|84500656|ref|ZP_00998905.1| hypothetical protein OB2597_11876 [Oceanicola batsensis HTCC2597]
 gi|84391609|gb|EAQ03941.1| hypothetical protein OB2597_11876 [Oceanicola batsensis HTCC2597]
          Length = 202

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/197 (14%), Positives = 62/197 (31%), Gaps = 10/197 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFSKSSIDLLDFEPMIMKKFILSDY 76
           + R + +LK   P A + ++    L S     ++           D     + K   S  
Sbjct: 8   YSRLVNWLKILLPLAALALLSTVFLLSETQEAQMELPYADVEAGGDGLAERVLKPSFSGA 67

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           ++     + VAE A     +G G +  ++F+  +       GD+   +  A  +    T 
Sbjct: 68  TERGDLIAFVAESA-RPVGTGLGALSAENFQGRIDLVSG--GDITFRSDEALLDQPEGTA 124

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--- 193
            ++    +       ++       + ++   SS  +          A    +   +    
Sbjct: 125 ELAGSVVVVSSTGYTVETAGLTAWLNDVRAESSGEIRGEGPPGRFVAGRMVVTGDADLSD 184

Query: 194 -SAVFAGQVSVVVNPGV 209
              VF   V +V  P  
Sbjct: 185 VQMVFTDGVKLVYEPES 201


>gi|16127832|ref|NP_422396.1| hypothetical protein CC_3602 [Caulobacter crescentus CB15]
 gi|221236652|ref|YP_002519089.1| hypothetical protein CCNA_03716 [Caulobacter crescentus NA1000]
 gi|13425348|gb|AAK25564.1| hypothetical protein CC_3602 [Caulobacter crescentus CB15]
 gi|220965825|gb|ACL97181.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 220

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 50/178 (28%), Gaps = 4/178 (2%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
              P A   ++   +     R    +  +        + +        S D   + + A 
Sbjct: 45  LVLPAAIGVLLLAVIAQVGWRTYLAASRAPAEAR-TEIRLITPRFYGQSTDGRSFMITAR 103

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A    +     I L++  LT+           + A    +      L +    ++   +
Sbjct: 104 SAIRD-DVDPRRIILEEPALTLDL--GSPTPTRMTAKHGVYRQDTFGLNLKDDVRLDDGE 160

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             R   E + +D +   ++    +        + ++   + +     VF G V     
Sbjct: 161 GYRFASEESFVDTRTGDVSGESTMNGEGPSGQVQSSAYSVYDKGDRIVFRGGVRARFE 218


>gi|319403503|emb|CBI77082.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 154

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 3/148 (2%)

Query: 59  DLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYG 118
           +  +   + M    L  Y+     Y + AE+A     S  GII L++    VPT+    G
Sbjct: 6   EEEEIAQLTMLNPRLEGYTNFHKPYWIKAEKAFQDRKS-SGIIGLKNITAEVPTK--GQG 62

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
            +++ A    ++     L  ++PF +  KD +   F  A +D+     N+  PV I  ++
Sbjct: 63  QIFIDAQGGVYDNIKSHLQFNEPFTVTTKDGIIAKFIAANIDLSKSQFNTDQPVNIQSAN 122

Query: 179 FVLSANFARIENSSRSAVFAGQVSVVVN 206
           F L AN  ++    +   F   V +V++
Sbjct: 123 FHLIANALQVCEKEQVMYFQKGVRIVLD 150


>gi|330993407|ref|ZP_08317342.1| hypothetical protein SXCC_03305 [Gluconacetobacter sp. SXCC-1]
 gi|329759437|gb|EGG75946.1| hypothetical protein SXCC_03305 [Gluconacetobacter sp. SXCC-1]
          Length = 245

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 67/204 (32%), Gaps = 9/204 (4%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFPFAT----VTIVGWFLLSSWIRISTFSKSSIDLLD 62
           R ++L   +   +    ++  K+  P        +I  W  +   + + T + + +  + 
Sbjct: 41  RRRLLPNAADLARRQTIMRSAKWMLPLLALVLLGSIAAWPAVQRAVIMHTGTMAQMSHVR 100

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
            +   M         +    Y + A+ A+         I L +           +  +Y+
Sbjct: 101 VKSGSMLNPTYRGLDEHGRPYMITADEARQIS---SERIDLTNAAADTLMDNGNW--LYV 155

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A    +      L ++    +   D   +   TA +D+++  I +   +       V+ 
Sbjct: 156 TASEGVYIQHAQMLDLTHAVTLYRNDGTLMLTPTADIDMRHNIIVTDSWIHGEGPMGVMD 215

Query: 183 ANFARIENSSRSAVFAGQVSVVVN 206
                ++      +F G   +++N
Sbjct: 216 VQGGMLDIHGGVMLFRGPGRMILN 239


>gi|89067362|ref|ZP_01154875.1| hypothetical protein OG2516_10996 [Oceanicola granulosus HTCC2516]
 gi|89046931|gb|EAR52985.1| hypothetical protein OG2516_10996 [Oceanicola granulosus HTCC2516]
          Length = 200

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 66/204 (32%), Gaps = 13/204 (6%)

Query: 17  YRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILS 74
              H  ++   K   P   + ++    L +        +     ++       +     S
Sbjct: 2   ADHHSTYVALAKTILPLLALALLSTMFLFARAPTIESVEIPYADIEELAREQQISAPSFS 61

Query: 75  DYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
             + D   +SL+AE A+        ++ L     T+         + L A   R + A  
Sbjct: 62  GVTDDGSIFSLMAESARP--VDDGDVVDLAAIRGTLDAPGG--ATILLRAGEGRVDTAGR 117

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI---ENS 191
           T  +S   +++  D   ++      D+    I +   +        L+A    +   +  
Sbjct: 118 TARLSGLTRIETSDGYEVETNGVFADLDAGRIETDGALEAHAPYGELTAGRLVVETPDGG 177

Query: 192 SRSAVFAGQVSVVVNPGVLQKKEN 215
           S+   F   V +V      +++++
Sbjct: 178 SQLLNFQDGVRLVYR----RQQQD 197


>gi|294084812|ref|YP_003551572.1| hypothetical protein SAR116_1245 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664387|gb|ADE39488.1| hypothetical protein SAR116_1245 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 220

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 66/172 (38%), Gaps = 4/172 (2%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN 95
              VGW  L +       S ++I++ D     +        +K    Y + A  A     
Sbjct: 46  AAAVGWLGLYTKTSDVRVSIANIEVADDGGTQLTGARYKGTTKTGKTYEINATNAVEQN- 104

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-VKDNLRLDF 154
           +G GII L +    +       G + + A +  F+  ++ + ++    +K  K N+ +  
Sbjct: 105 NGSGIIQLSEPTGFITQSDG--GRINISALNGAFSQTDNLVDLTGMVVLKQTKQNVIMTT 162

Query: 155 ETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           E    ++    + S  PV +   D  ++    R+ +     +F G   +V++
Sbjct: 163 EALSANIDAGEMQSDLPVEVVSPDAHITGQNIRVTDHGNVMMFGGTSKMVLH 214


>gi|119713542|gb|ABL97594.1| hypothetical protein MBMO_EB0-39F01.0005 [uncultured marine
           bacterium EB0_39F01]
 gi|161170292|gb|ABX59262.1| putative protein [uncultured marine bacterium EB000_55B11]
 gi|297183820|gb|ADI19943.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 189

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 22/191 (11%), Positives = 54/191 (28%), Gaps = 14/191 (7%)

Query: 32  PFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE---PMIMKKFILSDYSKDRVKYSLVAE 88
           P   V ++    +            SID           +     S  +     + L A 
Sbjct: 2   PVIAVLLLASVFIFGKEDALRSGTISIDADTINLTTDQKITNPQFSGLTNLGDSFILKAI 61

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A     S    I L    L     +       + + +   N    +  ++    + + +
Sbjct: 62  EAMPDSPS-PEKIDLIGPSLEFDALQGVG--FKISSKNGSVNFIKQSAELNGNVYIDMTN 118

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR--------SAVFAGQ 200
             +   E   L++K   + + + V  +     + A    +             +  F+  
Sbjct: 119 GYKAISEKIQLNLKLGNLIAPNSVEASGPYGKIIAGSMELFKDFDNKTSQVSGNLNFSDG 178

Query: 201 VSVVVNPGVLQ 211
           V+++  P  ++
Sbjct: 179 VTLIYLPSTVK 189


>gi|241760850|ref|ZP_04758939.1| protein of unknown function DUF1239 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753180|ref|YP_003226073.1| hypothetical protein Za10_0943 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|241374469|gb|EER63930.1| protein of unknown function DUF1239 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552543|gb|ACV75489.1| protein of unknown function DUF1239 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 212

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 62/178 (34%), Gaps = 7/178 (3%)

Query: 32  PFATVTIVGWFL---LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
           P A + +V       L     +S            E M +KK I   +      + L AE
Sbjct: 34  PVAIIIVVAMMAITPLIGRRDLSFMLSRDHISTSKERMNLKKAIYRGHDDHGRVFELKAE 93

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A    +S   + +L D    +           + A   R+N+ N+ L I    ++ + +
Sbjct: 94  SATQPDSSDPQL-WLTDLVAEITLDSG---PATVTAPHGRYNMDNNILTIDGAAQLVMAN 149

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             R++ +  VLD+    I S  PV     +         ++  +  AV  G+     +
Sbjct: 150 GYRVNGQDVVLDLDKRLITSQRPVSGQSPNGHFQGQSLNVDLINGKAVMDGRTHTHFD 207


>gi|56551173|ref|YP_162012.1| hypothetical protein ZMO0277 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56542747|gb|AAV88901.1| protein of unknown function DUF1239 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 212

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 62/178 (34%), Gaps = 7/178 (3%)

Query: 32  PFATVTIVGWFLLSS---WIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
           P A + +V    ++       +S            E M +KK I   +      + L AE
Sbjct: 34  PVAIIIVVAMMAITPLIGRRDLSFMLSRDHISTSKERMNLKKAIYRGHDDHGRVFELKAE 93

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A    +S   + +L D    +           + A   R+N+ N+ L I    ++ + +
Sbjct: 94  SATQPDSSDPQL-WLTDLVAEITLDSG---PATVTAPHGRYNMDNNILTIDGAAQLVMAN 149

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
              ++ +  VLD+    I S  PV     +         ++  +  AV  G+     +
Sbjct: 150 GYHVNGQDVVLDLDKRLITSQRPVSGQSPNGHFQGQSLNVDLINGKAVMDGRTHTHFD 207


>gi|86136833|ref|ZP_01055411.1| hypothetical protein MED193_14202 [Roseobacter sp. MED193]
 gi|85826157|gb|EAQ46354.1| hypothetical protein MED193_14202 [Roseobacter sp. MED193]
          Length = 193

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/196 (11%), Positives = 55/196 (28%), Gaps = 12/196 (6%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSD 75
           Q+ R + +LK F P A + ++    L S      +                 +     S 
Sbjct: 3   QYSRMVSYLKVFLPLAALALLSTLFLISPSSDNEVVIPFADREIEERLRGQQVTAPFFSG 62

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +    +  + A+ A+    S    +     +  +         + L +     +     
Sbjct: 63  STLQGDEIWVTADVAR---ASNDQPVIASALKAEIRMVTGGQ--ITLTSDRGTVHPDQDL 117

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS--- 192
                  ++   + + +  E     +  +   S   +        L+A    I + +   
Sbjct: 118 ARFVGNVEITTTEGMVVTTEVLKTQLSAVHAESPGAIRAKGDLGELTAGHMEISSETVGG 177

Query: 193 -RSAVFAGQVSVVVNP 207
               +F   V +V  P
Sbjct: 178 PVHLLFTNDVKLVYAP 193


>gi|126738422|ref|ZP_01754127.1| hypothetical protein RSK20926_08157 [Roseobacter sp. SK209-2-6]
 gi|126720221|gb|EBA16927.1| hypothetical protein RSK20926_08157 [Roseobacter sp. SK209-2-6]
          Length = 192

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 21/179 (11%), Positives = 47/179 (26%), Gaps = 12/179 (6%)

Query: 40  GWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNS 96
               L S            +           +     S  +    + S+ A  A+     
Sbjct: 18  STVFLISRGAETDAVIPFAAQEIEERMRGQQVTGPFFSGTTAHGDEISVTATVARADAEV 77

Query: 97  GKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFET 156
               +   D    +       G + L +     +   +        ++   D L +  E 
Sbjct: 78  ---PLLATDLRAEIRMAAG--GRLALISDRGTVHPDQNLARFIGNVEITTADGLLVRTEA 132

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR----SAVFAGQVSVVVNPGVLQ 211
              ++  +   S   +  T     L+A    I   +     + +F   V +V +P   +
Sbjct: 133 LKTNLSTLQGESPGTINATGPLGELTAGRMEISAETEGGPLTLLFTNHVKLVYDPQNPK 191


>gi|84514852|ref|ZP_01002215.1| hypothetical protein SKA53_11548 [Loktanella vestfoldensis SKA53]
 gi|84511011|gb|EAQ07465.1| hypothetical protein SKA53_11548 [Loktanella vestfoldensis SKA53]
          Length = 199

 Score = 95.2 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 21/196 (10%), Positives = 53/196 (27%), Gaps = 12/196 (6%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSW---IRISTFSKSSIDLLDFEPMIMKKFILSDY 76
           + +++ + K   P   + ++    L +              IDL   E +       S  
Sbjct: 8   YSQWVGWAKILLPLCGLALLSMLFLFARGPNDGTKIPLAQVIDLARDEKL--SAPEFSGL 65

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +       + A  A            +    + +         +Y+   +   +      
Sbjct: 66  TDTGAVVVISARSA-RPLPDRPDTATIDTLRMQMDNPGG--STLYVTGVTGEIDGRARIA 122

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN----FARIENSS 192
             S   +++      ++     + +   T  S   + I      L+A          N+ 
Sbjct: 123 RFSGLVRLQTSTGYTMETGGLTVTLDTGTAISDGSLEIRAPMGNLTAGQVTFQFDTSNTG 182

Query: 193 RSAVFAGQVSVVVNPG 208
              +F   V ++  P 
Sbjct: 183 HQMLFTDGVRLIYTPQ 198


>gi|302343388|ref|YP_003807917.1| hypothetical protein Deba_1958 [Desulfarculus baarsii DSM 2075]
 gi|301640001|gb|ADK85323.1| protein of unknown function DUF1239 [Desulfarculus baarsii DSM
           2075]
          Length = 264

 Score = 94.8 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/214 (14%), Positives = 69/214 (32%), Gaps = 10/214 (4%)

Query: 1   MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60
           +    +R +    +   R+    ++  +         I+    ++ ++          D 
Sbjct: 44  LATAHKRQQSSAGKRLDRRRTTILRRSQLIIIATLSAIILGVAVAVFVHEPARLPVFDDE 103

Query: 61  LDFEPMIMKK-FILSDYS----KDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQR 114
                +       +   +    ++   K+SL A  AK +  +      L D  L    + 
Sbjct: 104 GGSPLLAADGQPRMRGVTYTHVENGVRKWSLTASGAKQNPEAES--FTLADVRLEFFPKG 161

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
                + +  ++ R+     T+ +         D +RL  +    +  + T+++  PV I
Sbjct: 162 GGK--VTIRGNTGRYERGKRTIMLEGDVVATTHDGIRLVTDNLAYNDVDQTVDTDAPVHI 219

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           +  DF L A   R+       VF   V     P 
Sbjct: 220 SGVDFDLKAKGMRVFVPQDKVVFKKDVVSNFIPS 253


>gi|189425228|ref|YP_001952405.1| hypothetical protein Glov_2169 [Geobacter lovleyi SZ]
 gi|189421487|gb|ACD95885.1| protein of unknown function DUF1239 [Geobacter lovleyi SZ]
          Length = 193

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 61/187 (32%), Gaps = 4/187 (2%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            R I+ +           +   +L    R +    +S  +     M + +   S+   + 
Sbjct: 6   TRRIRQVLAVVIVTASVALVAAILFRQFRSTPPETASKPISPEIDMSITRLNFSEMRGND 65

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             + L AERA   ++   G   L   +  +     + G + + + +  +    H + + +
Sbjct: 66  KLWDLTAERA--DYDKETGTAKLAGVKTEIF--GGKAGGLIITSEAGSYLEEKHLVTMQK 121

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
             +   +  +    E          + S+ PV +      L+A    +      A F G 
Sbjct: 122 NVRAVTRKGMTFTTEQLEYRSVPGLVVSNHPVKVVDGRLTLTAQGMEMSLHDEKARFHGS 181

Query: 201 VSVVVNP 207
           V  VV  
Sbjct: 182 VEAVVEG 188


>gi|91205590|ref|YP_537945.1| hypothetical protein RBE_0775 [Rickettsia bellii RML369-C]
 gi|157827304|ref|YP_001496368.1| hypothetical protein A1I_04990 [Rickettsia bellii OSU 85-389]
 gi|91069134|gb|ABE04856.1| unknown [Rickettsia bellii RML369-C]
 gi|157802608|gb|ABV79331.1| hypothetical protein A1I_04990 [Rickettsia bellii OSU 85-389]
          Length = 197

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE-----PMIMK 69
           S Y++  +F +F  F      +      + SS+      +       +        +I+K
Sbjct: 3   SSYKRRKKFWKFTYFLIILGILYAGYILVKSSYPTEENNTNIVEKAPEKNLDLKYNIILK 62

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
             +     K+   Y + AE+A    ++   +  +           ++   + ++A     
Sbjct: 63  DSVFEGVDKNLNSYLVKAEQAIKDSDNKYKLDIINGI-----YNVNKNQSVTVYAKEGFL 117

Query: 130 NLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
           N  +H L +    K    +++  D   A +D+ N +I S  P  + H +  ++++    +
Sbjct: 118 NEESHILDLKNDVKF-YFEDMIFDTNDARIDLINKSIISDSPATLFHKNSTITSDSFNTQ 176

Query: 190 NSSRSAVFAGQVSVVVN 206
           + +   +F G V   ++
Sbjct: 177 DDNNIIIFKGNVYTTID 193


>gi|259417681|ref|ZP_05741600.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259346587|gb|EEW58401.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 199

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 62/201 (30%), Gaps = 11/201 (5%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWI---RISTFSKSSIDLLDFEPMIMKKFILSD 75
           ++ R + +LK   P A + ++    L S       S                +     + 
Sbjct: 3   RYSRVVSYLKVALPLAALALLSTLFLISRTINTDPSIPFADFELENRLRGQQVTAPFFTG 62

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +    + ++ A +A              D E  + T       + + + S        +
Sbjct: 63  TTATGQEITIAATKALPGGGGE--GASASDLEAEILTTEGR--RILMLSDSGSIRPDQDS 118

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS- 194
             +    ++   D  R++ E     +  + + S   V         SA   RI   S++ 
Sbjct: 119 AILMGNVRILTPDGTRVETERLNAQLSGLEVISPGAVTAEGPMGDFSAGTMRIFTDSKNA 178

Query: 195 ---AVFAGQVSVVVNPGVLQK 212
                F   V +V +P  +++
Sbjct: 179 PVHIEFTEGVKLVYDPAKVER 199


>gi|118579407|ref|YP_900657.1| hypothetical protein Ppro_0971 [Pelobacter propionicus DSM 2379]
 gi|118502117|gb|ABK98599.1| conserved hypothetical protein [Pelobacter propionicus DSM 2379]
          Length = 188

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 23/185 (12%), Positives = 58/185 (31%), Gaps = 3/185 (1%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            R I+          V  +   +  +  + +     S        + ++    ++     
Sbjct: 4   SRNIRLALALLVVTAVIGIVAAIFLNGSKPAPSEPVSPQTPRNVDLALRDARFTEVRNGA 63

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             +++VAERA+  +     +  L    +    +    G++ + A    ++  +  + +  
Sbjct: 64  TVWTIVAERAE--YIKEGEVANLSGIRMLFVKRPGT-GNITVTAERGTYSTKSRNVTLRG 120

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
              M     +  D ET           ++D V        L+A    ++   +   F   
Sbjct: 121 TVHMTTDSGIVFDTETLDYHAATSRFVTNDSVTFRQQRMTLTARGMDLDVDGQVVRFHSA 180

Query: 201 VSVVV 205
           V  +V
Sbjct: 181 VDAIV 185


>gi|322418290|ref|YP_004197513.1| hypothetical protein GM18_0756 [Geobacter sp. M18]
 gi|320124677|gb|ADW12237.1| protein of unknown function DUF1239 [Geobacter sp. M18]
          Length = 206

 Score = 84.4 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 63/184 (34%), Gaps = 4/184 (2%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           +FL      A++ ++    L    +      S   L     + ++KF  ++  +   ++ 
Sbjct: 25  RFLGILAVAASLLVIATI-LFRMQQEVAPKLSVRKLPVQVDISLQKFHYTETKQGIKRWE 83

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L AERA   +N    I +L   +L +       GD+ + A  A ++     + +    + 
Sbjct: 84  LTAERA--DYNKKADISYLTGVKL-LVHGSGGAGDLQITAQRAEYHNGTRDIALIGNVRG 140

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           +                    + SS+ V +T    VL          +R       VS V
Sbjct: 141 QSNKGYGFSAPRVDYIAARSLLKSSERVRMTDIGSVLEGTGMEFYTQTRKFRLLKDVSAV 200

Query: 205 VNPG 208
            + G
Sbjct: 201 YSQG 204


>gi|158520526|ref|YP_001528396.1| hypothetical protein Dole_0509 [Desulfococcus oleovorans Hxd3]
 gi|158509352|gb|ABW66319.1| protein of unknown function DUF1239 [Desulfococcus oleovorans Hxd3]
          Length = 190

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 69/193 (35%), Gaps = 6/193 (3%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS 77
            ++ R I        FA +  V + L+ S   +S    ++        + M     +   
Sbjct: 1   MRYTRPISLFLMITVFAALGAVIYLLVQSRP-LSVPPAATEQADTGVDISMTGVSQTFVQ 59

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
           + R+ ++L A+ A  S  +       ++  LT   +        + A     +       
Sbjct: 60  EGRISHTLTADTA--SLLARDKKAVFENVTLTFLAEDGT--PSVVTAKQGELSTETGDAT 115

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S    ++     ++  +T   +     + S +PV++T   F  + N    + +S  AV 
Sbjct: 116 LSGGVVVE-NRARKIYAQTLHYNDNRHILYSVEPVVVTGDSFRFTGNSMTFDMTSGKAVL 174

Query: 198 AGQVSVVVNPGVL 210
           +G V+  +    L
Sbjct: 175 SGNVTGRITDDAL 187


>gi|159046127|ref|YP_001534921.1| hypothetical protein Dshi_3587 [Dinoroseobacter shibae DFL 12]
 gi|157913887|gb|ABV95320.1| hypothetical protein Dshi_3587 [Dinoroseobacter shibae DFL 12]
          Length = 200

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 61/197 (30%), Gaps = 10/197 (5%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIR---ISTFSKSSIDLLDFEPMIMKKFILSD 75
           ++ +F+   K   P   + ++    L S ++    +            E   + +     
Sbjct: 7   RYSQFVLAAKIVLPLLALGLLSSLFLLSGVQDGEQTIPFSDIELEEIVEGQRILRPRYQT 66

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
                      AE A+    +        +    +        D+         + A+ T
Sbjct: 67  VLDSGALARFTAESARPDIGN-PDRFMASEITGRILQNDGLQVDIR--GAEGVMDNASRT 123

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS---- 191
           + I    ++   D   L  E A + +      ++  VI+      LSA  AR++      
Sbjct: 124 VRIEGGLRLSRTDGYTLSTEGAEVRLDGQWGETTSDVIVLGPGLTLSAGRARMQPDAATG 183

Query: 192 SRSAVFAGQVSVVVNPG 208
           +R  VF   V +V  P 
Sbjct: 184 NREVVFTDGVKLVYTPQ 200


>gi|85859055|ref|YP_461257.1| hypothetical protein SYN_00948 [Syntrophus aciditrophicus SB]
 gi|85722146|gb|ABC77089.1| hypothetical membrane protein [Syntrophus aciditrophicus SB]
          Length = 198

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 52/177 (29%), Gaps = 5/177 (2%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAER 89
              FA ++IV   +          +   I     +  +M     ++ + + VK+ + A+ 
Sbjct: 27  VLCFAVLSIVSGVIYKVSGNRPQKTLLKIMDSTVDLQVM-NVHYTEATDEGVKWEIKADS 85

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
           A   +   + +   ++  + +           +  +    +  +  + IS    +   + 
Sbjct: 86  A--QYRKKENLAVFKNPCIKLIMPNGRV--YVMTGNEGFVHQDSKDMEISGNINLTSSNG 141

Query: 150 LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
                             +  PV + +S   + A    +            V  V+N
Sbjct: 142 DEFKTNHLSYSGIEKRCYTPAPVTMKNSRIQVDAKGMSLSLKDEQLTLLSGVRAVLN 198


>gi|218672975|ref|ZP_03522644.1| hypothetical protein RetlG_15795 [Rhizobium etli GR56]
          Length = 111

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 2/111 (1%)

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
           L+  +  VP        +   A +A +N A   L+++ PF + +   L   F++A LD+K
Sbjct: 1   LETIKAAVPMNDGLIARVV--ASTADYNRATDNLHMTAPFTLVLSSGLNAKFQSARLDIK 58

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
              + S DPV IT  +  + A    I +  R   F G V + V+P  + K+
Sbjct: 59  GGNMRSDDPVTITKDNASIVAKTLEITDKGRVITFEGNVRMNVDPSTIHKQ 109


>gi|157964550|ref|YP_001499374.1| hypothetical protein RMA_0667 [Rickettsia massiliae MTU5]
 gi|157844326|gb|ABV84827.1| hypothetical protein RMA_0667 [Rickettsia massiliae MTU5]
          Length = 198

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/199 (13%), Positives = 70/199 (35%), Gaps = 13/199 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MI 67
           S Y++  +  + +        + I    + S +I        +   L           +I
Sbjct: 3   SSYKRRKKIWKSVYLLITVGILYIGYILIKSGYINEENDINVTKKSLKDNKNFDLKYNII 62

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           +K  I    +K+   Y +  ERA    ++      L          + +   + + A   
Sbjct: 63  LKDSIFEGVNKNLNAYKIKTERAIKESDNK---YKLDIINAIYNVNQDQ--TLIINAKEG 117

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  ++ L +    K+     +  +   A +D+ N  I    P  + + +  ++++   
Sbjct: 118 FLDEESNILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFN 176

Query: 188 IENSSRSAVFAGQVSVVVN 206
            ++ +   +F G VS +++
Sbjct: 177 TKDENNIIIFKGNVSTIID 195


>gi|157825779|ref|YP_001493499.1| hypothetical protein A1C_03550 [Rickettsia akari str. Hartford]
 gi|157799737|gb|ABV74991.1| hypothetical protein A1C_03550 [Rickettsia akari str. Hartford]
          Length = 199

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/197 (13%), Positives = 68/197 (34%), Gaps = 13/197 (6%)

Query: 17  YRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MIMK 69
           Y++  +  + L          I    + S +I        + + L           +I+K
Sbjct: 5   YKRRKKIWKSLYLLIIVGIFYIGYILIKSGYINEENDINVTKNRLKDTKNFDFQYNIILK 64

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
             I    +K+   Y +  ERA    ++      L          + +     + A     
Sbjct: 65  DSIFEGVNKNLDAYKIKTERAIKESDNK---YKLDVINAIYNVNQDQ--TFIINAKEGFL 119

Query: 130 NLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
           +  ++ L +    K+     +  +   A +D+ N  I  +    + + +  ++++   I 
Sbjct: 120 DEGSNILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGNSSAKLFYKNSSITSDSFNIM 178

Query: 190 NSSRSAVFAGQVSVVVN 206
           + +   +F G VS +++
Sbjct: 179 DETNIIIFKGNVSTIID 195


>gi|120555623|ref|YP_959974.1| hypothetical protein Maqu_2712 [Marinobacter aquaeolei VT8]
 gi|120325472|gb|ABM19787.1| protein of unknown function DUF1239 [Marinobacter aquaeolei VT8]
          Length = 199

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 51/192 (26%), Gaps = 9/192 (4%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
           +  R +  L           + W         +  S       + +  ++       + +
Sbjct: 10  RGKRRVTALALAITVTATVFLLWQSDEPVSSRNAASDLR-GPAEPDGFVVGG-QYRAWDE 67

Query: 79  DRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
               +  L + R +    +  G   L      +           + ++       N  L 
Sbjct: 68  QGNLQIDLTSPRIEQFEET--GTAHLDTPRARLF-SEGSPEPWLIESNEGSLQQNNEKLE 124

Query: 138 ISQPFKMKVK---DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           +    ++  +       L+ E   LD  N T+ +  PV IT    V  +   +     R 
Sbjct: 125 LMGNVRLTRQSEGREAVLETEVLTLDNSNGTVYTDQPVSITEPFGVTRSTGMKAWIDERI 184

Query: 195 AVFAGQVSVVVN 206
                +V     
Sbjct: 185 LELNSRVEGQYE 196


>gi|222055370|ref|YP_002537732.1| protein of unknown function DUF1239 [Geobacter sp. FRC-32]
 gi|221564659|gb|ACM20631.1| protein of unknown function DUF1239 [Geobacter sp. FRC-32]
          Length = 191

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 61/184 (33%), Gaps = 3/184 (1%)

Query: 22  RFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           + I+ +           +   ++    +    ++    L D   M ++K   S+      
Sbjct: 5   KKIRLILAMAIVLAGVSLIATVMLKVEQRKPPAEKLDPLPDNVEMALQKVHYSEVKDGIK 64

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           K+ L A++A            L+   L +    +  GD+ L A  A +      + +S  
Sbjct: 65  KWDLFADQALFDMKK--EAFHLKGVRLVLV-AETRIGDITLTADGADYYSKTKDVELSGN 121

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
              K    +     TA     N  I + DPV  T     +S     ++ ++R       V
Sbjct: 122 VVAKSDTGMHFSSATARFVGANALIRTDDPVRFTDGRIEVSGVGMELKTTTRDLKIKKGV 181

Query: 202 SVVV 205
           +  +
Sbjct: 182 TADI 185


>gi|88704067|ref|ZP_01101782.1| membrane or secreted protein containing DUF1239 [Congregibacter
           litoralis KT71]
 gi|88701894|gb|EAQ98998.1| membrane or secreted protein containing DUF1239 [Congregibacter
           litoralis KT71]
          Length = 192

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 69/201 (34%), Gaps = 16/201 (7%)

Query: 14  RSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSS----WIRISTFSKSSIDLLDFEPMIMK 69
            +K R+ VR  + L      +   +V   L  S       ++    + +       + + 
Sbjct: 3   ATKGRRRVR--KRLSIPLLLSAALLVYTTLSPSPTLIKESVAPMVPARVPESYATQVAVD 60

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
            F +    +   +    A   +     G+GI+ L + +    +   E+      A   + 
Sbjct: 61  DFDVHGVRQGSTE----ALNLRRFP--GEGIVELDEPKRHNYSTDGEW---VANAREGQL 111

Query: 130 NLANHTLYISQPFKMKVK-DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
                 L ++   +++   +N++   E  ++++      S+  V I   D    A+   I
Sbjct: 112 REETEVLVLNGDVRLQYDVENVQFLTERMIINMPKQAARSTASVRIWQGDNETVADQIYI 171

Query: 189 ENSSRSAVFAGQVSVVVNPGV 209
              ++ A  +G V  V  P  
Sbjct: 172 NLRAQVASLSGAVRTVYVPQS 192


>gi|83647980|ref|YP_436415.1| hypothetical protein HCH_05317 [Hahella chejuensis KCTC 2396]
 gi|83636023|gb|ABC31990.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 192

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 61/192 (31%), Gaps = 13/192 (6%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS 77
           RQ+    ++L      A + ++          +  F +  +   + +  ++   + + Y+
Sbjct: 6   RQYS---KWLYAAL--AAILVIYLAAYQDEANVPFFEEEQLLKDEPDAFVI-NAVYTTYN 59

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
           K+     L +                      +   +      ++ +      +   TL 
Sbjct: 60  KEG---VLTSRLQSQLAKHYPDTDTGVLTRPNLEIFQQGEKSWHVESLEGELLIKQDTLK 116

Query: 138 ISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +    ++    +      +  +    + K+  I++  PV IT +   L+A     +   +
Sbjct: 117 LRGDVEVNGASDDGAPILMQTQALDYNNKSRFISTDQPVKITSNINQLTAVGMEADIDKK 176

Query: 194 SAVFAGQVSVVV 205
             V   QV+ V 
Sbjct: 177 LIVLLSQVTGVY 188


>gi|187922606|ref|YP_001894248.1| hypothetical protein Bphyt_0599 [Burkholderia phytofirmans PsJN]
 gi|187713800|gb|ACD15024.1| protein of unknown function DUF1239 [Burkholderia phytofirmans
           PsJN]
          Length = 202

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 51/189 (26%), Gaps = 12/189 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILSDYSKDRV-KYSLV 86
             P   +  +                  +              F +S+  +    +Y L 
Sbjct: 9   LIPLVAMAALAGITWWLLQATLPRQNEGVVRPKEHTPDYFADNFSVSELDQSGSTQYRLT 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-- 144
           A+           +  L   +  +   +     +     + + N     + +    ++  
Sbjct: 69  AQSLI--HYEDDELSDL--VKPAMRAFQPGKPIVTATGDTGKVNGDASIVDLYDNARIVR 124

Query: 145 ---KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D +   + V +  I +  PV +     V++A+     N +R     G V
Sbjct: 125 APGYGDPQMQADSQHFRVLVNDDVIETEKPVKLQRGMSVMTASGMNYNNVTRVMQLFGNV 184

Query: 202 SVVVNPGVL 210
              + P   
Sbjct: 185 KGNIAPSEA 193


>gi|91762368|ref|ZP_01264333.1| hypothetical protein PU1002_03846 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718170|gb|EAS84820.1| hypothetical protein PU1002_03846 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 194

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/173 (12%), Positives = 58/173 (33%), Gaps = 10/173 (5%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSI------DLLDFEPMIMKKFILSDYSKDR 80
           L+       + I  WF L  +       K +       +  +     +            
Sbjct: 7   LQAIMVLVIIFISLWFYLKYFTENFEDVKETQVREKIDENQNSNSTYIDDINYVSTDAKG 66

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
            KY + A++A+    +   ++FL D    +  + S+   + + ++  ++N  N+    S+
Sbjct: 67  NKYQITAKQAEIKIEN-PDLMFLSDVVAFIFIKDSD--TVKITSNFGKYNSKNYDTIFSE 123

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
              +      ++  E       +     ++ V+       L A+   +  +++
Sbjct: 124 NVIVIY-PRHKISGEYLDFSFLSNLGTFTENVVYAGEKTNLYADKIEMNLTTK 175


>gi|157828534|ref|YP_001494776.1| hypothetical protein A1G_03755 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933250|ref|YP_001650039.1| hypothetical protein RrIowa_0790 [Rickettsia rickettsii str. Iowa]
 gi|157801015|gb|ABV76268.1| hypothetical protein A1G_03755 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908337|gb|ABY72633.1| hypothetical protein RrIowa_0790 [Rickettsia rickettsii str. Iowa]
          Length = 198

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 69/199 (34%), Gaps = 13/199 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MI 67
           S Y++  +  + +        + I    + S +I        +   L           +I
Sbjct: 3   SSYKRRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKKFDLKYNII 62

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           +K  I    SK+   Y +  ERA    N+      L          + +   + + A   
Sbjct: 63  LKDSIFEGVSKNLNAYKIKTERAIKESNNK---YKLDIINAIYNVNQDQ--TLIINAKEG 117

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  +  L +    K+     +  +   A +D+ N  I    P  + + +  ++++   
Sbjct: 118 FLDEESSILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGHSPATLLYKNSSITSDSFN 176

Query: 188 IENSSRSAVFAGQVSVVVN 206
            ++ +   +F G VS +++
Sbjct: 177 TKDENNIIIFKGNVSTIID 195


>gi|67459111|ref|YP_246735.1| hypothetical protein RF_0719 [Rickettsia felis URRWXCal2]
 gi|67004644|gb|AAY61570.1| unknown [Rickettsia felis URRWXCal2]
          Length = 199

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 27/199 (13%), Positives = 70/199 (35%), Gaps = 13/199 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MI 67
           S Y++  +  + + F      + I    + S +I        +   L           +I
Sbjct: 3   SSYKRRKKIWKSVYFLIIVGILYIGYILIKSGYINEENDINVTKKSLKDTKNFDLKYNII 62

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           +K  I    +K+   Y +  ERA    ++      L          + +   + + A   
Sbjct: 63  LKDSIFEGENKNLNAYKIKTERAIKESDNK---YKLDIINAIYNVNQDQ--TLIINAKEG 117

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  ++ L +    K+     +  +   A +D+ N  I  +    + + +  ++++   
Sbjct: 118 FLDEESNILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGNSSAKLLYKNSSITSDSFN 176

Query: 188 IENSSRSAVFAGQVSVVVN 206
             + +   +F G VS +++
Sbjct: 177 TRDENNIIIFKGNVSTIID 195


>gi|296161543|ref|ZP_06844348.1| protein of unknown function DUF1239 [Burkholderia sp. Ch1-1]
 gi|295888187|gb|EFG68000.1| protein of unknown function DUF1239 [Burkholderia sp. Ch1-1]
          Length = 202

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 51/189 (26%), Gaps = 12/189 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILSDYSKDRV-KYSLV 86
             P   +  +                  +              F +S+  +    +Y L 
Sbjct: 9   LIPLVAMAALAGITWWLLQATLPRQNEGVVRPKEHTPDYFADNFSISELDQSGSTQYRLT 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-- 144
           A+           +  L   +  +   +     +     + + N     + +    ++  
Sbjct: 69  AQSLI--HYEDDELSDL--VKPAMRAFQPGKPIVTATGDTGKVNGDASIVDLYDNARILR 124

Query: 145 ---KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D +   + V +  I +  PV +     V++A+     N +R     G V
Sbjct: 125 APGYGDPQMQADSQHFRVLVNDDVIETEKPVKLQRGMSVMTASGMNYNNVTRVMQLFGNV 184

Query: 202 SVVVNPGVL 210
              + P   
Sbjct: 185 KGSIAPSEA 193


>gi|171056875|ref|YP_001789224.1| hypothetical protein Lcho_0184 [Leptothrix cholodnii SP-6]
 gi|170774320|gb|ACB32459.1| protein of unknown function DUF1239 [Leptothrix cholodnii SP-6]
          Length = 231

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/216 (13%), Positives = 58/216 (26%), Gaps = 15/216 (6%)

Query: 5   DRRNKILLQRSKYRQHVRFIQFLKFF-FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF 63
           D  N+ L  R++ R        LK+       V  V    L     +             
Sbjct: 22  DAANRPLPWRARLRA-----GLLKYLSVLLMAVVAVATGWLVRQTPVIEPDAGVAAPTAE 76

Query: 64  EPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123
               M+ F +  Y+       ++       F     ++ +    +       +   +   
Sbjct: 77  PDYEMRGFSIQHYTAAGPAQGVIEGDVVRHFPVTDQLV-IDGVRVQWTDPGGQ--AIRAS 133

Query: 124 AHSARFNLANHTLYISQPFKMKVKDN------LRLDFETAVLDVKNITINSSDPVIITHS 177
           A  A        + +    ++                +  V D +N  + S  PV +   
Sbjct: 134 AARAVAEGDGSLVRLEGGARVVRDPAPGETSPFEFISDVLVFDTRNGQVRSDRPVRLRQG 193

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           D +  A     ++  R     G V   + P  L + 
Sbjct: 194 DNIFDAASIIYDHPQRVVTLGGGVQGRILPTELSRS 229


>gi|238650254|ref|YP_002916105.1| hypothetical protein RPR_00290 [Rickettsia peacockii str. Rustic]
 gi|238624352|gb|ACR47058.1| hypothetical protein RPR_00290 [Rickettsia peacockii str. Rustic]
          Length = 198

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/199 (14%), Positives = 69/199 (34%), Gaps = 13/199 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MI 67
           S Y++  +  + +        + I    + S +I        +   L           +I
Sbjct: 3   SSYKRRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYNII 62

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           +K  I    SK+   Y +  ERA    N+   +  +            +   + + A   
Sbjct: 63  LKDSIFEGVSKNLNAYKIKTERAIKESNNKYKLDIINAI-----YNVHQDQTLIINAKEG 117

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  +  L +    K+     +  +   A +D+ N  I    P  + + +  ++++   
Sbjct: 118 FLDEESSILDLKNDVKLFFD-KIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFN 176

Query: 188 IENSSRSAVFAGQVSVVVN 206
            ++ +   +F G VS +++
Sbjct: 177 TKDENNIIIFKGNVSTIID 195


>gi|91781727|ref|YP_556933.1| hypothetical protein Bxe_A4119 [Burkholderia xenovorans LB400]
 gi|91685681|gb|ABE28881.1| Putative exported protein [Burkholderia xenovorans LB400]
          Length = 202

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/188 (10%), Positives = 51/188 (27%), Gaps = 12/188 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILSDYSKDRV-KYSLV 86
             P   +  +                  +              F +S+  +    +Y L 
Sbjct: 9   LIPLVAMAALAGITWWLLQATLPRQNEGVVRPKEHTPDYFADNFSISELDQSGSTQYRLT 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-- 144
           A+           +  L   +  +   +     +     + + N     + +    ++  
Sbjct: 69  AQSLI--HYEDDELSDL--VKPAMRAFQPGKPIVTATGDTGKVNGDASIVDLYDNARILR 124

Query: 145 ---KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D +   + V +  I +  PV +     V++A+     N +R     G V
Sbjct: 125 APGYGDPQMQADSQHFRVLVNDDVIETEKPVKLQRGMSVMTASGMNYNNVTRVMQLFGNV 184

Query: 202 SVVVNPGV 209
              + P  
Sbjct: 185 KGSIAPSE 192


>gi|71083202|ref|YP_265921.1| hypothetical protein SAR11_0496 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062315|gb|AAZ21318.1| unknown protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 194

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 21/173 (12%), Positives = 59/173 (34%), Gaps = 10/173 (5%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSI------DLLDFEPMIMKKFILSDYSKDR 80
           L+       + I  WF L  +       K +       +  +     +            
Sbjct: 7   LQVVMVLIIILISLWFYLKYFTENFEDVKETQVKEKIDENQNSNSTYIDDINYVSTDVKG 66

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
            KY + A++A+    +   ++FL+D    +  + S+   + + ++  ++N  N+    S+
Sbjct: 67  NKYQITAKQAEIKVEN-SDVMFLRDVVAFIFIKDSD--TVKITSNFGKYNSKNYDTIFSE 123

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
              +      ++  E       +     ++ V+       L A+   +  +++
Sbjct: 124 NVIVIY-PRHKISGEYLDFSFLSNLGTFTENVVYAGEKTNLYADKIEMNLTTK 175


>gi|308535200|ref|YP_002137685.2| hypothetical protein Gbem_0866 [Geobacter bemidjiensis Bem]
 gi|308052545|gb|ACH37889.2| protein of unknown function DUF1239 [Geobacter bemidjiensis Bem]
          Length = 191

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 64/188 (34%), Gaps = 6/188 (3%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE---PMIMKKFILSDYSKDRVKY 83
           +K F     +      + +  +R+       + +        + ++KF  ++  +   ++
Sbjct: 7   IKRFLGLVAIVASLLVVGTILLRMDHGMVPKLPVRKLPLQVDISLQKFHYTETKQGVKRW 66

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            L AE+A+  +N  K +  L    LTV    +++GD+ + A  A ++     + +S    
Sbjct: 67  DLAAEKAE--YNKKKDLTSLATVRLTVAGA-AKFGDLVITADRALYHNGTRDVVLSGNVT 123

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                 LR              + S + V  +     L       +  +R       VS 
Sbjct: 124 GVSSKGLRFSASNLSYLASRSLLVSEERVRFSDGGNELEGVGMEFQTQTRRFKLKKDVSA 183

Query: 204 VVNPGVLQ 211
           V      +
Sbjct: 184 VFRQQEAR 191


>gi|289664524|ref|ZP_06486105.1| hypothetical protein XcampvN_15998 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 191

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 43/183 (23%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             +         S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VALFAAAAISGWSAWKQRARPAAAAVQESGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L + +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRSKTGWLNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|39996988|ref|NP_952939.1| hypothetical protein GSU1890 [Geobacter sulfurreducens PCA]
 gi|39983876|gb|AAR35266.1| hypothetical protein GSU1890 [Geobacter sulfurreducens PCA]
 gi|298506005|gb|ADI84728.1| protein of unknown function DUF1239 [Geobacter sulfurreducens
           KN400]
          Length = 191

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/191 (12%), Positives = 57/191 (29%), Gaps = 8/191 (4%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL-----DFEPMIMKKFILSDYS 77
            ++  K     A V I+    L + + I     +  +           + +K    ++  
Sbjct: 1   MVKTSKIRHILAVVIILVTLYLVASLAIRLVGGNEKEAGLPKLPRNIDLSLKTLHYAETR 60

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
           +   K+ L A+R +        +  L    +  P      G++ L +  A +  A   + 
Sbjct: 61  EGVKKWDLYADRGEYDRQR--DVTLLTGVRIVFPGTDKT-GEITLRSDKAEYFNATKDVT 117

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++     +    +      A        + + D V    + F +          +R+   
Sbjct: 118 LTGNIHARSTSGMEFTTGRASYRASRQLVVTDDRVSFRDARFAVEGVGMEFLVPTRTLRI 177

Query: 198 AGQVSVVVNPG 208
              V   + P 
Sbjct: 178 LNDVRATIAPA 188


>gi|325926074|ref|ZP_08187437.1| hypothetical protein XPE_1401 [Xanthomonas perforans 91-118]
 gi|325543532|gb|EGD14952.1| hypothetical protein XPE_1401 [Xanthomonas perforans 91-118]
          Length = 191

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 44/183 (24%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             + +       S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VVLFVAAVISGWSAWKQRARPAAAAVQESGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L A +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRAKTGWVNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|78048671|ref|YP_364846.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037101|emb|CAJ24846.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 191

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 43/183 (23%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             + +       S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VVLFVAAVISGWSAWKQRARPAAAAVQESGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L A +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRAKTGWVNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S         SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEANLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|294625298|ref|ZP_06703936.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665379|ref|ZP_06730668.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600419|gb|EFF44518.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604838|gb|EFF48200.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 191

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 44/183 (24%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             + +       S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VVLFVAAVISGWSAWKQRARPAAAAVQESGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L + +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRSKTGWVNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|121596411|ref|YP_988307.1| hypothetical protein Ajs_4130 [Acidovorax sp. JS42]
 gi|120608491|gb|ABM44231.1| protein of unknown function DUF1239 [Acidovorax sp. JS42]
          Length = 206

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/200 (10%), Positives = 54/200 (27%), Gaps = 17/200 (8%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFS--KSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
            L  + P   + ++                      +       M+ F +  +       
Sbjct: 11  RLSLYLPVLLMGLLALGSWWLVRNAPRPQQPAQERPVSHEPDYYMRDFAVKSFDATGRLQ 70

Query: 84  -SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
             +    A+   ++      L+  +  + +   E   +   A+ A  N     + +    
Sbjct: 71  SEIRGTLARHYADNDT----LEIDQARMRSVNEEGRVVTARANRALSNGDGSEVQLYGNA 126

Query: 143 KMKVK----------DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
            +  +            L    E     V    + S  PV +       +A+    +N  
Sbjct: 127 IVTREASAPEGRAPVPRLEFQGEFLHAWVNEERVRSDQPVTLKRGADTFTADSMDYDNLE 186

Query: 193 RSAVFAGQVSVVVNPGVLQK 212
           +     G+V   + P  +++
Sbjct: 187 QIMQLRGRVRGTLMPAPVRR 206


>gi|222112649|ref|YP_002554913.1| hypothetical protein Dtpsy_3488 [Acidovorax ebreus TPSY]
 gi|221732093|gb|ACM34913.1| protein of unknown function DUF1239 [Acidovorax ebreus TPSY]
          Length = 206

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/200 (10%), Positives = 54/200 (27%), Gaps = 17/200 (8%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFS--KSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
            L  + P   + ++                      +       M+ F +  +       
Sbjct: 11  RLSLYLPVLLMGLLALGSWWLVRNAPRPQQPAQERPVSHEPDYYMRDFAVKSFDATGRLQ 70

Query: 84  -SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
             +    A+   ++      L+  +  + +   E   +   A+ A  N     + +    
Sbjct: 71  SEIRGTLARHYADNDT----LEIDQARMRSVNEEGRVVTARANRALSNGDGSEVQLYGNA 126

Query: 143 KMKVK----------DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
            +  +            L    E     V    + S  PV +       +A+    +N  
Sbjct: 127 IVTREASAPEGRAPVPRLEFQGEFLHAWVNEERVRSDQPVTLKRGADTFTADSMDYDNLE 186

Query: 193 RSAVFAGQVSVVVNPGVLQK 212
           +     G+V   + P  +++
Sbjct: 187 QVMQLRGRVRGTLMPAPVRR 206


>gi|21243696|ref|NP_643278.1| hypothetical protein XAC2969 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109277|gb|AAM37814.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 191

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 44/183 (24%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             + +       S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VVLFVAAVISGWSAWKQRARPAAAAVQESGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L + +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRSKTGWVNPDGTQLRLRGDVEGDSPTGGATA 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|126668778|ref|ZP_01739726.1| hypothetical protein MELB17_07234 [Marinobacter sp. ELB17]
 gi|126626761|gb|EAZ97410.1| hypothetical protein MELB17_07234 [Marinobacter sp. ELB17]
          Length = 204

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 54/187 (28%), Gaps = 8/187 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTF-SKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSL 85
           +     ATV      L  S   +      S +         +   + + Y +    K   
Sbjct: 21  RTVALLATVIATAALLWHSDNEVPMPTQDSELRGDREPDSFVVDALYTSYDEQGTIKIQF 80

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
           V+ R +    +G  I  + + + T+  Q        L A   +    N  L +    ++ 
Sbjct: 81  VSPRIEQFEANGYAI--MAEPQATIQGQPGS-EPWQLTAKHGKLRDGNSQLELEGDVRIV 137

Query: 146 VKDNLR---LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            +   R   L      LD +     +  PV I  +     A   +   + R      QV 
Sbjct: 138 RQIGERSATLSTTRLTLDNRTNMAYTDAPVEIVDATGTTHATGMKAWLNERILELDSQVE 197

Query: 203 VVVNPGV 209
                G 
Sbjct: 198 GHYETGN 204


>gi|34580433|ref|ZP_00141913.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28261818|gb|EAA25322.1| unknown [Rickettsia sibirica 246]
          Length = 197

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 70/198 (35%), Gaps = 12/198 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP------MIM 68
           S Y+   +  + +        + I    + S +I           L D +       +I+
Sbjct: 3   SSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVKKSLKDNKNFDLKYNIIL 62

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
           K  I    +K+   Y +  ERA    N+   +  +           ++   + + A    
Sbjct: 63  KDSIFEGVNKNLNAYKIKTERAIKESNNKYKLYIINAI-----YNVNQDQTLIINAKEGF 117

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
            +  +  L +    K+     +  +   A +D+ N  I    P  + + +  ++++    
Sbjct: 118 LDEESSILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFNT 176

Query: 189 ENSSRSAVFAGQVSVVVN 206
           ++ +   +F G VS +++
Sbjct: 177 QDENNIIIFKGNVSTIID 194


>gi|289667911|ref|ZP_06488986.1| putative secreted protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 191

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 43/183 (23%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             +         S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VVLFAAAVISGWSAWKQRARPAAAAVQESGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L + +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRSKTGWVNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|95928726|ref|ZP_01311472.1| protein of unknown function DUF1239 [Desulfuromonas acetoxidans DSM
           684]
 gi|95135071|gb|EAT16724.1| protein of unknown function DUF1239 [Desulfuromonas acetoxidans DSM
           684]
          Length = 196

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 61/199 (30%), Gaps = 9/199 (4%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS 77
           R++      +     F    +V      +           +   D   + +  F  ++  
Sbjct: 3   RRNTIRRFLVAALLAFCAGLLVLVLYYENLPTSVEIIDDVVMDAD---VELTTFNYTETV 59

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                ++L  E A   FN  +  I     +L     + + GD+ L A      L++  + 
Sbjct: 60  DGAKHWTLTGESAAHDFNQEQTRIDRVMMKL---YDQKDMGDVVLTADQGTALLSDQQVN 116

Query: 138 ISQPFKMKVKDNLRLDFETAVLD---VKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           +     +K  +   L  E A       ++  I S   V I      L      ++   R+
Sbjct: 117 VDGDVVIKSDNGYTLLTERATYYGNRSQSGVIESPVAVTIRSDQLELHGTGLVLDVGLRT 176

Query: 195 AVFAGQVSVVVNPGVLQKK 213
                 VS    P   +++
Sbjct: 177 MQLNTDVSATFYPEAQKEQ 195


>gi|166711214|ref|ZP_02242421.1| hypothetical protein Xoryp_07020 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 191

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 44/183 (24%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
            T+         S  +      ++         I++ F L    K   K S+     +  
Sbjct: 11  VTLFAAAVISGWSAWKQRARPAAAAVQQSGADYILRDFELIALDKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L + +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRSKTGWVNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|91774495|ref|YP_544251.1| hypothetical protein Mfla_0139 [Methylobacillus flagellatus KT]
 gi|91708482|gb|ABE48410.1| protein of unknown function DUF1239 [Methylobacillus flagellatus
           KT]
          Length = 229

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/192 (8%), Positives = 51/192 (26%), Gaps = 9/192 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
             FP A + ++    L     +             +P  +    ++  +      S + +
Sbjct: 8   ILFPLAVLGLMALITLWIDRTVQPPEPRIDGATRHDPDYILNNFVTTKTDATGSISHILK 67

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK--- 145
            ++           L++                +       +     +      ++    
Sbjct: 68  ASEMRHYPDDDTTELENP--HFTQFGVGRPATTIEGKRGYVSSDGAVVEFRDNVRVVRPA 125

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIIT-HSDFVLSANFARIENSSRSAVFAGQVS 202
              +  + L  E   ++      ++  PV+IT     V+ A     +  +++     +V 
Sbjct: 126 FGDRPEMTLTTEYLRVEPDREVASTDQPVVITQGPKSVVRAVGMVYDKKNQTIQLNKRVR 185

Query: 203 VVVN-PGVLQKK 213
                P   +  
Sbjct: 186 SHYERPPAKRAS 197


>gi|229586752|ref|YP_002845253.1| hypothetical protein RAF_ORF0606 [Rickettsia africae ESF-5]
 gi|228021802|gb|ACP53510.1| Unknown [Rickettsia africae ESF-5]
          Length = 198

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 68/199 (34%), Gaps = 13/199 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MI 67
           S Y+   +  + +        + I    + S +I        +   L           +I
Sbjct: 3   SSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYNII 62

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           +K  I    SK+   Y +  ERA    N+      L          + +   + + A   
Sbjct: 63  LKDSIFEGVSKNLNAYKIKTERAIKESNNK---YKLDIINAIYNVNQDQ--TLIINAKEG 117

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  +  L +    K+     +  +   A +D+ N  I    P  + + +  ++++   
Sbjct: 118 FLDEESRILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFN 176

Query: 188 IENSSRSAVFAGQVSVVVN 206
            ++ +   +F G VS +++
Sbjct: 177 TKDENNIIIFKGNVSTIID 195


>gi|15892583|ref|NP_360297.1| hypothetical protein RC0660 [Rickettsia conorii str. Malish 7]
 gi|20455406|sp|Q92HW0|Y660_RICCN RecName: Full=Uncharacterized protein RC0660
 gi|15619748|gb|AAL03198.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 198

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/199 (14%), Positives = 68/199 (34%), Gaps = 13/199 (6%)

Query: 15  SKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP-------MI 67
           S Y+   +  + +        + I    + S +I        +   L           +I
Sbjct: 3   SSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYNII 62

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           +K  I    +K+   Y +  ERA    N+      L          + +   + + A   
Sbjct: 63  LKDSIFEGVNKNLNAYKIKTERAIKESNNK---YKLDIINAIYNVNQDQ--TLIINAKEG 117

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  +  L +    K+     +  +   A +D+ N  I    P  + + +  ++++   
Sbjct: 118 FLDEESSILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFN 176

Query: 188 IENSSRSAVFAGQVSVVVN 206
            ++ +   +F G VS +++
Sbjct: 177 TKDENNIIIFKGNVSTIID 195


>gi|56459510|ref|YP_154791.1| hypothetical protein IL0399 [Idiomarina loihiensis L2TR]
 gi|56178520|gb|AAV81242.1| Uncharacterized conserved secreted protein [Idiomarina loihiensis
           L2TR]
          Length = 187

 Score = 71.3 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/198 (12%), Positives = 59/198 (29%), Gaps = 21/198 (10%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            R +  +     F    ++ W                 D  +       +   + +  + 
Sbjct: 2   SRRVTVILILL-FGAGLLLVW----------RPFSDDADGNNAATTRTMQPDFTAFGLET 50

Query: 81  VKYS---LVAERAKTSFNSGKGIIFLQDFELTVP--TQRSEYGDMYLFAHSARFNLANHT 135
             +    L+A + K+   S    I L + +  V             + A    F   + T
Sbjct: 51  RIFESDGLLAHKIKSEKMSHYNQIGLTELKRPVYTVFSEQGEELWEVSAAQGTF-YDDQT 109

Query: 136 LYISQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
           L +    ++          ++  E  ++D+KN ++++  PV I     ++  N    +  
Sbjct: 110 LILEHDVEILALEPDTHIEQVLTEYLIVDLKNESMSTEHPVSIHGPRLLIRGNGMTADLK 169

Query: 192 SRSAVFAGQVSVVVNPGV 209
           +        V  +  P  
Sbjct: 170 AERMELKRHVKTIFQPAE 187


>gi|217969307|ref|YP_002354541.1| hypothetical protein Tmz1t_0878 [Thauera sp. MZ1T]
 gi|217506634|gb|ACK53645.1| protein of unknown function DUF1239 [Thauera sp. MZ1T]
          Length = 193

 Score = 71.3 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 58/182 (31%), Gaps = 11/182 (6%)

Query: 32  PFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVAERA 90
           P   + ++    +           ++         I     +  +  D   +Y LVAER 
Sbjct: 10  PVFALALLAGGSVWLERITRIDDPAASIEQTGPDFIAHDTRVVGFGADGAQRYELVAERL 69

Query: 91  KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL 150
           +        I  L    L +       G   + A +A  +     + ++   +++     
Sbjct: 70  EHFPVG--DITRLHTPRLQLH---GAEGTTTITARAADVSPGGEQVDLTGEVRVRRPGQA 124

Query: 151 -----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                 LD ET  +        +  PV++T      +A   R +N   +    G+VS  +
Sbjct: 125 GALPLALDSETLAVWPDAQRARTDSPVLMTRGAGRATAKGMRADNLFGTLELIGEVSTTM 184

Query: 206 NP 207
            P
Sbjct: 185 PP 186


>gi|296313584|ref|ZP_06863525.1| hypothetical protein NEIPOLOT_00394 [Neisseria polysaccharea ATCC
           43768]
 gi|296839817|gb|EFH23755.1| hypothetical protein NEIPOLOT_00394 [Neisseria polysaccharea ATCC
           43768]
          Length = 193

 Score = 71.3 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 56/192 (29%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V + G       I      +  ++  +     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGGLSAWLGRISEVEIEEVRLNPNE-PQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L A+ AK    S    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSAKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D      +++ E   +D ++    +  PV   +      A     ++ + 
Sbjct: 116 KNNVVLTKTADGKRQAGKVETEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 LLNFSSKVKATI 187


>gi|15676269|ref|NP_273403.1| hypothetical protein NMB0354 [Neisseria meningitidis MC58]
 gi|7225576|gb|AAF40797.1| hypothetical protein NMB0354 [Neisseria meningitidis MC58]
          Length = 193

 Score = 71.3 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 55/192 (28%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V +         I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L A+ AK    S    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSAKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D      +++ E   +D ++    +  PV   +      A     ++ + 
Sbjct: 116 KNNVVLTKTADGKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 MLNFSSKVKATI 187


>gi|325208820|gb|ADZ04272.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33]
          Length = 193

 Score = 71.3 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 52/186 (27%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V +         I      +  ++  D     M    L     D   Y    
Sbjct: 9   IAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK- 143
           L A+ AK    S    I        +   +       + +  A ++  N  +        
Sbjct: 66  LSAKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVL 121

Query: 144 MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
            K  D      +++ E   +D ++    +  PV   +      A     ++ +    F+ 
Sbjct: 122 TKTADGKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|148265014|ref|YP_001231720.1| hypothetical protein Gura_2975 [Geobacter uraniireducens Rf4]
 gi|146398514|gb|ABQ27147.1| protein of unknown function DUF1239 [Geobacter uraniireducens Rf4]
          Length = 191

 Score = 71.3 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 61/177 (34%), Gaps = 4/177 (2%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           +FL      + +++V    L      +     S    +   + ++K   ++      K+ 
Sbjct: 9   RFLALVIILSAISVVVAITLKVQQGKTPAETLSRLPGNV-DVALQKIHYTETKAGVKKWD 67

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L+A++A         II L    L +     + GD+ L A  A ++  +  + +    + 
Sbjct: 68  LLADQAVFDRK--SEIIHLTGVRL-LVAAGGKMGDITLTADRADYDSKSKDVKLVGNVEA 124

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
           K    +R   E A+       I ++  V  +     L      +   +++      V
Sbjct: 125 KSVSGMRFTTEIAIYMANRSMIKTAGRVRFSDGQLDLDGVGMELMTVTKNLKIMKDV 181


>gi|59801935|ref|YP_208647.1| hypothetical protein NGO1607 [Neisseria gonorrhoeae FA 1090]
 gi|239999671|ref|ZP_04719595.1| hypothetical protein Ngon3_09352 [Neisseria gonorrhoeae 35/02]
 gi|240014848|ref|ZP_04721761.1| hypothetical protein NgonD_09449 [Neisseria gonorrhoeae DGI18]
 gi|240081066|ref|ZP_04725609.1| hypothetical protein NgonF_07102 [Neisseria gonorrhoeae FA19]
 gi|240116370|ref|ZP_04730432.1| hypothetical protein NgonPID1_09071 [Neisseria gonorrhoeae PID18]
 gi|240121367|ref|ZP_04734329.1| hypothetical protein NgonPI_06304 [Neisseria gonorrhoeae PID24-1]
 gi|240126404|ref|ZP_04739290.1| hypothetical protein NgonSK_09404 [Neisseria gonorrhoeae SK-92-679]
 gi|240128869|ref|ZP_04741530.1| hypothetical protein NgonS_09643 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494387|ref|ZP_05107558.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260439811|ref|ZP_05793627.1| hypothetical protein NgonDG_01752 [Neisseria gonorrhoeae DGI2]
 gi|268595484|ref|ZP_06129651.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597177|ref|ZP_06131344.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268602037|ref|ZP_06136204.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268684989|ref|ZP_06151851.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268687251|ref|ZP_06154113.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043081|ref|ZP_06568804.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|59718830|gb|AAW90235.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|226513427|gb|EEH62772.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548873|gb|EEZ44291.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550965|gb|EEZ45984.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268586168|gb|EEZ50844.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268625273|gb|EEZ57673.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627535|gb|EEZ59935.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012687|gb|EFE04670.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|317164934|gb|ADV08475.1| hypothetical protein NGTW08_1515 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 193

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 54/192 (28%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V +         I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L A+ AK    +    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSAKGAKQFPENSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D      +++ E   +D ++    +  PV   +      A      + + 
Sbjct: 116 KNNVVLTKTADGRRQAGKVETEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYNHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 MLNFSSKVKAAI 187


>gi|221200000|ref|ZP_03573043.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221206845|ref|ZP_03579857.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221211207|ref|ZP_03584186.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221168568|gb|EEE01036.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221173500|gb|EEE05935.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221180239|gb|EEE12643.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 204

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/188 (10%), Positives = 50/188 (26%), Gaps = 13/188 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                  +              F +++  +    +Y L 
Sbjct: 10  LLPLVAVAALAGITWWLLQATLPPPGEGVAQPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +     ++    + +       P        +   A     N     + +    ++  
Sbjct: 70  AAKLVHYEDTESSDLTMPAMRAFQP----GKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 AAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVVNPG 208
           V   +   
Sbjct: 186 VRGTIAAS 193


>gi|258591942|emb|CBE68247.1| conserved exported protein of unknown function [NC10 bacterium
           'Dutch sediment']
          Length = 205

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/181 (13%), Positives = 53/181 (29%), Gaps = 3/181 (1%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             V  +   L       +  +           + + KF L +    +  + +  +R +  
Sbjct: 12  TAVVWIATALAFGVFGNALAASGEETPGSTADVKITKFHLVETKDGKTLWEVWGDRGEIF 71

Query: 94  FNSG-KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRL 152
                  ++ + +    V         +   + SAR N+    + +        +    L
Sbjct: 72  EKGEVAKVVKVANPVTVVLHSEHGK--LTARSDSARVNMRTKDIRLEGNVTATSEQGNSL 129

Query: 153 DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQK 212
             E+     K+  +++  PV +              E     A F  +V   V P  + K
Sbjct: 130 QTESLDWLAKDRLVSTRLPVTLVRGRLTSWGVGMEAETDLERATFLSRVRSHVAPESVGK 189

Query: 213 K 213
           K
Sbjct: 190 K 190


>gi|240017294|ref|ZP_04723834.1| hypothetical protein NgonFA_09057 [Neisseria gonorrhoeae FA6140]
 gi|240113276|ref|ZP_04727766.1| hypothetical protein NgonM_06826 [Neisseria gonorrhoeae MS11]
 gi|240124202|ref|ZP_04737158.1| hypothetical protein NgonP_09744 [Neisseria gonorrhoeae PID332]
 gi|268599356|ref|ZP_06133523.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268682828|ref|ZP_06149690.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|293398419|ref|ZP_06642597.1| hypothetical protein NGNG_01072 [Neisseria gonorrhoeae F62]
 gi|268583487|gb|EEZ48163.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268623112|gb|EEZ55512.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|291610890|gb|EFF39987.1| hypothetical protein NGNG_01072 [Neisseria gonorrhoeae F62]
          Length = 193

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 55/192 (28%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V + G       I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L A+ AK    +    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSAKGAKQFPENSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D      +++ E   +D ++    +  PV   +      A      + + 
Sbjct: 116 KNNVVLTKTADGRRQAGKVETEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYNHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 MLNFSSKVKAAI 187


>gi|51473688|ref|YP_067445.1| hypothetical protein RT0491 [Rickettsia typhi str. Wilmington]
 gi|51460000|gb|AAU03963.1| rickettsial conserved hypothetical protein [Rickettsia typhi str.
           Wilmington]
          Length = 201

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 57/142 (40%), Gaps = 6/142 (4%)

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            +I++  I    +K+   Y +  ERA     +      L         ++ +   + + A
Sbjct: 62  NVILQDSIFEGVNKNLNAYKIKTERAIKESGNK---YKLDIINAIYSIKQDQ--TLIITA 116

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
                +  ++TL +    K+ V   +  +   A +++ N  IN +    + + +  ++++
Sbjct: 117 KEGFLDQESNTLDLKNDIKLFVD-EIIFNTNNARINLVNQNINGNSSAKLIYKNSSITSD 175

Query: 185 FARIENSSRSAVFAGQVSVVVN 206
                N +   +F G VS +++
Sbjct: 176 SFNTMNENNIIIFKGNVSTIID 197


>gi|161523707|ref|YP_001578719.1| hypothetical protein Bmul_0527 [Burkholderia multivorans ATCC
           17616]
 gi|189351529|ref|YP_001947157.1| hypothetical protein BMULJ_02732 [Burkholderia multivorans ATCC
           17616]
 gi|160341136|gb|ABX14222.1| protein of unknown function DUF1239 [Burkholderia multivorans ATCC
           17616]
 gi|189335551|dbj|BAG44621.1| putative exported protein [Burkholderia multivorans ATCC 17616]
          Length = 204

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/188 (10%), Positives = 50/188 (26%), Gaps = 13/188 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                  +              F +++  +    +Y L 
Sbjct: 10  LLPLVAVAALAGITWWLLQATLPPPGEGVTQPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +     ++    + +       P        +   A     N     + +    ++  
Sbjct: 70  AAKLVHYEDTESSDLTMPAMRAFQP----GKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 AAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVVNPG 208
           V   +   
Sbjct: 186 VRGTIAAS 193


>gi|218507226|ref|ZP_03505104.1| hypothetical protein RetlB5_06225 [Rhizobium etli Brasil 5]
          Length = 88

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 43/85 (50%)

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
           +N A   L+++ PF + +   L   F++A LD+K   + S DPV IT  +  + A    I
Sbjct: 2   YNRATDNLHMTAPFTLVLSSGLNAQFQSARLDIKGGNMRSDDPVTITKDNASIVAKTLEI 61

Query: 189 ENSSRSAVFAGQVSVVVNPGVLQKK 213
            +  R   F G V + V+P  + K+
Sbjct: 62  TDKGRVITFEGNVRMNVDPSTIHKQ 86


>gi|121635510|ref|YP_975755.1| hypothetical protein NMC1814 [Neisseria meningitidis FAM18]
 gi|161870715|ref|YP_001599888.1| hypothetical protein NMCC_1788 [Neisseria meningitidis 053442]
 gi|120867216|emb|CAM10985.1| putative periplasmic hypothetical protein [Neisseria meningitidis
           FAM18]
 gi|161596268|gb|ABX73928.1| conserved hypothetical protein [Neisseria meningitidis 053442]
 gi|308388562|gb|ADO30882.1| hypothetical protein NMBB_0395 [Neisseria meningitidis alpha710]
 gi|325128939|gb|EGC51793.1| hypothetical protein NMXN1568_0315 [Neisseria meningitidis N1568]
 gi|325130883|gb|EGC53613.1| hypothetical protein NMBOX9930304_0336 [Neisseria meningitidis
           OX99.30304]
 gi|325134935|gb|EGC57567.1| hypothetical protein NMBM13399_0352 [Neisseria meningitidis M13399]
 gi|325138893|gb|EGC61443.1| hypothetical protein NMBES14902_0337 [Neisseria meningitidis
           ES14902]
 gi|325143039|gb|EGC65391.1| hypothetical protein NMB9615945_0398 [Neisseria meningitidis
           961-5945]
          Length = 193

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 53/186 (28%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V + G       I      +  ++  D     M    L     D   Y    
Sbjct: 9   IAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK- 143
           L A+ AK    S    I        +   +       + +  A ++  N  +        
Sbjct: 66  LSAKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVL 121

Query: 144 MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
            K  D      +++ E   +D ++    +  PV   +      A     ++ +    F+ 
Sbjct: 122 TKTADGKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|157803763|ref|YP_001492312.1| hypothetical protein A1E_02935 [Rickettsia canadensis str. McKiel]
 gi|157785026|gb|ABV73527.1| hypothetical protein A1E_02935 [Rickettsia canadensis str. McKiel]
          Length = 188

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 55/142 (38%), Gaps = 6/142 (4%)

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            +I+K  I    +K+   Y++  ERA    ++      L          + +   + + A
Sbjct: 49  NIILKDSIFEGVNKNLNAYTIKTERATKESDNK---YKLDIINAIYNVNKDQ--HLIIHA 103

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
                +  ++ L +    K      +  +   A +D+ N  I  +    + +++  ++++
Sbjct: 104 QEGFLDEESNILDLKNDVKFFFD-KIIFNTNNARIDLVNQNITGNSSATLFYNNSSITSD 162

Query: 185 FARIENSSRSAVFAGQVSVVVN 206
                + +   +F G VS ++N
Sbjct: 163 SFNTRDKNNIIIFKGNVSTIIN 184


>gi|240118658|ref|ZP_04732720.1| hypothetical protein NgonPID_09418 [Neisseria gonorrhoeae PID1]
 gi|268604371|ref|ZP_06138538.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268588502|gb|EEZ53178.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
          Length = 193

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 55/192 (28%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V + G       I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L A+ AK    +    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSAKGAKQFPENS--HIHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D  R    ++ E   +D ++    +  PV   +      A      + + 
Sbjct: 116 KNNVVLTKTADGRRQAGKVETEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYNHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 MLNFSSKVKAAI 187


>gi|255658899|ref|ZP_05404308.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
 gi|260848848|gb|EEX68855.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
          Length = 187

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/179 (8%), Positives = 47/179 (26%), Gaps = 17/179 (9%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS-------KDR-VKYS 84
              + I+ +  +  W   +      ID  D +        +  Y        KD    + 
Sbjct: 8   LVALGILFFACVVIWAVRTVPEAPKIDHSDDDQ-----PRIMSYDNNTISEEKDGVKIWD 62

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L A+  +           +         +     ++   A    ++     + I    K+
Sbjct: 63  LTADHLEVDI--DSRNAEMTGITGHFYQKDGRSAEV--TADHGSYDNETKDIQIDGNVKI 118

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
              D   L  +  +   +   +++     +++             +       +G+  +
Sbjct: 119 TTSDGATLTSDQLLWTAEQGMLSAIGQAKVSNDTIRAWGERIDSTDGFNKVKISGKAHI 177


>gi|292669890|ref|ZP_06603316.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648687|gb|EFF66659.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 180

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 51/176 (28%), Gaps = 6/176 (3%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           K  +  A V ++G  + +      T S  +           +   + +    R  ++L A
Sbjct: 5   KMIYGGAAVFLLGLIIWAIVTVPETPSPDAPSGPRIMSY--ENNTIHEERDGRTVWTLTA 62

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           +R     ++      +Q  E T  +       + L A     + A   + ++   +    
Sbjct: 63  KRVNVDIDTNDTT--MQGIEGTFYSADG--RTLALQADEGHMDSATRNIVLTGSIEATTS 118

Query: 148 DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           D   L  +          + +     IT  D   + +     +        G   V
Sbjct: 119 DGASLRAQELKWTSAEGVLTAEGDAEITRDDIRATGDRIASTDEFERFTITGNARV 174


>gi|77919537|ref|YP_357352.1| hypothetical protein Pcar_1941 [Pelobacter carbinolicus DSM 2380]
 gi|77545620|gb|ABA89182.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 165

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/162 (12%), Positives = 47/162 (29%), Gaps = 3/162 (1%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFL 103
           + +             L     + ++    ++ S    ++ L A+ A       K  +  
Sbjct: 1   MWTHRPEPVSEPPVDSLPANTDLALQDIQYTETSDGLRRWMLTAKSAAYDDQQSKSTV-- 58

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
           QD  +    ++     M L +    +      +       +K  +   +  E      + 
Sbjct: 59  QDMRVEFFDKQGRV-QMTLTSREGVWFSETGEIEARGNVVVKTTEGYTVYTERLRYRSRA 117

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             +++  PV +   +  LSA         R      QV   +
Sbjct: 118 DEVSTDLPVRVESVNMRLSARGMHYRVKERLLTLDSQVKASL 159


>gi|78222494|ref|YP_384241.1| hypothetical protein Gmet_1280 [Geobacter metallireducens GS-15]
 gi|78193749|gb|ABB31516.1| protein of unknown function DUF1239 [Geobacter metallireducens
           GS-15]
          Length = 191

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 62/191 (32%), Gaps = 8/191 (4%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL-----DFEPMIMKKFILSDYS 77
            ++  K     A+V ++    ++  + +   +    D           + + K   ++  
Sbjct: 1   MVKPNKIRHILASVIVLATLYIAVSLALKLGAGGKKDEGLPALPRNVEISLSKIHYTETK 60

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
               ++ L A + +        +  L D  L +  +  + G++ L +  A +  A   + 
Sbjct: 61  DGVRQWDLYAGKGEYDKAR--DVTRLTDVRLVLHER-GKSGEITLVSDQADYFNAAKNVA 117

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++     K +  +      A        + + D V  T     +S     +   +R    
Sbjct: 118 LTGNVVAKSESGMEFTTGRASYQSNRSLVVTDDRVRFTDGGMSVSGVGMELSVKTRQVRI 177

Query: 198 AGQVSVVVNPG 208
              V+  V PG
Sbjct: 178 LRDVTATVAPG 188


>gi|15604366|ref|NP_220882.1| hypothetical protein RP506 [Rickettsia prowazekii str. Madrid E]
 gi|6647950|sp|Q9ZD41|Y506_RICPR RecName: Full=Uncharacterized protein RP506
 gi|3861058|emb|CAA14958.1| unknown [Rickettsia prowazekii]
 gi|292572119|gb|ADE30034.1| hypothetical protein rpr22_CDS490 [Rickettsia prowazekii Rp22]
          Length = 201

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/142 (12%), Positives = 53/142 (37%), Gaps = 6/142 (4%)

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            +I++  I    +K+   Y +  ERA     +      L          + +   + + A
Sbjct: 62  NVILQDSIFEGVNKNLNAYKIKTERAIKESGNK---YKLDIINAIYNINQDQ--ALIITA 116

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
                +  ++ L +    K+     +  +   A +++ N  I  +    + + +  ++++
Sbjct: 117 KEGFLDQESNILDLKNDIKLFFD-EIIFNTNNARINLVNQNIYGNSSAKLLYKNSSITSD 175

Query: 185 FARIENSSRSAVFAGQVSVVVN 206
                + +   +F G VS +++
Sbjct: 176 SFNTMDENNIIIFKGNVSTIID 197


>gi|89902982|ref|YP_525453.1| hypothetical protein Rfer_4235 [Rhodoferax ferrireducens T118]
 gi|89347719|gb|ABD71922.1| protein of unknown function DUF1239 [Rhodoferax ferrireducens T118]
          Length = 201

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/198 (12%), Positives = 55/198 (27%), Gaps = 15/198 (7%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRVKY 83
            L  + P   + ++                  ++          M+KF +  +       
Sbjct: 7   RLSLYLPVILMGVLALGTYWLVRSTPLLISHGLEAQVRHEPDYFMRKFSVKSFDDAGR-- 64

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            L +E   T          L+   +++ +   E G     A  A  N     + +     
Sbjct: 65  -LKSEVLGTDARHFPDSETLEIDLVSIRSFSEEGGLTTATAKRAVANADASEVQLFGEAH 123

Query: 144 MKVKDN----------LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +  +            +    E     +    + S  PV +T  +   +A+    +N  R
Sbjct: 124 VVRQPMADKAGQVQPRMEFRGEFLHAFMDTERVKSHKPVELTRGNDKFTADAMDFDNLKR 183

Query: 194 SAVFAGQVSVVVNPGVLQ 211
                G+V   + P   +
Sbjct: 184 VMELKGRVKGTLVPAAAR 201


>gi|170691490|ref|ZP_02882655.1| protein of unknown function DUF1239 [Burkholderia graminis C4D1M]
 gi|170143695|gb|EDT11858.1| protein of unknown function DUF1239 [Burkholderia graminis C4D1M]
          Length = 203

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 50/187 (26%), Gaps = 12/187 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILSDYSKDRV-KYSLV 86
             P   +  +                  +              F +S+  +    +Y L 
Sbjct: 10  LIPLVAMAALAGITWWLLQATLPRQNEGVVRPKEHTPDYFADNFSVSELDQSGSTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A+           +  L   +  +   +     +     + + N     + +    ++  
Sbjct: 70  AQSLI--HYEDDELSDL--VKPAMRAFQPGKPVVTATGDTGKVNGDASIVDLYGNARILR 125

Query: 147 KDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D E   + V +  I +  PV +     V++A+     N +R     G V
Sbjct: 126 SAGYGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGVSVMTASGMNYNNVTRVMKLFGNV 185

Query: 202 SVVVNPG 208
              +   
Sbjct: 186 KGAIAAS 192


>gi|160901480|ref|YP_001567062.1| hypothetical protein Daci_6049 [Delftia acidovorans SPH-1]
 gi|160367064|gb|ABX38677.1| protein of unknown function DUF1239 [Delftia acidovorans SPH-1]
          Length = 205

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/203 (11%), Positives = 55/203 (27%), Gaps = 16/203 (7%)

Query: 22  RFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKS--SIDLLDFEPMIMKKFILSDYSK 78
           R +   L  + P   + ++                S     +       MK F +  +  
Sbjct: 6   RRVGDRLSLYLPVLLMGLLALGTWWLVRNAPQPVASGTEKAVAHEPDYFMKDFSIKSFDA 65

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
                 L ++   +          L+   + +     E       A  A  N     + +
Sbjct: 66  TGR---LKSQIEGSVGRHYPDTDTLEIDNVRMFAVSPEGRITRGSAKRALSNADGSEVQM 122

Query: 139 SQPFKMKVKD----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
                +  +            L+   E          ++S+ PV++T  +   +A+  + 
Sbjct: 123 FGNAVVTREPFVTAGKQPQPQLQFQGEFLHAWPNEERVSSNQPVVLTRGNDRFTADSMQY 182

Query: 189 ENSSRSAVFAGQVSVVVNPGVLQ 211
            N        G+V   + P   +
Sbjct: 183 SNLDLVMKLQGRVRGTLQPSRTK 205


>gi|323524686|ref|YP_004226839.1| hypothetical protein BC1001_0314 [Burkholderia sp. CCGE1001]
 gi|323381688|gb|ADX53779.1| protein of unknown function DUF1239 [Burkholderia sp. CCGE1001]
          Length = 203

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 50/189 (26%), Gaps = 12/189 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILSDYSKDRV-KYSLV 86
             P   +  +  F                              F +S+  +    +Y L 
Sbjct: 10  LIPLVAMAALAGFTWWLLQATLPRQNEGAVRPKEHTPDYFADNFSVSELDQSGSTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-- 144
           A+           +  L   +  +   +     +     + + N     + +    ++  
Sbjct: 70  AQSLI--HYEDDELSDL--VKPAMRAFQPGKPVVTATGDTGKVNGDASIVDLYGNARILR 125

Query: 145 ---KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D E   + V +  I +  PV +     +++A+     N +R     G V
Sbjct: 126 AAGYGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGMSIMTASGMNYNNVTRVMKLFGNV 185

Query: 202 SVVVNPGVL 210
              +     
Sbjct: 186 KGAIAASEA 194


>gi|254251393|ref|ZP_04944711.1| hypothetical protein BDAG_00578 [Burkholderia dolosa AUO158]
 gi|124894002|gb|EAY67882.1| hypothetical protein BDAG_00578 [Burkholderia dolosa AUO158]
          Length = 204

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/188 (11%), Positives = 48/188 (25%), Gaps = 13/188 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                                 F +++  +    +Y L 
Sbjct: 10  LLPLVAVAALAGITWWLLQATLPPPGEGAAQPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L D    +   +     +   A     N     + +    ++  
Sbjct: 70  AAKLV--HYEDTESSDLTDP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARIVR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     V++A +  +  N +R     G 
Sbjct: 126 AAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSVVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVVNPG 208
           V   +   
Sbjct: 186 VRGTIAAS 193


>gi|297182781|gb|ADI18935.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF0010_09O16]
          Length = 199

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 65/199 (32%), Gaps = 24/199 (12%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMI-----------------MK 69
           +K      T  I+  F +  +    +  K +    + + +I                 ++
Sbjct: 1   MKKKIILGTSFIIVVFSVLYFFYTKSNYKKNFIETEKKNLIDKENIKLAEEKIESSNIIE 60

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
               S       +Y L A        +    IFL+  +  +  +   Y  + + +   ++
Sbjct: 61  DVSYSAKDAKGNEYFLKASEGTID-QNDSNFIFLKSVKAIINLKN--YKLIEISSDFGKY 117

Query: 130 NLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
           N+ N+    S+   +   DN  +  +          +  S  V++ +++  L A+   ++
Sbjct: 118 NINNYDTIFSKNVIVSYLDNKIM-GDYLDFSWDKNLMLISRDVVLKNNESSLLADVIEMD 176

Query: 190 NSS---RSAVFAGQVSVVV 205
                 +  ++     V +
Sbjct: 177 IKKRDIKIFMYEDNKKVNI 195


>gi|121607155|ref|YP_994962.1| hypothetical protein Veis_0152 [Verminephrobacter eiseniae EF01-2]
 gi|121551795|gb|ABM55944.1| protein of unknown function DUF1239 [Verminephrobacter eiseniae
           EF01-2]
          Length = 205

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 54/193 (27%), Gaps = 18/193 (9%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFS--KSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            P A + ++            T                +MK F + ++        L ++
Sbjct: 15  LPVALMGLLALGSWWLVRNAPTPQWPILERQQRHQPDYVMKTFSVKNFDAAGR---LQSQ 71

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                         L+  +  + +   E       A+ A  N     + +     +  + 
Sbjct: 72  VQGRELRHYPDTGMLEIDQAHMRSISPEGQITVATANRALSNADGSQVQLFGNAIVTREP 131

Query: 149 -------------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
                         +R +F  A        + S  PV +T      +A+    ++ S+  
Sbjct: 132 LPAKPGAPARPRLEMRSEFLQAFTSAHAERVRSDQPVTLTRGRDRFTADGMEYDHRSQVL 191

Query: 196 VFAGQVSVVVNPG 208
              G V  V+ PG
Sbjct: 192 QLRGHVRGVLMPG 204


>gi|119469168|ref|ZP_01612152.1| hypothetical protein ATW7_18770 [Alteromonadales bacterium TW-7]
 gi|119447420|gb|EAW28688.1| hypothetical protein ATW7_18770 [Alteromonadales bacterium TW-7]
          Length = 184

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/184 (10%), Positives = 59/184 (32%), Gaps = 11/184 (5%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSL 85
            +       ++ + W     + +++   ++  D++        +   + Y ++    + +
Sbjct: 4   ARIILSVLFISCMVWLWYPYFTQVNLPQQTEADIIAKPDYTAIELKQTAYDENGKISHKV 63

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A  A+       G  F       + T  +      + A+ A        L +       
Sbjct: 64  TA--ARMELYQELGFTFFDKP---IFTLYNNKQTWRINANEATL-YEGRQLILEGNVVAS 117

Query: 146 VKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
              +     +++ +   +D+K +T+ S  PVI+T  +  ++      +  +         
Sbjct: 118 NLTDNAMIDKINADNIQVDIKLLTMQSEQPVIVTGPNLKITGKGLEADLKTEVIKLINHT 177

Query: 202 SVVV 205
             + 
Sbjct: 178 RTIY 181


>gi|299068030|emb|CBJ39244.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CMR15]
          Length = 210

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/213 (8%), Positives = 57/213 (26%), Gaps = 19/213 (8%)

Query: 16  KYRQHVRFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS 74
              +  R +   L+       + ++      +++ +   +  + +  +     +  + + 
Sbjct: 2   ASERSQRLVSSLLQIMLRGLPILLMAVVCGVTFLLVQVNTPQTEETANQAKRHVADYTMD 61

Query: 75  DY-----SKDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
                   +    KY         +         +    L +         +   A   +
Sbjct: 62  GISATALDERGVTKYRFTG--VHMNHYEDDLTYDVTFPALRIYAPDH--PQVTARADLGK 117

Query: 129 FNLANHTLYISQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            N     + +    K+             +  D     + + +  + +  PV +     +
Sbjct: 118 MNGEGSIIDLYDNAKVVRAQGPDLRQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPSI 177

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           ++AN     N +R     G V   +      K+
Sbjct: 178 MNANGLVFNNVTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|254515274|ref|ZP_05127335.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]
 gi|219677517|gb|EED33882.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]
          Length = 192

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 67/189 (35%), Gaps = 7/189 (3%)

Query: 22  RFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
           R ++  L      + + ++   L     R+ T +                  ++D++++ 
Sbjct: 8   RRVRKRLSIPLVLSALLLIYTMLA-PAPRLITENTVQTTSARVPDSYAHDVSVNDFNENG 66

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
           V       +A   F   +GI+ L +      ++  E+   +  A S +       L +  
Sbjct: 67  VLLGSTEAQALRRFP-REGIVELDEPRRRNYSEDGEW---FASARSGQLREKTDVLLLDH 122

Query: 141 PFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
             ++K   D+L+   ++ ++++      S+  V I  +D    A    I    + A   G
Sbjct: 123 EVRLKYASDDLQFLTDSMIINIPKQAARSTSSVRIWQADNETVAEQIYINLDRQIASLNG 182

Query: 200 QVSVVVNPG 208
            V  V  P 
Sbjct: 183 SVRTVYVPQ 191


>gi|58580910|ref|YP_199926.1| hypothetical protein XOO1287 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622843|ref|YP_450215.1| hypothetical protein XOO_1186 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578111|ref|YP_001915040.1| hypothetical protein PXO_02230 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425504|gb|AAW74541.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366783|dbj|BAE67941.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188522563|gb|ACD60508.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 191

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/183 (11%), Positives = 45/183 (24%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
            T+         S  +      ++         I++ F L   +K   K S+     +  
Sbjct: 11  VTLFAAAVISGWSAWKQRARPAAAAVQQSGADYILRDFELIALNKQSGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L + +   N     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLMPDNANLPWTLRSKTGWVNPDGTQLRLRGDVEGDSPTGGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     +  PV +T    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNIAKTDAPVTMTRPGIMQSGVGFAADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|332531903|ref|ZP_08407787.1| uncharacterized protein YrbK [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038530|gb|EGI74973.1| uncharacterized protein YrbK [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 184

 Score = 69.0 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 61/184 (33%), Gaps = 11/184 (5%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSL 85
            +       ++ + W     + + +   ++  +++     I  +   + Y +     + +
Sbjct: 4   ARIILSVLFISCMVWLWYPYFTQTNIVPQAEPEVVAKPDYIAIELKQTAYDEQGKISHKV 63

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A  AK       G  F +     + T  +E     + A  A     +  L +      K
Sbjct: 64  TA--AKMELYQQLGFTFFEKP---IFTLYNEQQTWQINADEATL-YEDKQLILEGNVVAK 117

Query: 146 VKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
              +     +++ +   +D+K +T+ S  PVIIT  +  ++      +  +         
Sbjct: 118 NLTDNAMIDKINADNIQVDIKLLTMRSEQPVIITGPNLKITGKGLEADLKTEVIKLINHT 177

Query: 202 SVVV 205
             + 
Sbjct: 178 RTIY 181


>gi|218768870|ref|YP_002343382.1| putative periplasmic hypothetical protein [Neisseria meningitidis
           Z2491]
 gi|121052878|emb|CAM09230.1| putative periplasmic hypothetical protein [Neisseria meningitidis
           Z2491]
 gi|254670188|emb|CBA05298.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|254673984|emb|CBA09768.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|319411111|emb|CBY91515.1| conserved hypothetical membrane protein [Neisseria meningitidis WUE
           2594]
          Length = 193

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 55/192 (28%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V +         I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L ++ AK    S    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSSKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D      +++ E   +D ++    +  PV   +      A     ++ + 
Sbjct: 116 KNNVVLTKTADGKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 MLNFSSKVKATI 187


>gi|254490083|ref|ZP_05103276.1| conserved hypothetical protein [Methylophaga thiooxidans DMS010]
 gi|224464747|gb|EEF81003.1| conserved hypothetical protein [Methylophaga thiooxydans DMS010]
          Length = 189

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/185 (9%), Positives = 45/185 (24%), Gaps = 9/185 (4%)

Query: 31  FPFAT----VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
            P       V I    L       +  S+            M  F ++    D     ++
Sbjct: 7   LPLTAKLGIVAIALIGLWLLLSDDTVESQIQNQTHRTSDYAMTDFTMTVMDIDGTPARVI 66

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-- 144
                  +        +      +   +  +    + +        + T+ ++    +  
Sbjct: 67  KGDEMAHYPDNDSTEIINPVTEFIEPGQDTWL---IESELGHTQDDSDTILLTGNVIITN 123

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           K   + ++  E   LD K  T  + + V I        +          +     +V   
Sbjct: 124 KDNPSFQMLTEKLTLDTKQNTAYTDEHVTILSPQGDTESVGLHAALDDETINLHSKVKGQ 183

Query: 205 VNPGV 209
            +   
Sbjct: 184 YDAPA 188


>gi|312897535|ref|ZP_07756955.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310621387|gb|EFQ04927.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 182

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 50/181 (27%), Gaps = 6/181 (3%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           +  K+  P      +  F       +    K   ++     +      L +    ++ + 
Sbjct: 4   RIQKYKLPLIVGAFILLFAAVLIPLLREGEK-PAEVNTERFVEFDGSELEEKRDGKLVWH 62

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L A++         G ++      T  +       + + A     +    T+ +  P + 
Sbjct: 63  LTADKILVDP--DSGKVYFVKPTGTFVSDDG--VQLTITADQGIVDRNGKTIELKAPLEA 118

Query: 145 KVKDNLRLDFE-TAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                  L  + +   ++    I     VI       LSA+      +  +    G   +
Sbjct: 119 HTDQGDSLQTDGSVYYNMDTREITGGKVVITRADQTDLSADSFTANAALNAVTLTGHARI 178

Query: 204 V 204
            
Sbjct: 179 T 179


>gi|304386602|ref|ZP_07368890.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|304339431|gb|EFM05503.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
          Length = 193

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 55/192 (28%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V +         I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L ++ AK    S    I        +   +       + +  A ++  N  +  
Sbjct: 60  GYLKEHLSSKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLF 115

Query: 139 SQPFK-MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                  K  D      +++ E   +D ++    +  PV   +      A     ++ + 
Sbjct: 116 KNNVVLTKTADGRRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 MLNFSSKVKATI 187


>gi|254480276|ref|ZP_05093524.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
 gi|214039838|gb|EEB80497.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
          Length = 185

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 16/180 (8%), Positives = 47/180 (26%), Gaps = 6/180 (3%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSL-VAE 88
                 + +      +     S    +S    +     ++      + +      +  AE
Sbjct: 8   ILLAIVLVLAANHYWNPETAESPDLDTSARRHELPKTYLEVVRAWTFDEGGKLTDIVEAE 67

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
           R +         I     +        +       A   R +     L + +   +    
Sbjct: 68  RLEQFPRRHLSYIT----KPRFFAHSGDDRSWSASADKGRTDEKVDRLLLRKNVVLIHDQ 123

Query: 149 -NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
              R+  +   ++++N   +S+  V +   +    A+   +       +    V  +  P
Sbjct: 124 SGTRMKTQALDIELENKVASSNKKVTVVQGNNSTRADGMVVRMEDEIIIMKPNVESIYAP 183


>gi|330446808|ref|ZP_08310459.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490999|dbj|GAA04956.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 187

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 47/192 (24%), Gaps = 19/192 (9%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
           LK            W       +            +       K +          + L 
Sbjct: 3   LKRLLYVLLAVFCAWLGYYQLEQHWQKDGQVKPDDE-------KPVFIGNDISNTTFDLS 55

Query: 87  AERAKTSFN------SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             R+    +         G        L V  +     +  + A++A  +  N  L +  
Sbjct: 56  GIRSYQIDSDHLEYFEKSGQTDFVKPVLWVF-KDGTNAEWRISANTAMLDNKN-ILNLHG 113

Query: 141 PFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             +M       D   +  +   L+++    N+ D V IT   F    +        + A 
Sbjct: 114 NVRMFNLLPDSDIQVIKTDNLQLNIETQDFNTQDHVTITGPAFQNQGDGMTGNMKRKVAK 173

Query: 197 FAGQVSVVVNPG 208
               V     P 
Sbjct: 174 LLKNVKSRYEPN 185


>gi|17545130|ref|NP_518532.1| hypothetical protein RSc0411 [Ralstonia solanacearum GMI1000]
 gi|17427421|emb|CAD13939.1| probable transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 210

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 19/213 (8%), Positives = 57/213 (26%), Gaps = 19/213 (8%)

Query: 16  KYRQHVRFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS 74
              +  R +   L+       + ++      +++ +   +  + +  +     +  + + 
Sbjct: 2   ASERSQRLVSSLLQIMLRGLPILLMAVVCGVTFLLVQVNTPQTEETANQAKRHVADYTMD 61

Query: 75  DY-----SKDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
                   +    KY         +         +    L +         +   A   +
Sbjct: 62  GISATALDERGVTKYRFTG--VHMNHYEDDLTYDVTFPALRIYAPDR--PQVTARADLGK 117

Query: 129 FNLANHTLYISQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            N     + +    K+             +  D     + + +  + +  PV +     V
Sbjct: 118 MNGEGSIIDLYDNAKVVRAQGPDLRQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPSV 177

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           ++AN     N +R     G V   +      K+
Sbjct: 178 MNANGLVFNNVTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|89093950|ref|ZP_01166895.1| hypothetical protein MED92_01599 [Oceanospirillum sp. MED92]
 gi|89081836|gb|EAR61063.1| hypothetical protein MED92_01599 [Oceanospirillum sp. MED92]
          Length = 190

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/181 (12%), Positives = 44/181 (24%), Gaps = 8/181 (4%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFS-KSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAER 89
              A   ++   L   +         S  +L D     +    + ++  D        E 
Sbjct: 10  IILAAFILIPVLLYWGFGTSPVEQAPSRSNLPDQVDYFIDNAKIQEWDTDGQLIR-KVET 68

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
            K      K   FL     T   +        L A        N         ++     
Sbjct: 69  KKLEHKPHKEANFLDAPISTQFQKNGNIS--LLTAAKGVVLDDNSKTDFVGDIEIYSNKG 126

Query: 150 L----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                 +  E   +  K     +  PV I  ++ ++      I  + +      +V    
Sbjct: 127 QPNETIMRTEKLSVFHKQSIAETDQPVTIESTNSLMQGTGMDINFNDQILNLHSRVKGTH 186

Query: 206 N 206
           N
Sbjct: 187 N 187


>gi|254805610|ref|YP_003083831.1| hypothetical protein NMO_1686 [Neisseria meningitidis alpha14]
 gi|254669152|emb|CBA07834.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
          Length = 193

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 53/186 (28%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V + G       I      +  ++  D     M    L     D   Y    
Sbjct: 9   IAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK- 143
           L ++ AK    S    I        +   +       + +  A ++  N  +        
Sbjct: 66  LSSKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVL 121

Query: 144 MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
            K  D      +++ E   +D ++    +  PV   +      A     ++ +    F+ 
Sbjct: 122 TKTADGKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|261391879|emb|CAX49338.1| conserved hypothetical membrane protein [Neisseria meningitidis
           8013]
          Length = 193

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 53/186 (28%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V + G       I      +  ++  D     M    L     D   Y    
Sbjct: 9   IAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK- 143
           L ++ AK    S    I        +   +       + +  A ++  N  +        
Sbjct: 66  LSSKGAKQFPESSD--IHFDSP--HLVFFQEGSLLYEVGSDEAVYHTENKQVLFKNNVVL 121

Query: 144 MKVKDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
            K  D  R    ++ E   +D ++    +  PV   +      A     ++ +    F+ 
Sbjct: 122 TKTADGKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|171318646|ref|ZP_02907792.1| protein of unknown function DUF1239 [Burkholderia ambifaria MEX-5]
 gi|171096154|gb|EDT41077.1| protein of unknown function DUF1239 [Burkholderia ambifaria MEX-5]
          Length = 204

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/185 (10%), Positives = 48/185 (25%), Gaps = 13/185 (7%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                                 F +++  +    +Y L 
Sbjct: 10  LLPLIAVAALAGITWWLLQATLPPPGEGTARPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L D    +   +     +   A     N     + +    ++  
Sbjct: 70  AAKLI--HYEDTDNSDLTDP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 VAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVV 205
           V   +
Sbjct: 186 VRGTI 190


>gi|241765940|ref|ZP_04763868.1| protein of unknown function DUF1239 [Acidovorax delafieldii 2AN]
 gi|241364113|gb|EER59333.1| protein of unknown function DUF1239 [Acidovorax delafieldii 2AN]
          Length = 205

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 21/199 (10%), Positives = 57/199 (28%), Gaps = 17/199 (8%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRVKY 83
            L  + P   + ++                 +    +       MK F +  +       
Sbjct: 11  RLSLYLPILLMGLLALGTWWLVRNAPAPVAPAAAPGNAHEPDYFMKTFSVKSFDATGRMQ 70

Query: 84  -SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
             +  + A+   ++      L+  +  + +   +       A  A  N     + +    
Sbjct: 71  SEVKGDMARHFADNDT----LEIDQARMRSVTPQGVLTLATADRALSNADGSEVQLFGNA 126

Query: 143 KMKVK----------DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
            +  +            +    E      +   + S  PV++T  +   +A+    ++  
Sbjct: 127 IVTREAAPGAAGKAQPRMEFRSEFLHAFTQTERVRSDQPVVLTRGNDRFTADAMEYDHLD 186

Query: 193 RSAVFAGQVSVVVNPGVLQ 211
           +     G+V  V+ PG  +
Sbjct: 187 QVLQLRGRVRGVLMPGAAR 205


>gi|239947700|ref|ZP_04699453.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921976|gb|EER22000.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 136

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/139 (14%), Positives = 52/139 (37%), Gaps = 6/139 (4%)

Query: 68  MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
           MK  I    +K+   Y +  ERA    ++      L          + +   + + A   
Sbjct: 1   MKDSIFEGVNKNLNAYKIKTERAIKESDNK---YKLDIINAIYNVNQDQ--TLIINAKEG 55

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFAR 187
             +  ++ L +    K+     +  +   A +D+ N  I    P  + + +  ++++   
Sbjct: 56  FLDEESNILDLKNDVKLFFD-EIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFN 114

Query: 188 IENSSRSAVFAGQVSVVVN 206
            ++ +   +F   VS +++
Sbjct: 115 TKDENNIIIFKSNVSTIID 133


>gi|316984360|gb|EFV63334.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325141003|gb|EGC63509.1| hypothetical protein NMBCU385_0314 [Neisseria meningitidis CU385]
 gi|325145149|gb|EGC67431.1| hypothetical protein NMBM01240013_0375 [Neisseria meningitidis
           M01-240013]
 gi|325199548|gb|ADY95003.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325202827|gb|ADY98281.1| conserved hypothetical protein [Neisseria meningitidis M01-240149]
          Length = 181

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 24/181 (13%), Positives = 50/181 (27%), Gaps = 15/181 (8%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---SLVAER 89
              V +         I      +  ++  D     M    L     D   Y    L A+ 
Sbjct: 2   ILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEHLSAKG 58

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK-MKVKD 148
           AK    S    I        +   +       + +  A ++  N  +         K  D
Sbjct: 59  AKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVLTKTAD 114

Query: 149 NL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                 +++ E   +D ++    +  PV   +      A     ++ +    F+ +V   
Sbjct: 115 GKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSSKVKAT 174

Query: 205 V 205
           +
Sbjct: 175 I 175


>gi|241661912|ref|YP_002980272.1| hypothetical protein Rpic12D_0293 [Ralstonia pickettii 12D]
 gi|240863939|gb|ACS61600.1| protein of unknown function DUF1239 [Ralstonia pickettii 12D]
          Length = 210

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/213 (9%), Positives = 55/213 (25%), Gaps = 19/213 (8%)

Query: 16  KYRQHVRFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS 74
              +  R +   L+       + ++      +++ +   +  + +        +  + + 
Sbjct: 2   ASERSQRLVSSVLQIMLRGLPILLMAIVCGVTFLLVQVNTPQTDEAATQPKRHIPDYTMD 61

Query: 75  DYSK------DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
             S          KY         +         +    L V         +   A   +
Sbjct: 62  GISATALDEIGTTKYRFTG--VHMNHYEDDLTYDVTYPALRVYAPDR--PQVTARADLGK 117

Query: 129 FNLANHTLYISQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            N     + +    K+             +  D     + +    + +  PV +     +
Sbjct: 118 MNGDGTIIDLYNNAKVIRAQGPDARQDPLMTADSTYFQVLLNEDIVRTDKPVELHRGPSI 177

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           ++AN     N +R     G V   +      K+
Sbjct: 178 MNANGLTFNNVTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|326319547|ref|YP_004237219.1| hypothetical protein Acav_4775 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323376383|gb|ADX48652.1| protein of unknown function DUF1239 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 205

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/199 (9%), Positives = 55/199 (27%), Gaps = 17/199 (8%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTF--SKSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
            +  + P   + ++                   ++         M+ F + ++  +    
Sbjct: 11  RMSLYLPVVLMGVMALGTWWLVRNAPKPVRPAQTVAPTHEPDYFMRGFSVKNFDANGRLQ 70

Query: 84  -SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
             +  + A+           L+     + +   +       A  A  N     + +    
Sbjct: 71  SEIRGDVAR----HYPDTDTLEIDNAHMRSVALDGRVTVATAKRALTNADASEVQLFGNA 126

Query: 143 KMKVKD----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
            +  +            L+   E     + +  + S+ PV +       +A+    +N  
Sbjct: 127 VVTREPLNRPGREPLPRLQFRGEFLHAWLNSERVRSNQPVTLVRGSDQFTADNMDYDNLD 186

Query: 193 RSAVFAGQVSVVVNPGVLQ 211
           +     G+V  ++ P   +
Sbjct: 187 QIMQLRGRVRGMLIPPQAR 205


>gi|307728396|ref|YP_003905620.1| hypothetical protein BC1003_0325 [Burkholderia sp. CCGE1003]
 gi|307582931|gb|ADN56329.1| protein of unknown function DUF1239 [Burkholderia sp. CCGE1003]
          Length = 203

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/187 (11%), Positives = 53/187 (28%), Gaps = 12/187 (6%)

Query: 30  FFPFATVTIVGWFLLSSW-IRISTFSKSSIDLLD-FEPMIMKKFILSDYSKDR-VKYSLV 86
             P   +  +           +       +   +        KF +S+  +    +Y L 
Sbjct: 10  LIPLVAMAALAGITWWLLQATLPRQGDRPLRPKEHTPDYFADKFSVSELDQSGATQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A+           +  L   +  +   +     +     + R N     + +    ++  
Sbjct: 70  AQSLI--HYEDDELSDL--VKPAMRAFQPGKPIVTATGDTGRVNGDASIVDLYGNARIVR 125

Query: 147 KDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D E   + V +  I +  PV +     V++A+     N +R     G V
Sbjct: 126 SAGNGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGMSVMTASGMNYNNVTRVMQLFGNV 185

Query: 202 SVVVNPG 208
              +   
Sbjct: 186 KGAIAAS 192


>gi|325132908|gb|EGC55585.1| hypothetical protein NMBM6190_0288 [Neisseria meningitidis M6190]
 gi|325136928|gb|EGC59525.1| hypothetical protein NMBM0579_0326 [Neisseria meningitidis M0579]
 gi|325198957|gb|ADY94413.1| conserved hypothetical protein [Neisseria meningitidis G2136]
          Length = 181

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 51/181 (28%), Gaps = 15/181 (8%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---SLVAER 89
              V + G       I      +  ++  D     M    L     D   Y    L A+ 
Sbjct: 2   ILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEHLSAKG 58

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK-MKVKD 148
           AK    S    I        +   +       + +  A ++  N  +         K  D
Sbjct: 59  AKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVLTKTAD 114

Query: 149 NLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             R    ++ E   +D ++    +  PV   +      A     ++ +    F+ +V   
Sbjct: 115 GKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSSKVKAT 174

Query: 205 V 205
           +
Sbjct: 175 I 175


>gi|170700373|ref|ZP_02891383.1| protein of unknown function DUF1239 [Burkholderia ambifaria
           IOP40-10]
 gi|170134717|gb|EDT03035.1| protein of unknown function DUF1239 [Burkholderia ambifaria
           IOP40-10]
          Length = 204

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/185 (10%), Positives = 48/185 (25%), Gaps = 13/185 (7%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                                 F +++  +    +Y L 
Sbjct: 10  LLPLIAVAALAGITWWLLQATLPPPGEGAARPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L D    +   +     +   A     N     + +    ++  
Sbjct: 70  AAKLI--HYEDTENSDLTDP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 VAGGGDPQMQADSQHFRIFVNDDVIKTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVV 205
           V   +
Sbjct: 186 VRGTI 190


>gi|134296984|ref|YP_001120719.1| hypothetical protein Bcep1808_2893 [Burkholderia vietnamiensis G4]
 gi|134140141|gb|ABO55884.1| protein of unknown function DUF1239 [Burkholderia vietnamiensis G4]
          Length = 204

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/185 (10%), Positives = 48/185 (25%), Gaps = 13/185 (7%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                                 F +++  +    +Y L 
Sbjct: 10  LLPLVAVAALAGITWWLLQATLPPPGEGAAQPKRHTPDYFADNFSVTELDQTGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L D    +   +     +   A     N     + +    ++  
Sbjct: 70  AAKLV--HYEDTDDSDLTDP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 VAGGGDPQMQADSQHFRILVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVV 205
           V   +
Sbjct: 186 VRGTI 190


>gi|51244615|ref|YP_064499.1| hypothetical protein DP0763 [Desulfotalea psychrophila LSv54]
 gi|50875652|emb|CAG35492.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 191

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 68/187 (36%), Gaps = 14/187 (7%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWI-------RISTFSKSSIDLLDFEPMIMKKFILSD 75
            I+  K +     +  +  F L           R     K   D++  +  IM+K ++S 
Sbjct: 1   MIRRNKVW--VIPLIFILTFPLWKIPVGNFLSPRGDFNPKGKKDIVQGQSFIMQKVVISQ 58

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
           +  D+    + A++A T   +   I  L D +  +  + +    +   + +A +N     
Sbjct: 59  FEGDKKNTVIRAQKAST--GTTSKIFTLTDIDADLYDETNNITKVR--SKTALYNQGTEI 114

Query: 136 LYISQPFKM-KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           L +     + K+  + +L  +  + + K  +I   D  +I      +          S+ 
Sbjct: 115 LTLLGDVVVTKLDKDQQLFSQKLIHNGKKKSIFCPDKTLIVSGANTIRGGSFFYNLISKD 174

Query: 195 AVFAGQV 201
             F G+V
Sbjct: 175 YAFGGRV 181


>gi|194099433|ref|YP_002002535.1| hypothetical protein NGK_1910 [Neisseria gonorrhoeae NCCP11945]
 gi|193934723|gb|ACF30547.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
          Length = 181

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/181 (13%), Positives = 50/181 (27%), Gaps = 15/181 (8%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---SLVAER 89
              V + G       I      +  ++  D     M    L     D   Y    L A+ 
Sbjct: 2   ILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEHLSAKG 58

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK-MKVKD 148
           AK    +    I        +   +       + +  A ++  N  +         K  D
Sbjct: 59  AKQFPENSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVLTKTAD 114

Query: 149 NL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                 +++ E   +D ++    +  PV   +      A      + +    F+ +V   
Sbjct: 115 GRRQAGKVETEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYNHKTGMLNFSSKVKAA 174

Query: 205 V 205
           +
Sbjct: 175 I 175


>gi|255020584|ref|ZP_05292647.1| protein of unknown function DUF1239 [Acidithiobacillus caldus ATCC
           51756]
 gi|254969969|gb|EET27468.1| protein of unknown function DUF1239 [Acidithiobacillus caldus ATCC
           51756]
          Length = 183

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 53/174 (30%), Gaps = 6/174 (3%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSI--DLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
           + ++   +  +W + +           +      + + +L  Y        L+A  A   
Sbjct: 14  LLVLAALVWWTWPKHAVDLSGIDWHGQIHRGDQSVTQVVLRQYDAAGR-LDLLATAASAY 72

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLD 153
                   FL D  +          D+ L    A  +  +  + +    + +++ +  L 
Sbjct: 73  HEPKDDETFLSDVHIRRFRADG---DLLLSGAHALIHDQSRDVTLWGDVRGRLQPDSTLR 129

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
            +    D  +  + S+DPV +TH    L          ++       V     P
Sbjct: 130 TQKLRYDPASGILRSADPVFLTHGRSTLRGVGLWASVKTQEVRLLHDVEGSYVP 183


>gi|23009302|ref|ZP_00050401.1| hypothetical protein Magn03004219 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 139

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 29/102 (28%), Gaps = 5/102 (4%)

Query: 21  VRFIQFLKFFFPFATVT----IVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY 76
              ++ L+   P A       +    L                 +    + M+   LS +
Sbjct: 35  SARVRMLRRLIPVAAGLAVMGLAAVVLWGPLSGSVPNVSIGPISVSGTKVTMENPRLSGF 94

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYG 118
            K    Y +VA+ A+        II LQ     V T      
Sbjct: 95  RKGERGYEVVADAAQQDVR-KPSIIELQAMTGHVATDDKGGR 135


>gi|325916424|ref|ZP_08178696.1| hypothetical protein XVE_2640 [Xanthomonas vesicatoria ATCC 35937]
 gi|325537344|gb|EGD09068.1| hypothetical protein XVE_2640 [Xanthomonas vesicatoria ATCC 35937]
          Length = 191

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/183 (9%), Positives = 44/183 (24%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             +         S  +      +++        +++ F L    K   K ++     +  
Sbjct: 11  VVLFAAAVISGWSAWQQRARPAAAVVDESKADYVLRDFELITLDKQTGKEAMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN---- 149
            N       +           +      L A +   +     L +    +          
Sbjct: 71  RNRADQTADITTP--VFLLPDNANQPWTLRAKTGWVSPKGDELRLRGDVEGDSPTAGATP 128

Query: 150 -LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 E+  +  +     ++ PV +     + S      +  SR      QV     P 
Sbjct: 129 PTTFRTESLDVFPQQNLAKTAAPVTMRRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|115352899|ref|YP_774738.1| hypothetical protein Bamb_2848 [Burkholderia ambifaria AMMD]
 gi|115282887|gb|ABI88404.1| protein of unknown function DUF1239 [Burkholderia ambifaria AMMD]
          Length = 204

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/185 (10%), Positives = 47/185 (25%), Gaps = 13/185 (7%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                                 F +++  +    +Y L 
Sbjct: 10  LLPLIAVAALAGITWWLLQATLPPPGEGAAQPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L      +   +     +   A     N     + +    ++  
Sbjct: 70  AAKLV--HYEDTDNSDLTAP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 VAGGGDPQMQADSQHFRILVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVV 205
           V   +
Sbjct: 186 VRGTI 190


>gi|288942542|ref|YP_003444782.1| hypothetical protein Alvin_2844 [Allochromatium vinosum DSM 180]
 gi|288897914|gb|ADC63750.1| protein of unknown function DUF1239 [Allochromatium vinosum DSM
           180]
          Length = 204

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/191 (10%), Positives = 54/191 (28%), Gaps = 12/191 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVAE 88
           +   A   ++G         +                 ++     +          L AE
Sbjct: 15  WLLGAGFVLLGLGAWWQLRSLPEDDGVRAPRERRPDYSVQGLAALETDASGQPSRRLSAE 74

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
           R +    + + +  L +  L +          +  A   +       + ++   +   + 
Sbjct: 75  RLR--HYADEDLSELDEPRLVLYRPDG--PPWFAQARLGQVQAGGDQVRLTGAVRFDREA 130

Query: 149 NLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE--NSSRSAVFAGQV 201
           +       L  E   +  +     +  PV I      ++AN  ++     S    F G+ 
Sbjct: 131 DATNRPVHLQTEAMDIWRQTGLAETDLPVRIDSDGDSVTANGMKLWYLEDSSRTSFHGRA 190

Query: 202 SVVVNPGVLQK 212
            + ++P   ++
Sbjct: 191 RIRLSPEPERQ 201


>gi|291287218|ref|YP_003504034.1| hypothetical protein Dacet_1306 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884378|gb|ADD68078.1| protein of unknown function DUF1239 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 179

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 54/180 (30%), Gaps = 14/180 (7%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
           F      V  V    L    + +       D +      M K       +    Y L A+
Sbjct: 8   FLLVIFIVGAVVAVSLFKSDKTNVTINVKKDSVVINNFEMAKV----VDEKNNFYKLNAD 63

Query: 89  RAKTSFNSGK-GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           +A  +  +    ++            +    D+   A    F      +  +   +  + 
Sbjct: 64  QAVLNRKARSADLVDFVLVY------KKGSTDLTASADKG-FLEEEVRMDATGKIQGVIN 116

Query: 148 DNL--RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                  +  +   D +  T      V IT ++  +S++   I N ++S  F G V ++ 
Sbjct: 117 GRDFETGESGSFHYDFETETGVLDGDVTITGTEGTISSDKLFIYNKTKSLEFDGNVKILY 176


>gi|325205430|gb|ADZ00883.1| conserved hypothetical protein [Neisseria meningitidis M04-240196]
          Length = 193

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 53/186 (28%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V + G       I      +  ++  D     M    L     D   Y    
Sbjct: 9   IAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK- 143
           L ++ AK    S    I        +   +       + +  A ++  N  +        
Sbjct: 66  LSSKGAKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVL 121

Query: 144 MKVKDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
            K  D  R    ++ E   +D ++    +  PV   +      A     ++ +    F+ 
Sbjct: 122 TKTADGRRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHETGMLNFSS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|319639070|ref|ZP_07993827.1| hypothetical protein HMPREF0604_01451 [Neisseria mucosa C102]
 gi|317399648|gb|EFV80312.1| hypothetical protein HMPREF0604_01451 [Neisseria mucosa C102]
          Length = 193

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 52/183 (28%), Gaps = 10/183 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVA 87
             FP      +G              +  +   +     MK      + ++      L A
Sbjct: 9   IAFPLVLAVSLGALAAWLGRISEVQVEEVVLNPNEPQYSMKGINGKRFDQEGRLKENLSA 68

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
             A    NS    + L    L+            + +  A +N+ N  +   Q   +   
Sbjct: 69  ADAVQYPNSAD--VHLDKPHLSFYR--DGSLLYEVGSDKAVYNIQNKKVVFEQNVVLNKA 124

Query: 148 DNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            + +     +  E   +D +    ++  PV   +      AN    ++ +    F  +V 
Sbjct: 125 ADAKRLAGIVKTERLNVDTEAQYAHTDSPVTFQYGQSGGQANGMTYDHKTGLLNFPSKVK 184

Query: 203 VVV 205
             +
Sbjct: 185 ATI 187


>gi|120613410|ref|YP_973088.1| hypothetical protein Aave_4783 [Acidovorax citrulli AAC00-1]
 gi|120591874|gb|ABM35314.1| protein of unknown function DUF1239 [Acidovorax citrulli AAC00-1]
          Length = 205

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/194 (9%), Positives = 52/194 (26%), Gaps = 17/194 (8%)

Query: 31  FPFATVTIVGWFLLSSWIRISTF--SKSSIDLLDFEPMIMKKFILSDYSKDRVKY-SLVA 87
            P   + ++                    +         M+ F + ++  +      +  
Sbjct: 16  LPVVLMGLMALGTWWLVRNAPKPVRPAQEVAPTHEPDYFMRGFSVKNFDANGRLQSEIRG 75

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           + A+           L+     + +   +       A  A  N     + +     +  +
Sbjct: 76  DVAR----HYPDTDTLEIDNAHMRSVALDGRVTVATAKRALTNADASEVQLFGNAVVTRE 131

Query: 148 D----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
                       L+   E     + +  + S+ PV +       +A+    +N  +    
Sbjct: 132 PLNRPGRDPLPRLQFRGEFLHAWLNSERVRSNQPVTLIRGSDQFTADNMDYDNLDQIMQL 191

Query: 198 AGQVSVVVNPGVLQ 211
            G+V  ++ P   +
Sbjct: 192 RGRVRGMLIPPPAR 205


>gi|21232230|ref|NP_638147.1| hypothetical protein XCC2799 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767641|ref|YP_242403.1| hypothetical protein XC_1314 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188990757|ref|YP_001902767.1| hypothetical protein xccb100_1361 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113989|gb|AAM42071.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572973|gb|AAY48383.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732517|emb|CAP50711.1| putative exported protein [Xanthomonas campestris pv. campestris]
          Length = 191

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/186 (10%), Positives = 50/186 (26%), Gaps = 10/186 (5%)

Query: 33  FATVTIVGWFL--LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERA 90
              V +    +   S+W + +    +++D       +++ F L    K+  K S+     
Sbjct: 9   LGAVLLAAAIISGWSAWQQRARPVAAAVD-DSKADYVLRDFELIALDKESGKESMTLRAP 67

Query: 91  KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL 150
           +   N       +           +      L + +   +     + +            
Sbjct: 68  EMHRNRADQTSEITTP--VFLLPDNANNPWTLRSKTGWISPKGDEMRLRGDVSGDSPTTG 125

Query: 151 R-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                    E+  +  +     ++ PV +     + S      +  +R      QV    
Sbjct: 126 NTPPTTFRTESLDVFPQQNLAKTAAPVTMRRPGIMQSGVGFEADLKTRQYKLLSQVKTRY 185

Query: 206 NPGVLQ 211
            P   +
Sbjct: 186 EPNAAR 191


>gi|320529933|ref|ZP_08031010.1| hypothetical protein HMPREF9555_01085 [Selenomonas artemidis F0399]
 gi|320137951|gb|EFW29856.1| hypothetical protein HMPREF9555_01085 [Selenomonas artemidis F0399]
          Length = 180

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/176 (10%), Positives = 48/176 (27%), Gaps = 4/176 (2%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           K +        +   ++ +         SS        M  +   LS+    R  ++L A
Sbjct: 3   KKYLYGGAAAFLILLIVWAISTAPQPPTSSEVSDAPRIMSYENNTLSEERDGRTVWTLTA 62

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++     ++      +Q  E    ++      + L A     +     + ++        
Sbjct: 63  QQMTVDIDTQD--TSMQGIEGAFYSEDG--RTLTLHADEGHMDHETRDVVLTGSVNAATS 118

Query: 148 DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           D   L            T+ ++    +   D   + +     +  R     G   +
Sbjct: 119 DGASLMANELQWSSTEGTLTATGDAQVERDDLRATGDRIMSMDEFRQFRIEGNARI 174


>gi|313895189|ref|ZP_07828746.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976084|gb|EFR41542.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 180

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/176 (10%), Positives = 48/176 (27%), Gaps = 4/176 (2%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           K +        +   ++ +         SS        M  +   LS+    R  ++L A
Sbjct: 3   KKYLYGGAAAFLILLIVWAISTAPQPPTSSEVSDAPRIMSYENNTLSEERDGRTVWTLTA 62

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++     ++      +Q  E    ++      + L A     +     + ++        
Sbjct: 63  QQMTVDIDTQD--TSMQGIEGAFYSEDG--RTLTLHADEGHMDHETRDVVLTGSVNAATS 118

Query: 148 DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           D   L            T+ ++    +   D   + +     +  R     G   +
Sbjct: 119 DGASLMANELKWTSTEGTLTATGDAQVERDDLRATGDRIMSMDEFRQFRIEGNARI 174


>gi|253997532|ref|YP_003049596.1| hypothetical protein Mmol_2167 [Methylotenera mobilis JLW8]
 gi|253984211|gb|ACT49069.1| protein of unknown function DUF1239 [Methylotenera mobilis JLW8]
          Length = 239

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/179 (8%), Positives = 42/179 (23%), Gaps = 11/179 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGII 101
              +        K           +M  F  +        +Y L A              
Sbjct: 24  FWINKSVQPLAPKLDGSSRHDPDYMMHNFETTQTDASGALRYKLAA----QEMKHFPDKD 79

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----LRLDFET 156
                +        +     L   +   +     + +     +  +       + ++ + 
Sbjct: 80  STDLVKPRFTRFAKDKPYTRLEGDTGNVSSDGEQVDVLGNVVVLREAYAEKGVMTIETDA 139

Query: 157 AVLDVKNITINSSDPVIITH-SDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
             +        +  PV+I      V+ A     E   ++     +V    +P   + K+
Sbjct: 140 LRILPNQEYATTDRPVVIKQAPGTVVHATGMIYEQKQQTVTLLHKVRAHYDPPAAKAKK 198


>gi|298530338|ref|ZP_07017740.1| protein of unknown function DUF1239 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509712|gb|EFI33616.1| protein of unknown function DUF1239 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 180

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 60/185 (32%), Gaps = 7/185 (3%)

Query: 26  FLKFFFPFATVTIVGWFLLSS--WIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
            LK  FP   +T++  F L S  W       +   D      + ++   L    +D+  +
Sbjct: 1   MLKKAFPII-LTVMLMFFLLSIFWRETPGPRQVDFDQDLEVDLNIRDLTLVQSGRDKKIW 59

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            L A++A   F   + I  LQ+  +T          + + A   R +  + TLY+    K
Sbjct: 60  ELDAKQA--GFMRKENIYLLQEPVMT-YFGEKNGEPVEIRAARGRIDQDSGTLYMWPDVK 116

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
            +    L    E A        +   D V  T     +    A I       V    V  
Sbjct: 117 AR-SGGLYTTSEKATYKEGEGHVLLEDNVSFTGRGMRVDTPRALIMLEEDKIVATQGVRT 175

Query: 204 VVNPG 208
            +   
Sbjct: 176 SIRGN 180


>gi|311695330|gb|ADP98203.1| protein containing DUF1239 [marine bacterium HP15]
          Length = 194

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/189 (11%), Positives = 54/189 (28%), Gaps = 8/189 (4%)

Query: 26  FLKFFFPFATVTIVGWFLLSS-WIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KY 83
           +L+      TV    + L  S    +     +++         +     + + +    K 
Sbjct: 9   WLRTLALAGTVVAAVFLLWQSDEPPVIDDEAAALRGDAEPDGFVVNGNYTSFDESGKLKI 68

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
              + R +        +  ++     +    +    + + A +       + +Y++   +
Sbjct: 69  RFSSPRIEQFEEG--NLATMESPRAELYGGDNVLPWI-VEAENGSLLQNQNLVYLTDNVR 125

Query: 144 MKVKDNLR---LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
           ++     R   L   T  LD     + +  PV I     +  A   +     R      Q
Sbjct: 126 IQRSIGERDATLTTSTLTLDNDRGMVYTDAPVEIRDVTGITRATGMKAWIDERILELNSQ 185

Query: 201 VSVVVNPGV 209
           V      G 
Sbjct: 186 VEGRYETGN 194


>gi|172061747|ref|YP_001809399.1| hypothetical protein BamMC406_2706 [Burkholderia ambifaria MC40-6]
 gi|171994264|gb|ACB65183.1| protein of unknown function DUF1239 [Burkholderia ambifaria MC40-6]
          Length = 204

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/185 (10%), Positives = 47/185 (25%), Gaps = 13/185 (7%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLV 86
             P   V  +                                 F +++  +    +Y L 
Sbjct: 10  LLPLIAVAALAGITWWLLQATLPPPGEGTVRPKRHTPDYFADNFSVTELDQSGTTQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L      +   +     +   A     N     + +    ++  
Sbjct: 70  AAKLI--HYEDTDNSDLTAP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARILR 125

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   ++ D +   + V +  I +  PV +     +++A +  +  N +R     G 
Sbjct: 126 VAGGGDPQMQADSQHFRILVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGN 185

Query: 201 VSVVV 205
           V   +
Sbjct: 186 VRGTI 190


>gi|124514200|gb|EAY55715.1| protein of unknown function [Leptospirillum rubarum]
          Length = 195

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 64/196 (32%), Gaps = 12/196 (6%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD-----FEPMIMKKFI 72
           R+  R  +   F    + V IV   L   +I      +     +D        ++++ F 
Sbjct: 2   RRGERLFRSRFFVLGISAVPIVLTLLYMGFIAHRHLQQRGTVPVDSHPLPEAEVLIRHFH 61

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            S     + K+ + AERA  S    +    + D +  +  +R     + +       +  
Sbjct: 62  YSRTVDGKTKWFVEAERA--SLGKDETQTRIWDLKARIRVRRDLK--LVVTGEKGVIDQV 117

Query: 133 NHTLYISQ---PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
            H  Y+ +   P   +  + L +         +   I +   VII   + ++     +  
Sbjct: 118 RHRFYVEKVTRPVAARFSNGLTVISSHLNYVDRTDQIRTDGHVIILGPNMIIQGKGLKSV 177

Query: 190 NSSRSAVFAGQVSVVV 205
             ++      +V  V 
Sbjct: 178 PRNQMFRIDRKVHAVF 193


>gi|298369554|ref|ZP_06980871.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282111|gb|EFI23599.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 193

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 46/183 (25%), Gaps = 10/183 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVA 87
             FP      +G             ++      +     MK      + +       L +
Sbjct: 9   IAFPLILSVALGGLAAWLGRISEIQTEEVRLNPNEPQYSMKGINGRRFDEAGRLKENLSS 68

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
            +A     S    +        +  ++       + +  A +N  N  +       +  +
Sbjct: 69  PKAWQMPGSND--VHFSSP--QLIFRKEGRLLYQVRSDEAVYNTENKQVVFDNNVILTKE 124

Query: 148 DNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            +              +D +     +  PV   +     +AN    +N      F  +V 
Sbjct: 125 ADAEHPAGVFKTSRLHVDTETEFAKTDAPVAYEYGQSHGTANGMTFDNKKSLLNFPSRVK 184

Query: 203 VVV 205
             +
Sbjct: 185 ATI 187


>gi|261379305|ref|ZP_05983878.1| conserved hypothetical protein [Neisseria subflava NJ9703]
 gi|284797745|gb|EFC53092.1| conserved hypothetical protein [Neisseria subflava NJ9703]
          Length = 193

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 52/183 (28%), Gaps = 10/183 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVA 87
             FP      +G              +  +   +     MK      + ++      L A
Sbjct: 9   IAFPLVLAVSLGALAAWLGRISEVQVEEVVLNPNEPQYSMKGINGKRFDQEGRLKENLSA 68

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
             A    NS    + L    L+            + +  A +N+ N  +   Q   +   
Sbjct: 69  VDAVQYPNSAD--VHLDKPHLSFYR--DGSLLYEVGSDKAAYNIQNKKVVFEQNVVLNKA 124

Query: 148 DNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            + +     +  E   +D +    ++  PV   +      AN    ++ +    F  +V 
Sbjct: 125 ADAKRLAGIVKTERLNVDTEAQYAHTDSPVTFQYGQSSGQANGMTYDHKTGLLNFPSKVK 184

Query: 203 VVV 205
             +
Sbjct: 185 ATI 187


>gi|300692614|ref|YP_003753609.1| hypothetical protein RPSI07_2995 [Ralstonia solanacearum PSI07]
 gi|299079674|emb|CBJ52351.1| conserved exported protein of unknown function [Ralstonia
           solanacearum PSI07]
          Length = 210

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/213 (8%), Positives = 58/213 (27%), Gaps = 19/213 (8%)

Query: 16  KYRQHVRFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS 74
              +  R +   L+       + ++      +++ +   +  + +  +     +  + + 
Sbjct: 2   ASERSQRLVSSLLQVMLRGLPILLMAIVCGVTFLLVQVNTPQTEETANQAKRHVADYTMD 61

Query: 75  DY-----SKDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
                   +    KY         +         +    L V         +   A+  +
Sbjct: 62  GISATALDERGVTKYRFTG--VHMNHYEDDLTYDVTFPALRVYAPDH--PQVTARANLGK 117

Query: 129 FNLANHTLYISQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            N     + +    K+             +  D     + + +  + +  PV +     +
Sbjct: 118 MNGEGSIIDLYDNAKVVRAQGPDPRQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPSI 177

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           ++AN     N +R     G V   +      K+
Sbjct: 178 MNANGLVFNNVTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|56476149|ref|YP_157738.1| hypothetical protein ebA1318 [Aromatoleum aromaticum EbN1]
 gi|56312192|emb|CAI06837.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 193

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 62/189 (32%), Gaps = 13/189 (6%)

Query: 32  PFATVT-IVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAER 89
           P   +  + G  L    I          +       I ++  L  +  D  + Y L+A+R
Sbjct: 10  PVVALVVLAGATLWLERITRDDDGAVRTEQRRAPDFIAEQTRLVSFGADGQQRYELLADR 69

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--- 146
              +     GI  L    L      SE  ++ + A S   +     + +S   ++     
Sbjct: 70  --ITNYPLSGITTLDRPRLRY---DSEGRELRITAQSGEIHEGGSEVLLSGDVRVHRAAT 124

Query: 147 --KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                +    ET  +   +    +SDPVI+T       A   + +N   +      V  V
Sbjct: 125 VGSPAMSFASETLKVWPDDERAETSDPVILTQGKTTAHAGGLKSDNIFGTLDLLDGV-TV 183

Query: 205 VNPGVLQKK 213
           + P   + +
Sbjct: 184 LMPRTSRTQ 192


>gi|319940821|ref|ZP_08015160.1| hypothetical protein HMPREF9464_00379 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805703|gb|EFW02484.1| hypothetical protein HMPREF9464_00379 [Sutterella wadsworthensis
           3_1_45B]
          Length = 230

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 61/204 (29%), Gaps = 12/204 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRI-STFSKSSIDLLD-FEPMIMKKFILSDYS 77
           H R I   +      +  +      S W  I +  +       +     + +   L+D++
Sbjct: 3   HRRMIIRERLTAIIGSAILFALVATSYWYSIQTQVAGLKYVPSEMSPDFLARNVSLTDFT 62

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            +     L    A            ++   + V +        +  A     N    T+ 
Sbjct: 63  PEGTPKLL----AYADDVQHFSDERMRAERIQVISLDPNSAPAFAQADEGWSNDGLETID 118

Query: 138 ISQPF-----KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENS 191
           ++        + + +  +    E     +      +  PV IT      S+ N    +N 
Sbjct: 119 LTGHVLVHRRQYQDQPPMTFTTEHLTGWLDTQRFKTDSPVKITRGADETSSQNGLLYDNV 178

Query: 192 SRSAVFAGQVSVVVNPGVLQKKEN 215
           +R     G V  V +P   +K ++
Sbjct: 179 TRVLELYGGVESVFHPQSFRKADS 202


>gi|285018901|ref|YP_003376612.1| hypothetical protein XALc_2137 [Xanthomonas albilineans GPE PC73]
 gi|283474119|emb|CBA16620.1| hypothetical protein XALc_2137 [Xanthomonas albilineans]
          Length = 188

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/187 (9%), Positives = 55/187 (29%), Gaps = 13/187 (6%)

Query: 33  FATVTIVGWFL--LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAER 89
             ++ +V   +   S+W + S  ++++         + + F +   +K   +  +L A  
Sbjct: 7   LGSILLVAAVISGWSAWNQRSKPARATTAEARS-DYVARDFEVVSLNKQGKEAMTLRAPE 65

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK-- 147
            + S         L           +      + + +   +     L +           
Sbjct: 66  MERSRADQT----LSIVTPLFLLPDANDQHWEMRSKTGWVSADGKELRLRGDVAGDSPKV 121

Query: 148 ---DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                     ++  +  +  +  ++ PV +T    + +     ++  S+      QV   
Sbjct: 122 PSIPPTTFRTQSLDVFPQTNSARTTAPVTMTRPGMMQTGVGLEVDLKSQQYKLLSQVKTR 181

Query: 205 VNPGVLQ 211
             P   +
Sbjct: 182 YEPNAAR 188


>gi|261401802|ref|ZP_05987927.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269208079|gb|EEZ74534.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 192

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 51/186 (27%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V +         I      +  ++  D     M    +   + D   Y    
Sbjct: 9   IAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--IDGRTFDTQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L A+ AK    S    I+     L             + +  A ++  N  +   +   +
Sbjct: 66  LGAKGAKQYPESSD--IYFDSPRLKFYRN--GALLYEVGSGGAVYHTGNKQVSFQKNVVL 121

Query: 145 KVKDNL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                       ++ +   +D ++    +  PV   +      A+    +  +    F  
Sbjct: 122 AQTPEGGRQPGTVETDELHVDTESQYARTDAPVRFRYGASYGRADGMEYDRRTGLLNFPS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|261378336|ref|ZP_05982909.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269145441|gb|EEZ71859.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 193

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 56/192 (29%), Gaps = 17/192 (8%)

Query: 24  IQFLK-FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V + G       I      +  ++  D     M    L     D  
Sbjct: 3   VRWRYGIAFPLILAVALGGLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQ 59

Query: 82  KY---SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
            Y    L ++ AK    S    I  +     +   +       + +  A ++     +  
Sbjct: 60  GYLKEHLSSKGAKQFPESSD--IHFESP--HLSFFQEGRLLYEVGSDEAIYHTETKQVLF 115

Query: 139 SQPFKM-KVKDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                + K  D  R    +  +   +D ++    +  PV   +      A     ++ + 
Sbjct: 116 KNHVVLNKTGDGRRQAGTVKTDKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTG 175

Query: 194 SAVFAGQVSVVV 205
              F+ +V   +
Sbjct: 176 LLNFSSKVKATI 187


>gi|261365379|ref|ZP_05978262.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
 gi|288566175|gb|EFC87735.1| conserved hypothetical protein [Neisseria mucosa ATCC 25996]
          Length = 193

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 53/190 (27%), Gaps = 13/190 (6%)

Query: 24  IQFLK-FFFPF-ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V + G       I      +  ++  +     M       + +   
Sbjct: 3   VRWRYGIAFPLVLAVALGGLSAWLGRISEIDIEEVKLNP-NQPQYTMDGIDGRRFDEQGR 61

Query: 82  -KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
            K  L A  AK    S      L      +   +       + +  A +N     L    
Sbjct: 62  LKEHLSARGAKQFPESTDVHFEL----PHLVFFQEGSRLYDVGSDEAVYNTQTKQLLFKH 117

Query: 141 PFKMKVKDNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              +    + +     +  E   +D ++    +  PV   + +   SA     ++     
Sbjct: 118 NVVLTKAADAKRQAGVVKTELLHVDTESQYAKTDTPVTFQYGESSGSAEGLTYDHKKGLL 177

Query: 196 VFAGQVSVVV 205
            F  +V   +
Sbjct: 178 NFPSRVKATI 187


>gi|309378634|emb|CBX22705.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 193

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 51/186 (27%), Gaps = 16/186 (8%)

Query: 29  FFFPFA-TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---S 84
             FP    V +         I      +  ++  D     M    +   + D   Y    
Sbjct: 9   IAFPLILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--IDGRTFDTQGYLKEH 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L A+ AK    S    I+     L             + +  A ++  N  +   +   +
Sbjct: 66  LGAKGAKQYPESSD--IYFDSPRLKFYRN--GALLYEVGSGGAVYHTGNKQVSFQKNVVL 121

Query: 145 KVKDNL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                       ++ +   +D ++    +  PV   +      A+    +  +    F  
Sbjct: 122 AQTPEGGRQPGTVETDELHVDTESQYARTDAPVRFRYGASYGRADGMEYDRRTGLLNFPS 181

Query: 200 QVSVVV 205
           +V   +
Sbjct: 182 KVKATI 187


>gi|255066044|ref|ZP_05317899.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
 gi|255049589|gb|EET45053.1| conserved hypothetical protein [Neisseria sicca ATCC 29256]
          Length = 193

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 53/190 (27%), Gaps = 13/190 (6%)

Query: 24  IQFLK-FFFPF-ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           +++     FP    V + G       I      +  ++  +     M       + +   
Sbjct: 3   VRWRYGITFPLVLAVALGGLSAWLGRISEIDIEEVKLNP-NQPQYTMDGIDGRRFDEQGR 61

Query: 82  -KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
            K  L A  AK    S      L      +   +       + +  A +N     L    
Sbjct: 62  LKEHLSARGAKQFPESTDVHFEL----PHLVFFQEGSRLYEVGSDEAVYNTQTKQLLFKH 117

Query: 141 PFKMKVKDNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              +    + +     +  E   +D ++    +  PV   + +   SA     ++     
Sbjct: 118 NVVLTKAADAKRQAGVVKTELLHVDTESQYAKTDTPVTFQYGESSGSAEGLTYDHKKGLL 177

Query: 196 VFAGQVSVVV 205
            F  +V   +
Sbjct: 178 NFPSRVKATI 187


>gi|186475098|ref|YP_001856568.1| hypothetical protein Bphy_0329 [Burkholderia phymatum STM815]
 gi|184191557|gb|ACC69522.1| protein of unknown function DUF1239 [Burkholderia phymatum STM815]
          Length = 197

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/193 (10%), Positives = 52/193 (26%), Gaps = 12/193 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDF--EPMIMKKFILSDYSKDRV-KYSLV 86
             P  T+  +                  +              F +S+  +    +Y L 
Sbjct: 9   LVPLITMAALAGVTYWLLQATRPHQDEGLIKPKQHTPDYFADNFSVSELDQSGSTQYRLT 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A  A         +  L      +   +     +     + + N     + +    ++  
Sbjct: 69  A--ANLVHYEDDEVSDL--IRPAMRAFQPAKPVVTATGDTGKVNGDVSIVDLYGNARIVR 124

Query: 147 KDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
           +       ++ D     + V +  I +  PV +     +++A+     N +R     G V
Sbjct: 125 EAGGGDPRMQADSSHFRVLVNDDVIETEKPVKLQRGQSIMTASGMNYNNVTRVIQLFGNV 184

Query: 202 SVVVNPGVLQKKE 214
              + P      +
Sbjct: 185 RGAIAPADSGGSQ 197


>gi|77361463|ref|YP_341038.1| hypothetical protein PSHAa2548 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876374|emb|CAI87596.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 185

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/185 (9%), Positives = 56/185 (30%), Gaps = 10/185 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYS 84
             +       +  + W     + +++T +K+  +++        +   + + ++    + 
Sbjct: 3   IARIVLSVLFIGCMVWLWYPYFTQVNTVAKADSEVIAKPDYTAIELKQTAFDENGEISHK 62

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + A +  T      G    +    T            + A  A        L +      
Sbjct: 63  VTAVK--TELYEQLGFTLFEKP--TFILYDDRQKTWRINADEATL-YDERQLILEGNVTA 117

Query: 145 KVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
           +   +     ++  +   +D+  +T+ S  PVIIT  +  ++        ++        
Sbjct: 118 QNLIDGAMIDKITADNIQVDIMLLTMRSEQPVIITGPNLKITGKGLEANLTTEVIKLINH 177

Query: 201 VSVVV 205
              + 
Sbjct: 178 TRTLY 182


>gi|206602318|gb|EDZ38799.1| Protein of unknown function [Leptospirillum sp. Group II '5-way
           CG']
          Length = 195

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 64/196 (32%), Gaps = 12/196 (6%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD-----FEPMIMKKFI 72
           R+  R  +   F    + V IV   L   +I      +     +D        ++++ F 
Sbjct: 2   RRGERLFRSRFFVLGISAVPIVLTLLYMGFIAHRHLQQRGTVPVDSHPLPEAEVLIRHFH 61

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            S     + K+ + AERA  S    +    + D +  +  ++     + +       +  
Sbjct: 62  YSRTVDGKTKWFVEAERA--SLGKDETQTRIWDLKARIRVRKDLK--LIVTGERGVIDQV 117

Query: 133 NHTLYISQ---PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
            H  Y+ +   P   +  + L +         +   I +   VII   + ++     +  
Sbjct: 118 RHRFYVEKVTRPVSARFSNGLTVISSHLKYVDRTDQIRTDGHVIILGPNMIIQGKGLKSV 177

Query: 190 NSSRSAVFAGQVSVVV 205
             ++      +V  V 
Sbjct: 178 PRNQMFRIDRKVHAVF 193


>gi|218779214|ref|YP_002430532.1| hypothetical protein Dalk_1364 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760598|gb|ACL03064.1| protein of unknown function DUF1239 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 190

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/185 (11%), Positives = 57/185 (30%), Gaps = 11/185 (5%)

Query: 30  FFPFATVTIVGWFL------LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
                   ++   +      L         +    ++ +   M++ K         ++++
Sbjct: 11  IIYLMAGFLIALIIGPMVGRLYMKDDGGQTTVEKTEISEDGGMVLTKLHHEAVRDGKLEW 70

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            L A  A+ +     G  +     L +    ++  +  + A     N   H   +    +
Sbjct: 71  MLDAASAELTELGKSGRFY----NLGIMLYGADKSETKVTAKYGEVNFFTHDFMLKHAVE 126

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
              K    L  +      +  ++ S   V I      L+A+  + +  ++ A F G V  
Sbjct: 127 ATNKP-YSLTSDKLEYSNEKQSLYSPGRVRIKGPSVYLTADSMQYDLKNKQAEFRGNVVA 185

Query: 204 VVNPG 208
           ++   
Sbjct: 186 ILGGS 190


>gi|206559209|ref|YP_002229970.1| hypothetical protein BCAL0816 [Burkholderia cenocepacia J2315]
 gi|198035247|emb|CAR51122.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 204

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/184 (10%), Positives = 48/184 (26%), Gaps = 13/184 (7%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRV-KYSLVA 87
            P   V  +                                 F +++  +    +Y L A
Sbjct: 11  LPLVAVAALAGVTWWLLQATLPPPGEGAVQPKRHTPDYFADNFSVTELDQTGTTQYRLTA 70

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV- 146
            +             L D    +   +     +   A     N     + +    ++   
Sbjct: 71  AKLV--HYEDTEGSDLTDP--AMRAFQPGKPVVTTTAKRGTVNGDVSIVDLYDDARILRA 126

Query: 147 ----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQV 201
                  ++ D +   + V +  I +  PV +     +++A +  +  N +R     G V
Sbjct: 127 AGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVNATDGMKYNNVTRVIELYGNV 186

Query: 202 SVVV 205
              +
Sbjct: 187 RGTI 190


>gi|187927373|ref|YP_001897860.1| hypothetical protein Rpic_0266 [Ralstonia pickettii 12J]
 gi|309779926|ref|ZP_07674680.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|187724263|gb|ACD25428.1| protein of unknown function DUF1239 [Ralstonia pickettii 12J]
 gi|308921285|gb|EFP66928.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 210

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/213 (9%), Positives = 55/213 (25%), Gaps = 19/213 (8%)

Query: 16  KYRQHVRFIQ-FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS 74
              +  R +   L+       + ++      +++ +   +  + +           + + 
Sbjct: 2   ASERSQRLVSSVLQIMLRGLPILLMAIVCGVTFLLVQVNTPQTDEAATQPKRHTADYTMD 61

Query: 75  DYSK------DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
             S          KY         +         +    L V         +   A   +
Sbjct: 62  GISATALDETGTTKYRFTG--VHMNHYEDDLTYDVTYPALRVYAPDR--PQVTARADLGK 117

Query: 129 FNLANHTLYISQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            N     + +    K+             +  D     + + +  + +  PV +     +
Sbjct: 118 MNGDGTVVDLYNNAKVIRAQGSDARQDPLMTADSTYFQVLLNDDIVRTDKPVELHRGPSI 177

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           ++AN     N +R     G V   +      K+
Sbjct: 178 MNANGLTFNNVTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|209521315|ref|ZP_03270032.1| protein of unknown function DUF1239 [Burkholderia sp. H160]
 gi|209498261|gb|EDZ98399.1| protein of unknown function DUF1239 [Burkholderia sp. H160]
          Length = 195

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 50/187 (26%), Gaps = 12/187 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRI--STFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLV 86
             P   +  +             +                   F +S+  +    +Y L 
Sbjct: 9   LIPLIAMAALAGITWWLLQATMPNKTDNEVRPKEHTPDYFADNFSVSELDQSGATQYRLT 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A+              L   +  +   +     +     +   N     + + +  ++  
Sbjct: 69  AQSLI--HYEDDETSDL--VKPAMRAFQPGKPIVTATGDTGTVNADASIVNLYENARILR 124

Query: 147 KDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D E   + V +  I +  PV +     V++A+  +  N +R     G V
Sbjct: 125 APGGGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGMSVMTASGMKYNNVTRFMQLFGNV 184

Query: 202 SVVVNPG 208
              +   
Sbjct: 185 RGAIAAS 191


>gi|225075758|ref|ZP_03718957.1| hypothetical protein NEIFLAOT_00774 [Neisseria flavescens
           NRL30031/H210]
 gi|224952924|gb|EEG34133.1| hypothetical protein NEIFLAOT_00774 [Neisseria flavescens
           NRL30031/H210]
          Length = 193

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 52/183 (28%), Gaps = 10/183 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVA 87
             FP      +G              +  +   +     MK      + ++      L A
Sbjct: 9   IAFPLVLAVSLGALAAWLGRISEVQVEEVVLNPNEPQYAMKGINGKRFDQEGRLKENLSA 68

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
             A    NS    + L    L+            + +  A +N+ N  +   Q   +   
Sbjct: 69  VDAVQYPNSAD--VHLDKPHLSFYR--DGSLLYEVGSDKAAYNIQNKKVVFEQNVVLNKA 124

Query: 148 DNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            + +     +  E   +D +    ++  PV   +      AN    ++ +    F  +V 
Sbjct: 125 ADAKRLAGIVKTERLNVDTEAQYAHTDSPVTFQYGQSGGQANGMTYDHKTGLLNFPSKVK 184

Query: 203 VVV 205
             +
Sbjct: 185 ATI 187


>gi|91790718|ref|YP_551670.1| hypothetical protein Bpro_4896 [Polaromonas sp. JS666]
 gi|91699943|gb|ABE46772.1| protein of unknown function DUF1239 [Polaromonas sp. JS666]
          Length = 236

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 65/206 (31%), Gaps = 15/206 (7%)

Query: 14  RSKYRQHVRFIQFLKFFFPFA--TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKF 71
           R  +R+  R    +  + P        +G + L     I +  + + ++       M KF
Sbjct: 20  RRSWRRAYRLWDSIAIYMPLLMMGALALGTYWLVRNTPIFSAPEQAKEVSHDVDYFMHKF 79

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
            +  + +      L +E              L+  +  + +  +E       A+ A  N 
Sbjct: 80  TVKTFDEGGK---LKSEVYGVEARHFPDTDILEIDQARIRSINAEGQITTATANRAYSNG 136

Query: 132 ANHTLYISQPFKM----------KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
               + ++   ++          K    L    E     +    + S  PV++       
Sbjct: 137 DGSEVQLTGNARVVREASQDASGKQTPRLEFRGEFLHAFLNEERVKSHKPVLLIRGTDQF 196

Query: 182 SANFARIENSSRSAVFAGQVSVVVNP 207
           + +    +N  + A   G+V  V+ P
Sbjct: 197 TGDNFAYDNLDQVADLKGRVRGVLVP 222


>gi|70728300|ref|YP_258049.1| hypothetical protein PFL_0918 [Pseudomonas fluorescens Pf-5]
 gi|68342599|gb|AAY90205.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 190

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/191 (7%), Positives = 46/191 (24%), Gaps = 10/191 (5%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            + I+ +   F    +        +           +          +       Y  D 
Sbjct: 3   SKKIRNI-LIFGTIALLFAAVGYWNISPERFLDKPVAQVDESAIDYYVINARSVQYLPDG 61

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
             +Y + +++ +        +  L   +L +          ++ +     N     + + 
Sbjct: 62  KLQYEMTSDKVE--HVKASEVTLLTKPDLQMYR--GTTFPWHVQSERGEVNPDGTEVELI 117

Query: 140 QPFKM----KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++    +   NL +      +  +     +   V I  +  V +A   +        
Sbjct: 118 DSVRVSRTDEHNRNLLITTTRMTVFPQKQYAQTEQAVRIDGAGGVTTAKGMKAYLKDGRM 177

Query: 196 VFAGQVSVVVN 206
                V     
Sbjct: 178 NLLSNVRGQYE 188


>gi|325203466|gb|ADY98919.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 181

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/181 (12%), Positives = 50/181 (27%), Gaps = 15/181 (8%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---SLVAER 89
              V +         I      +  ++  D     M    L     D   Y    L ++ 
Sbjct: 2   ILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--LDGRRFDEQGYLKEHLSSKG 58

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK-MKVKD 148
           AK    S    I        +   +       + +  A ++  N  +         K  D
Sbjct: 59  AKQFPESSD--IHFDSP--HLVFFQEGRLLYEVGSDEAVYHTENKQVLFKNNVVLTKTAD 114

Query: 149 NL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                 +++ E   +D ++    +  PV   +      A     ++ +    F+ +V   
Sbjct: 115 GKRQAGKVEAEKLHVDTESQYAQTDTPVSFQYGASHGQAGGMTYDHKTGMLNFSSKVKAT 174

Query: 205 V 205
           +
Sbjct: 175 I 175


>gi|149378027|ref|ZP_01895751.1| hypothetical protein MDG893_01460 [Marinobacter algicola DG893]
 gi|149357682|gb|EDM46180.1| hypothetical protein MDG893_01460 [Marinobacter algicola DG893]
          Length = 196

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 57/192 (29%), Gaps = 13/192 (6%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK 82
           +++ L        +  +      S         +++         +       + +    
Sbjct: 11  WVRTLGLAVTIVALFFLL---WQSDESSEPVDAAALRGESEPDGFVVNGRYLSFDETGR- 66

Query: 83  YSLVA--ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             L A  E  +      +    ++    T+           + A+  +F  A+  +Y++ 
Sbjct: 67  --LTAHFESPRIEQFEARNETIMESPNATLYGDPGN-APWEVQANKGQFMEADDLVYLTG 123

Query: 141 PFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             ++  +      L L   T  LD    T+ +  PV +T S  +  A   +     R   
Sbjct: 124 DVRVSQQPQGGRPLTLTTSTLTLDNTKRTVYTDAPVELTDSFSLTRATGMKAWIDDRILE 183

Query: 197 FAGQVSVVVNPG 208
              +V     PG
Sbjct: 184 LDSEVEGRYEPG 195


>gi|319765044|ref|YP_004128981.1| hypothetical protein Alide_4396 [Alicycliphilus denitrificans BC]
 gi|330827236|ref|YP_004390539.1| hypothetical protein Alide2_4723 [Alicycliphilus denitrificans
           K601]
 gi|317119605|gb|ADV02094.1| protein of unknown function DUF1239 [Alicycliphilus denitrificans
           BC]
 gi|329312608|gb|AEB87023.1| protein of unknown function DUF1239 [Alicycliphilus denitrificans
           K601]
          Length = 213

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/203 (10%), Positives = 56/203 (27%), Gaps = 15/203 (7%)

Query: 19  QHVRFIQFLKFFFPFATVTIVGWFLLSSWIRIS-TFSKSSIDLLD-FEPMIMKKFILSDY 76
           +  R  + L  + P   + ++                 +    +       M+ F + ++
Sbjct: 4   RLRRAWERLSIYLPVLLMGLLALGTWWLVRNAPQPPQPAQERPVRHEPDYFMRDFAVRNF 63

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
                   L +E   T          L+  +  + +   +       A+ A  N     +
Sbjct: 64  DATGR---LQSEIRGTLARHYADTDTLEIDQARLRSVSVDGRVTTASANRALSNADGSEV 120

Query: 137 YISQPFKMKVKD----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            +     +  +            L L  E          + ++ PV +     + +A+  
Sbjct: 121 QLFGNAIVVREPLERAGQAPLPRLELRSEFLHAWTNEERVRTNQPVTLKRGVDIFTADGL 180

Query: 187 RIENSSRSAVFAGQVSVVVNPGV 209
             +N  +     G+V   + P  
Sbjct: 181 DYDNLDQILNLRGRVRGTLLPAT 203


>gi|241760779|ref|ZP_04758870.1| conserved hypothetical protein [Neisseria flavescens SK114]
 gi|241318676|gb|EER55228.1| conserved hypothetical protein [Neisseria flavescens SK114]
          Length = 193

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 52/183 (28%), Gaps = 10/183 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVA 87
             FP      +G              +  +   +     MK      + ++      L A
Sbjct: 9   IAFPLVLAVSLGALAAWLGRISEVQVEEVVLNPNEPQYSMKGINGKRFDQEGRLKENLSA 68

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
             A    NS    + L    L+            + +  A +N+ N  +   Q   +   
Sbjct: 69  VDAVQYPNSAD--VHLDKPHLSFYR--DGSLLYEVGSDKAAYNIQNKKVVFEQNVVLNKA 124

Query: 148 DNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            + +     +  E   +D +    ++  PV   +      AN    ++ +    F  +V 
Sbjct: 125 ADAKRLAGIVKTERLNVDTEAQYAHTDSPVTFQYGQSGGQANGMTYDHKTGLLNFPSKVK 184

Query: 203 VVV 205
             +
Sbjct: 185 ATI 187


>gi|300705235|ref|YP_003746838.1| hypothetical protein RCFBP_21077 [Ralstonia solanacearum CFBP2957]
 gi|299072899|emb|CBJ44255.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CFBP2957]
          Length = 210

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/203 (8%), Positives = 53/203 (26%), Gaps = 18/203 (8%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY-----SKD 79
             L+       + ++      +++ +   +  + +        +  + +         + 
Sbjct: 12  SLLQIMLRGLPILLMALVCGVTFLLVQVNTPQTEETASQAKRHVADYTMDGISATALDER 71

Query: 80  R-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
              KY         +         +    L +         +   A   + N     + +
Sbjct: 72  GVTKYRFTG--VHMNHYEDDLTYDVTFPALRIYAPDR--PQVTARADLGKMNGEGTIIDL 127

Query: 139 SQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
               K+             +  D     + + +  + +  PV +     V++AN     N
Sbjct: 128 YDNAKVIRAQGPDLRQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPSVMNANGLVFNN 187

Query: 191 SSRSAVFAGQVSVVVNPGVLQKK 213
            +R     G V   +      K+
Sbjct: 188 VTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|121998902|ref|YP_001003689.1| hypothetical protein Hhal_2123 [Halorhodospira halophila SL1]
 gi|121590307|gb|ABM62887.1| protein of unknown function DUF1239 [Halorhodospira halophila SL1]
          Length = 187

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/182 (10%), Positives = 51/182 (28%), Gaps = 9/182 (4%)

Query: 30  FFPFATVT-IVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            FP AT+  IV   LL +         ++    +     ++ F + D+ +   +    A 
Sbjct: 6   LFPLATLGFIVLLSLLLTRDPTPPEPDTTEPPEERPDFFLEGFTMVDFDEQGQR---RAA 62

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK--- 145
               +     G   L+  E  +  +  +       A           + +     +    
Sbjct: 63  LHGHTGEHFPGRGELEIVEPDLRMRSRDGATWEARAPFGIAEREGAEVRLFDEVDIHRPA 122

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
              +  L +     ++D++     +++ V        L      ++  +        V  
Sbjct: 123 QGTRPALDIATRNLLVDLRAGEARTTEAVTAREPAGTLRGTGMTLDYRTDRLRLHADVRG 182

Query: 204 VV 205
             
Sbjct: 183 EY 184


>gi|330964014|gb|EGH64274.1| hypothetical protein PSYAC_05100 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 190

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/188 (8%), Positives = 44/188 (23%), Gaps = 10/188 (5%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFS-KSSIDLLDFEPMIMKKFILSDYSKDRV-K 82
           +  KF        ++      +    S      +                  Y  D   +
Sbjct: 5   KLRKFLLFGILAVLLAAVGYWNISPESFMDRPITSVDDTVIDYYAINTRSVQYLPDGTLQ 64

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y + A++ +        +  L    L +          ++ +     + A   + +    
Sbjct: 65  YDMTADKVE--HVKATDVSLLTTPNLHMYR--GGEFPWHVNSKRGEVSSAGDQVELIDDV 120

Query: 143 KMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           +++  D       +      +  +     +   V I  +  V +A   +           
Sbjct: 121 RVERTDEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDLL 180

Query: 199 GQVSVVVN 206
             V     
Sbjct: 181 SNVRGQYE 188


>gi|82701222|ref|YP_410788.1| hypothetical protein Nmul_A0087 [Nitrosospira multiformis ATCC
           25196]
 gi|82409287|gb|ABB73396.1| Protein of unknown function DUF1239 [Nitrosospira multiformis ATCC
           25196]
          Length = 190

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 51/182 (28%), Gaps = 8/182 (4%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAER 89
           F             L +    +         +     +++ F      ++   Y ++  +
Sbjct: 9   FLFVIVALFASLLTLLNQDGPTPLLAPESISVRAPDYVVEDFSAIRTDENDAGYKMLLGK 68

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
               +        L+     + T       + L A +A+ +     +Y+S    +     
Sbjct: 69  KMVHYP-DDDSAELEQPR--LITIEPGKPSVQLQADNAKMSAEGEDIYLSGNVVIVRNAG 125

Query: 150 L-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                  L      L        +  PV IT ++  + A    + N +       QV VV
Sbjct: 126 KGRGETILTTSLLHLIPDQDIARTDKPVEITETNATIRAIGMEMNNRTGHTELLSQVKVV 185

Query: 205 VN 206
            +
Sbjct: 186 HD 187


>gi|28198548|ref|NP_778862.1| hypothetical protein PD0640 [Xylella fastidiosa Temecula1]
 gi|182681228|ref|YP_001829388.1| hypothetical protein XfasM23_0673 [Xylella fastidiosa M23]
 gi|28056632|gb|AAO28511.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182631338|gb|ACB92114.1| protein of unknown function DUF1239 [Xylella fastidiosa M23]
 gi|307579675|gb|ADN63644.1| hypothetical protein XFLM_08760 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 189

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 49/192 (25%), Gaps = 12/192 (6%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
             L      A +        S+W +      + +  +      ++ F L        K S
Sbjct: 5   SILNIMLLLAAIVSG----WSAWHQRKHTQATPLRDI-AADYTLQDFKLVALDTQTGKES 59

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L            +     +                 L A +   N     L +    K 
Sbjct: 60  LT--LLGQQMQHNQTDSSAEVTAPLFMIPDQAGQHWTLQAQTGWINKDGTLLRLRHDVKG 117

Query: 145 KVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
               +          ++  +   +    ++D V ITH   + +     +   ++   F  
Sbjct: 118 DSPTDLGQLPTTFRTQSLDIYPNHHLAKTTDAVTITHQGIIQTGVGFEVNTKTQQYKFNS 177

Query: 200 QVSVVVNPGVLQ 211
           +V+    P   +
Sbjct: 178 KVNTRYEPSAAR 189


>gi|295675418|ref|YP_003603942.1| protein of unknown function DUF1239 [Burkholderia sp. CCGE1002]
 gi|295435261|gb|ADG14431.1| protein of unknown function DUF1239 [Burkholderia sp. CCGE1002]
          Length = 195

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/187 (11%), Positives = 50/187 (26%), Gaps = 12/187 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRIST--FSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLV 86
             P   +  +                                 F +S+  +    +Y L 
Sbjct: 9   LIPLIAMAALAGITWWLLQATLPRKTDNEVRSKEHTPDYFADNFSVSELDQSGATQYRLT 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A+           +  L   +  +   +     +     +   N     + + Q  ++  
Sbjct: 69  AQSLI--HYEDDEMSDL--VKPAMRAFQPGKPIVTATGDTGTVNADASIVNLYQNARILR 124

Query: 147 KDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   ++ D E   + V +  I +  PV +     V++A+  +  N +R     G V
Sbjct: 125 APGGGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGMSVMTASGMKYNNVTRFMQLFGNV 184

Query: 202 SVVVNPG 208
              +   
Sbjct: 185 RGAIAAS 191


>gi|28871585|ref|NP_794204.1| hypothetical protein PSPTO_4450 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213966609|ref|ZP_03394760.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301383118|ref|ZP_07231536.1| hypothetical protein PsyrptM_10802 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302133820|ref|ZP_07259810.1| hypothetical protein PsyrptN_20619 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28854837|gb|AAO57899.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213928459|gb|EEB62003.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|331016690|gb|EGH96746.1| hypothetical protein PLA106_11680 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 190

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 16/183 (8%), Positives = 42/183 (22%), Gaps = 9/183 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
             F    V +      +           S                  Y  D   +Y + A
Sbjct: 10  LLFGVLAVLLAAVGYWNISPESFMDRPISSVDDTVIDYYAINTRSVQYLPDGTLQYDMTA 69

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++ +    +   +  L    L +          ++ +     + A   + +    +++  
Sbjct: 70  DKVEHVMAT--DVSLLTTPNLHMYR--GGEFPWHVTSKRGEVSSAGDQVELIDDVRVERT 125

Query: 148 DNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           D       +      +  +     +   V I  +  V +A   +             V  
Sbjct: 126 DEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRG 185

Query: 204 VVN 206
              
Sbjct: 186 QYE 188


>gi|83746571|ref|ZP_00943621.1| Hypothetical Protein RRSL_03743 [Ralstonia solanacearum UW551]
 gi|83726705|gb|EAP73833.1| Hypothetical Protein RRSL_03743 [Ralstonia solanacearum UW551]
          Length = 210

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/203 (8%), Positives = 53/203 (26%), Gaps = 18/203 (8%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY-----SKD 79
             L+       + ++      +++ +   +  + +        +  + +         + 
Sbjct: 12  SLLQVMLRGLPILLMALVCGVTFLLVQVNTPQTEETASQAKRHVADYTMDGISATALDER 71

Query: 80  R-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
              KY         +         +    L +         +   A   + N     + +
Sbjct: 72  GVTKYRFTG--VHMNHYEDDLTYDVTFPALRIYAPDR--PQVTARADLGKMNGEGTIIDL 127

Query: 139 SQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
               K+             +  D     + + +  + +  PV +     V++AN     N
Sbjct: 128 YDNAKVIRAQGPDLHQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPSVMNANGLVFNN 187

Query: 191 SSRSAVFAGQVSVVVNPGVLQKK 213
            +R     G V   +      K+
Sbjct: 188 VTRQVQLLGNVRGRIEGLGAPKQ 210


>gi|322514084|ref|ZP_08067155.1| hypothetical protein HMPREF0027_0907 [Actinobacillus ureae ATCC
           25976]
 gi|322120101|gb|EFX92072.1| hypothetical protein HMPREF0027_0907 [Actinobacillus ureae ATCC
           25976]
          Length = 207

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/199 (10%), Positives = 49/199 (24%), Gaps = 21/199 (10%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSK 78
            L          + GW++       +   +                  +        Y  
Sbjct: 4   RLNIILLVIAAALGGWYMSQQTPETNGLDQLIKKEG--------NPDYTGNKMTTSVYDL 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
                   A+  +             +  + +   ++      + A  A        L +
Sbjct: 56  KGNPQYF-AQADEIKRYESSERTEFLNPFVDLFDAQTALKQWKVSAKHAEI-TKEKMLNL 113

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           S   K++         R++ +   +D+    I +   V      F  S    +     + 
Sbjct: 114 SGDVKIEALDPTSRLQRVETDKLTVDLNTQDIFTDSAVKSVGLGFTTSGVGLKGNLKQQV 173

Query: 195 AVFAGQVSVVVNPGVLQKK 213
           A     V   + P V+++ 
Sbjct: 174 ATLTKNVKTYIEPTVIRQS 192


>gi|71897588|ref|ZP_00679833.1| Protein of unknown function DUF1239 [Xylella fastidiosa Ann-1]
 gi|71732491|gb|EAO34544.1| Protein of unknown function DUF1239 [Xylella fastidiosa Ann-1]
          Length = 189

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 49/192 (25%), Gaps = 12/192 (6%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
             L      A +        S+W +      + +  +      ++ F L        K S
Sbjct: 5   SILNIMLLLAAIVSG----WSAWHQRKHTQATPLRDI-AADYTLQDFKLVALDTQTGKES 59

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L            +     +                 L A +   N     L +    K 
Sbjct: 60  LT--LLGQQMQHNQTDSSAEVTAPLFMIPDQARQHWTLQAQTGWINKDGTLLRLRHDVKG 117

Query: 145 KVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
               +          ++  +   +    ++D V ITH   + +     +   ++   F  
Sbjct: 118 DSPTDLGQLPTTFRTQSLDIYPNHHLAKTTDAVTITHQGIIQTGVGFEVNTKTQQYKFNS 177

Query: 200 QVSVVVNPGVLQ 211
           +V+    P   +
Sbjct: 178 KVNTRYEPSAAR 189


>gi|89075263|ref|ZP_01161690.1| hypothetical protein SKA34_22639 [Photobacterium sp. SKA34]
 gi|89048944|gb|EAR54512.1| hypothetical protein SKA34_22639 [Photobacterium sp. SKA34]
          Length = 187

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 52/193 (26%), Gaps = 19/193 (9%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
           LK       V    W   +   ++           +       K +          + L 
Sbjct: 3   LKRLLYVLLVIFCAWLGYNQLEQLWQKDHQVKPDDE-------KPMFIGNDISNTTFDLS 55

Query: 87  AERAKTSFN------SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             R+    +         G        L V  +  +  +  + + +A  +  N+ L +  
Sbjct: 56  GIRSYQIDSDHLEYFEKSGETDFIKPVLWVF-KEGKNAEWRISSDTAILD-KNNVLNLHG 113

Query: 141 PFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             +M       D   +  +   L+++    N+ D V+IT   F    +        + A 
Sbjct: 114 NVRMFNLLPDSDIQVIKTDNLQLNIETQDFNTQDHVMITGPAFQNQGDGMMGNMKRKVAK 173

Query: 197 FAGQVSVVVNPGV 209
               V     P  
Sbjct: 174 LLKNVKSRYEPTE 186


>gi|152990526|ref|YP_001356248.1| hypothetical protein NIS_0779 [Nitratiruptor sp. SB155-2]
 gi|151422387|dbj|BAF69891.1| hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 166

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/179 (10%), Positives = 53/179 (29%), Gaps = 17/179 (9%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
           +++F        +    L  W       K  +     E ++   F+   ++ D   + L 
Sbjct: 1   MRYFLFLG----LIVCYLLVWFIFFKPFKYEVRPSVQESVVFYDFLYRSFAIDGSSFVLQ 56

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
            ++           I +      +  +  E     + A    F+   +++ +        
Sbjct: 57  GKKGVKRSKE----IEVIQP---IAYRNGEK----ITAQKGIFHQDKNSIDLFDKIVYL- 104

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                L    A  D+ +  ++   P +I    + +     ++         + +V  ++
Sbjct: 105 GKEYTLKSSKAHYDISSEILSIDSPFVIESDRYTIFGKELKVNKKLGRIW-SKKVKAII 162


>gi|325922182|ref|ZP_08183970.1| hypothetical protein XGA_2991 [Xanthomonas gardneri ATCC 19865]
 gi|325547352|gb|EGD18418.1| hypothetical protein XGA_2991 [Xanthomonas gardneri ATCC 19865]
          Length = 191

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/183 (9%), Positives = 42/183 (22%), Gaps = 7/183 (3%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             +         S  +       +         +++ F L    K   K S+     +  
Sbjct: 11  VVLFAAAVISGWSAWQQRARPVVAAVDDSRADYVLRDFELIALDKQTGKESMTLRAPEMH 70

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR-- 151
            N       +           +      L + +   +     L +               
Sbjct: 71  RNRADQTSDITTP--VFLLPDNANQPWTLRSKTGWISPKGDELRLRGDVSGDSPTTGATP 128

Query: 152 ---LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
                 ++  +  +     ++ PV ++    + S      +  SR      QV     P 
Sbjct: 129 PTTFRTQSLDVFPQQNLAKTAAPVSMSRPGIMQSGVGFEADLKSRQYKLLSQVKTRYEPN 188

Query: 209 VLQ 211
             +
Sbjct: 189 AAR 191


>gi|119897083|ref|YP_932296.1| hypothetical protein azo0792 [Azoarcus sp. BH72]
 gi|119669496|emb|CAL93409.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 192

 Score = 64.0 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 64/191 (33%), Gaps = 16/191 (8%)

Query: 32  PFATVTIVG-WFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAER 89
           P   + ++    +    +  +    ++         I ++  L  + KD   +Y LV+ER
Sbjct: 9   PVIALALLAGASVWLERVSRNDTPAAAPAQQTGPDFIAEQTRLIGFGKDGNIRYELVSER 68

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK-- 147
           +          I L    L +    SE     + A     +     + +S   +++    
Sbjct: 69  SAHFPQGDITRIAL--PRLVMF---SEGRATRVTAAQGEVSPGGERVDLSGAVRVRRGGD 123

Query: 148 ---DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                L LD ET  +   +    S  PV + H      A     +N   +    GQ  V 
Sbjct: 124 GNGSELALDSETLSVWPDDHRAESQSPVSLVHGRNTAQAQGMHADNLFGTLELIGQARVR 183

Query: 205 VNPGVLQKKEN 215
           +     +++EN
Sbjct: 184 L----PRRQEN 190


>gi|239818250|ref|YP_002947160.1| hypothetical protein Vapar_5292 [Variovorax paradoxus S110]
 gi|239804827|gb|ACS21894.1| protein of unknown function DUF1239 [Variovorax paradoxus S110]
          Length = 211

 Score = 64.0 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/196 (11%), Positives = 56/196 (28%), Gaps = 15/196 (7%)

Query: 29  FFFP--FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
            + P        +G + L           +           M+ F++ ++  +     L 
Sbjct: 17  IYLPIILTAAVALGTYWLVRNAPKLLAPTAKAAPTHEPDYFMRGFVIKNFLPNGD---LR 73

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-- 144
           +E              ++  ++ + +   +    +  A+    N     + +     +  
Sbjct: 74  SELHGKEGRHYPDTDTVEVDDVRMRSVSPQGYTTHATANRGISNSDGSEIQLFGNAIVIR 133

Query: 145 --------KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
                   K    L    +     +    + S+ PV +       +A+    +N S  A 
Sbjct: 134 DPVVGPSGKSTPRLEFRGDFLHAFLDTERVTSNKPVTLIRGSDQFTADHLDYDNLSGVAN 193

Query: 197 FAGQVSVVVNPGVLQK 212
             G+V  V+ P    K
Sbjct: 194 LTGRVRGVLIPSAAGK 209


>gi|121606988|ref|YP_984317.1| hypothetical protein Pnap_4106 [Polaromonas naphthalenivorans CJ2]
 gi|120595957|gb|ABM39396.1| protein of unknown function DUF1239 [Polaromonas naphthalenivorans
           CJ2]
          Length = 237

 Score = 64.0 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/189 (13%), Positives = 55/189 (29%), Gaps = 13/189 (6%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERA 90
                   +G + L          +S  ++       M+ F +  + +      L +E A
Sbjct: 39  LLMMGTLALGTYWLVRNTPTFNAPESVREVSHEVDYFMQNFTIKTFDEGGK---LKSEIA 95

Query: 91  KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK--- 147
            T          L+  +  + +           A+ A  N     + ++   ++  +   
Sbjct: 96  GTEARHFADTDILEIDQARIHSININGQLTTATANRAYSNGDGSEVQLTGNARVVREASL 155

Query: 148 -------DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                    L    E     +    + S  PV++       + N     N  + AV  G+
Sbjct: 156 NEQGKEAPRLEFQGEFLHAFLNEERVQSHKPVLLIRGADQFTGNVFAYNNLDQVAVLTGR 215

Query: 201 VSVVVNPGV 209
           V  V+ P  
Sbjct: 216 VRGVLMPKS 224


>gi|94501783|ref|ZP_01308296.1| hypothetical protein RED65_07604 [Oceanobacter sp. RED65]
 gi|94426091|gb|EAT11086.1| hypothetical protein RED65_07604 [Oceanobacter sp. RED65]
          Length = 189

 Score = 64.0 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 63/185 (34%), Gaps = 8/185 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
                  +T+V +  L+         +    L      +++   L +Y ++   + ++ A
Sbjct: 6   IATILIALTVVAYMALNDRQGEEYHDQEQAKL--EPDFMVENLNLQNYGENGELRQTVKA 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
           + AK    +      +      +   +++     L A + +     + L +S    +K  
Sbjct: 64  KSAKHFPATDVQAEIVAFISPDITLHQADKKLWRLTAETGKLTNQRY-LSLSGRVAIKPL 122

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L   T  +D+     N+   VII + + ++ +    ++    +  F  +V  
Sbjct: 123 VDASTRFSLKTATLNMDLNTQIANTDSDVIIENPNTLIESTGLTLDLKKETVQFISKVRG 182

Query: 204 VVNPG 208
             +P 
Sbjct: 183 SHDPS 187


>gi|90580193|ref|ZP_01236000.1| hypothetical protein VAS14_19716 [Vibrio angustum S14]
 gi|90438495|gb|EAS63679.1| hypothetical protein VAS14_19716 [Vibrio angustum S14]
          Length = 187

 Score = 64.0 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 51/192 (26%), Gaps = 19/192 (9%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
           LK       V    W   +   +            +       K +          + L 
Sbjct: 3   LKRLLYVLLVIFCAWLGYNQLEQQWQKDHQVKPDDE-------KPMFIGNDISNTTFDLS 55

Query: 87  AERAKTSFN------SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             R+    +         G        L V  +  +  +  + +++A  +  N+ L +  
Sbjct: 56  GIRSYQIDSDHLEYFEKSGQTDFVKPVLWVF-KDGKNAEWRVSSNTAILD-KNNVLNLHG 113

Query: 141 PFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             +M       D   +  +   L+++    N+ D V+I    F    +        + A 
Sbjct: 114 NVRMFNLLPDSDIQVIKTDNLQLNIETQDFNTQDHVMIIGPAFQNQGDGMTGNMKRKVAK 173

Query: 197 FAGQVSVVVNPG 208
               V     P 
Sbjct: 174 LLKNVKSRYEPT 185


>gi|239996752|ref|ZP_04717276.1| hypothetical protein AmacA2_20083 [Alteromonas macleodii ATCC
           27126]
          Length = 192

 Score = 64.0 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/189 (12%), Positives = 56/189 (29%), Gaps = 11/189 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD--YSKDRV-KYS 84
           +     + + I+   +                  D      K   L+   Y++D    + 
Sbjct: 8   RLGLSISALFILAMLMYIPTWMEEQPETQGNRENDALKPAYKAKNLTTTLYNQDGELNHK 67

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + AE          G +  Q  + T+ T+ +      + A        N  + +     +
Sbjct: 68  VFAES--MEHYDQLGFVLFQQPKYTLYTENAS-SPWVVTADEGTL-YNNELIQLENQVNI 123

Query: 145 KVKDNLRL----DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
           + +           E   ++++   + S  PV I  + +V+ +N       ++       
Sbjct: 124 ENQTGDDFVRSISTEYIQINLETKQMTSDQPVEILGTQYVILSNGFNANLRTQEYELLDH 183

Query: 201 VSVVVNPGV 209
           V    +P  
Sbjct: 184 VQTTYSPSN 192


>gi|313667760|ref|YP_004048044.1| hypothetical protein NLA_4150 [Neisseria lactamica ST-640]
 gi|313005222|emb|CBN86655.1| hypothetical periplasmic protein [Neisseria lactamica 020-06]
          Length = 181

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/181 (11%), Positives = 49/181 (27%), Gaps = 15/181 (8%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY---SLVAER 89
              V +         I      +  ++  D     M    +   + D   Y    L A+ 
Sbjct: 2   ILAVALGSLSAWLGRISEVEIEEVRLNP-DEPQYTMDG--IDGRTFDTQGYLKEHLGAKG 58

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
           AK    S    I+     L             + +  A ++  N  +   +   +     
Sbjct: 59  AKQYPESSD--IYFDSPRLKFYRN--GALLYEVGSGGAVYHTENKQVSFQKNVVLAQTPE 114

Query: 150 L-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                  ++ +   +D ++    +  PV   +      A+    +  +    F  +V   
Sbjct: 115 GGRQPGTVETDELHVDTESQYARTDAPVRFRYGASYGRADGMEYDRRTGLLNFPSKVKAT 174

Query: 205 V 205
           +
Sbjct: 175 I 175


>gi|315125506|ref|YP_004067509.1| hypothetical protein PSM_A0403 [Pseudoalteromonas sp. SM9913]
 gi|315014019|gb|ADT67357.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 184

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/185 (10%), Positives = 58/185 (31%), Gaps = 11/185 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYS 84
             +       ++ + W     + ++   +     ++        +   + Y++     + 
Sbjct: 3   VARIILSVLFISCMVWLWYPYFTKVDITASEETQVIAKPDYTAIELKQTAYNEQGKVSHK 62

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + A +         G  F +     + T  +E     + A  A     +  L +      
Sbjct: 63  VTAVK--MELYQQLGFTFFEKP---IFTLYNEQQTWRINADEATL-YDDRQLVLEGNVTA 116

Query: 145 KVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
           +   +      ++ +T  +D+K +T+ S  PV+IT  +  ++      +  +        
Sbjct: 117 QNLVDNAMIDTINAQTINVDIKLLTMQSQQPVVITGPNLKITGKGLEADLKTEVIKLINH 176

Query: 201 VSVVV 205
              + 
Sbjct: 177 TRTLY 181


>gi|77457087|ref|YP_346592.1| hypothetical protein Pfl01_0860 [Pseudomonas fluorescens Pf0-1]
 gi|77381090|gb|ABA72603.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 190

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/188 (9%), Positives = 47/188 (25%), Gaps = 10/188 (5%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE-PMIMKKFILSDYSKDRV-K 82
           +F           I G     +        K  +   +              Y +D   +
Sbjct: 5   KFRNILLFGCIAAIFGAVGYWNISPERFLDKPPVSAAESPIDWYATNTHTIQYLEDGKVQ 64

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y + +E+A+    +   ++     +  +   R      ++ +     N     + +    
Sbjct: 65  YEMTSEKAEHVKVTDITLVT----KPDLNMFRGTDFPWHVTSERGEVNSGGTEVELIDSV 120

Query: 143 KMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++K       +  +      +  +     +  PV I  +  V +    +           
Sbjct: 121 RVKRTDEKNRDTLITSTRMTVFPQQQYAQTQQPVRIDGAGGVSTGVGMKAYLKESRIHLL 180

Query: 199 GQVSVVVN 206
             V     
Sbjct: 181 SNVRGQYE 188


>gi|237748917|ref|ZP_04579397.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380279|gb|EEO30370.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 201

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 65/204 (31%), Gaps = 11/204 (5%)

Query: 16  KYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD 75
           K  +    I+    F     +T+     ++  IR +    SS         I++ F   +
Sbjct: 3   KSARSALRIRLTIIFLVVLFLTLGS-MWVNMVIRKTATDASSDVQRTEPDYIVENFRYFN 61

Query: 76  YSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
                  +Y   A   K +         + +  L    +  +     + +  A     N 
Sbjct: 62  IKPTGEAQYE--ANGTKMTHYPADDTYLIDNPVLITQNKNGQIE--TISSKEAFVEDFNS 117

Query: 135 TLYISQPFKMKVKDNL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
            +++ +   MK + +       L  E  ++      + S   V+I   +  ++       
Sbjct: 118 KVHMRENVVMKREASAGKGPLTLTSEYVLVFPDEEIMTSDREVVIKSDNSTVTGVGLHAN 177

Query: 190 NSSRSAVFAGQVSVVVNPGVLQKK 213
           N++R    + +  V  NP    KK
Sbjct: 178 NATREVRISNRARVTYNPPGAAKK 201


>gi|330721732|gb|EGG99727.1| hypothetical protein imdm_769 [gamma proteobacterium IMCC2047]
          Length = 189

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/185 (11%), Positives = 51/185 (27%), Gaps = 9/185 (4%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAE 88
                 + I         + +     S     D     M     + ++      + L A+
Sbjct: 9   LLSLIVLAIASVVHWQDELLLEEPV-SQQPAEDETDFFMLNATTTQFNAQGNVDHRLTAQ 67

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK- 147
           +                 ++TV  Q +      + A   R +  N+ + +    K+  K 
Sbjct: 68  QVT--HYPNGDFTVTTSPDITVIHQNNT--PWNITAKHGRISQKNNIIELWDKVKLVRKT 123

Query: 148 --DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             + L++D      +      ++   V+I  +   + A                 V V  
Sbjct: 124 PANELKMDTSKLTFNATEKVAHTKKAVVIIDNATHVDAIGMTAYLRENRTKLLSNVRVTH 183

Query: 206 NPGVL 210
           +P  +
Sbjct: 184 DPANI 188


>gi|229588429|ref|YP_002870548.1| hypothetical protein PFLU0885 [Pseudomonas fluorescens SBW25]
 gi|229360295|emb|CAY47152.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 190

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/191 (5%), Positives = 45/191 (23%), Gaps = 10/191 (5%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            + I+     F       +     +          ++                  +  D 
Sbjct: 3   SKKIRNF-LLFGVIAALFLAVGYWNISPERFLDQPAAQVDEGAIDYYATNAKSVQFLPDG 61

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
             +Y + +++ +        +  L + ++ +          ++ +     N     + + 
Sbjct: 62  KVQYEMTSDKVE--HVKASEVTLLTNPDMNIYR--GTEFPWHVTSKRGEVNPDGTEVELI 117

Query: 140 QPFKMKVKDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++   D+ +    +      +  +     +   V I  +  V +    +        
Sbjct: 118 DSVRVARTDDKKRETVITSSRMTVFPQKQYAQTEQDVRIDGAGGVSTGKGMKAYLKESRI 177

Query: 196 VFAGQVSVVVN 206
                V     
Sbjct: 178 HLLSNVRGQYE 188


>gi|297537428|ref|YP_003673197.1| hypothetical protein M301_0233 [Methylotenera sp. 301]
 gi|297256775|gb|ADI28620.1| protein of unknown function DUF1239 [Methylotenera sp. 301]
          Length = 252

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 56/191 (29%), Gaps = 14/191 (7%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDR-V 81
           +     FP   ++++          +    ++ +D         IM  F+ S    +  +
Sbjct: 5   KRSAIIFPIVILSVLALLTAW-INHMVQPPQAKLDGSSRHDPDYIMSNFVTSQTDANGVL 63

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y L A  A+           LQ                 + A     +     + +   
Sbjct: 64  RYKLAA--AEMRHFPDDDSTNLQRPR--YTQFSVGKPYTQVEALRGYVSSDGEQVQLVDN 119

Query: 142 FKMKV-----KDNLRLDFETAVLDVKNITINSSDPVIITH-SDFVLSANFARIENSSRSA 195
            K+       K  + ++ E   +      + +  PV+I      V+ A     E ++R+ 
Sbjct: 120 VKITRQAFAGKGEMTVETEYLNILPDQDLVRTDSPVVIKQAPKTVIYATGMVYEKNTRTV 179

Query: 196 VFAGQVSVVVN 206
               +V     
Sbjct: 180 TLLHRVRAHYE 190


>gi|15838012|ref|NP_298700.1| hypothetical protein XF1411 [Xylella fastidiosa 9a5c]
 gi|9106423|gb|AAF84220.1|AE003972_5 hypothetical protein XF_1411 [Xylella fastidiosa 9a5c]
          Length = 189

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 48/192 (25%), Gaps = 12/192 (6%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
             L      A +        S+W +      + +  +      ++ F L        K S
Sbjct: 5   SILNIMLLLAAIVSG----WSAWHQRKHTQATPLRDI-AADYTLQDFKLVALDTQTGKES 59

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L            +     +                 L A +   N     L +    K 
Sbjct: 60  LT--LLGQQMQHNQTDSSAEVTAPLFMIPDQAGQHWTLQAQTGWINKDGTLLRLRHDVKG 117

Query: 145 KVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
               +          ++  +   +    ++D V ITH   + +     +   ++      
Sbjct: 118 DSPTDLGQVPTTFRTQSLDIYPNHHLAKTTDAVTITHQGIIQTGVGFEVNTKTQQYKLNS 177

Query: 200 QVSVVVNPGVLQ 211
           +V+    P   +
Sbjct: 178 KVNTRYEPSAAR 189


>gi|94264343|ref|ZP_01288135.1| hypothetical protein MldDRAFT_0388 [delta proteobacterium MLMS-1]
 gi|94268094|ref|ZP_01291085.1| hypothetical protein MldDRAFT_3081 [delta proteobacterium MLMS-1]
 gi|93451734|gb|EAT02502.1| hypothetical protein MldDRAFT_3081 [delta proteobacterium MLMS-1]
 gi|93455237|gb|EAT05450.1| hypothetical protein MldDRAFT_0388 [delta proteobacterium MLMS-1]
          Length = 186

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/145 (13%), Positives = 47/145 (32%), Gaps = 5/145 (3%)

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
                M++  L        ++ +  +  +    +    + L      +         + +
Sbjct: 47  GRRFTMEQARLYQDQAGVRQWRI--DTPRLQTGATSDELLLGAVAAILFR--DGQEHLRI 102

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A   R++    TLY+    +M+  D   L     V       ++S   V +  ++  + 
Sbjct: 103 NAERGRYDTVAETLYLDDNVEMRGDDGFLLTTPALVYHEPRGMVSSRAGVEVHSAEARVR 162

Query: 183 ANFARIENSSRSAVFAGQVSVVVNP 207
           A     +  +     +GQV + + P
Sbjct: 163 AENLDYDLGAGHYQLSGQV-LFITP 186


>gi|319796636|ref|YP_004158276.1| hypothetical protein Varpa_6013 [Variovorax paradoxus EPS]
 gi|315599099|gb|ADU40165.1| protein of unknown function DUF1239 [Variovorax paradoxus EPS]
          Length = 217

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/194 (10%), Positives = 54/194 (27%), Gaps = 15/194 (7%)

Query: 29  FFFP--FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLV 86
            + P        +G + L           +           M+ F++ ++  +     L 
Sbjct: 20  IYLPIILTAAVALGTYWLVRNAPKLLEPTAKAAPTHEPDYFMRDFVIKNFLPNGD---LR 76

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +E              ++  E+ + +   +       A+    N     + +     +  
Sbjct: 77  SELHGKEGRHYPDTDTVEVDEVNMRSVSPQGYTTRSTANRGISNSDGSEIQLFGNAVVIR 136

Query: 147 KDNL----------RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             ++              E     +    + S+ PV +       +A+    +N S  A 
Sbjct: 137 DPSVGANGKPTPRLEFRGEFLHAFLDTERVTSNKPVTLIRGTDQFTADNLDYDNLSGVAN 196

Query: 197 FAGQVSVVVNPGVL 210
             G+V  ++ P   
Sbjct: 197 LTGRVRGLLVPSAA 210


>gi|328953771|ref|YP_004371105.1| protein of unknown function DUF1239 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454095|gb|AEB09924.1| protein of unknown function DUF1239 [Desulfobacca acetoxidans DSM
           11109]
          Length = 173

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/166 (9%), Positives = 51/166 (30%), Gaps = 20/166 (12%)

Query: 46  SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQD 105
             + +   + +     +     MK   L++  +   ++ L A  A   +   +  I L+ 
Sbjct: 13  PGVSLPPPTIAPEKQAE-----MKAVRLTEIQEGEKRWILTAVGA--DYLKDQDTIQLRK 65

Query: 106 FELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT 165
             + +  +  +   + +  +    N  +  L +    + +   +     +    D K   
Sbjct: 66  VSVEIIGKDDD--TITITGNIGFINPKSRELTLQGDVRAE-SRSYEFSSDLVRYDPKARV 122

Query: 166 INSSDPVIITHSDFVLSANFARIENSSRS----------AVFAGQV 201
           +++   V +      +      I+   +             F+G +
Sbjct: 123 LSAPGEVKVQGPRIYVEGRGLSIDLQHKKLDVAEHIVTRMQFSGNI 168


>gi|90022818|ref|YP_528645.1| hypothetical protein Sde_3176 [Saccharophagus degradans 2-40]
 gi|89952418|gb|ABD82433.1| protein of unknown function DUF1239 [Saccharophagus degradans 2-40]
          Length = 196

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 42/129 (32%), Gaps = 9/129 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y L  ++A    N    +I L    LT+      +    + A   +      ++ + +  
Sbjct: 72  YQLTEDQAPEDENRVYTLIDL--PVLTIFQGEQPW---RVEAKKGKLLGDGQSIELWEDV 126

Query: 143 KMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
            ++ K+      +L     ++        + + V I      ++      + + R     
Sbjct: 127 VIRQKNESGTYTQLTTNKLLILPHEKVAQTEETVKINSPRGEMTGVGMVADLAERKITLL 186

Query: 199 GQVSVVVNP 207
           G+V    +P
Sbjct: 187 GKVRGTHDP 195


>gi|207727852|ref|YP_002256246.1| hypothetical protein RSMK04149 [Ralstonia solanacearum MolK2]
 gi|207742257|ref|YP_002258649.1| hypothetical protein RSIPO_00441 [Ralstonia solanacearum IPO1609]
 gi|206591093|emb|CAQ56705.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206593645|emb|CAQ60572.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 190

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/192 (8%), Positives = 51/192 (26%), Gaps = 18/192 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDY-----SKDR-VKYSLVAER 89
           + ++      +++ +   +  + +        +  + +         +    KY      
Sbjct: 3   ILLMALVCGVTFLLVQVNTPQTEETASQAKRHVADYTMDGISATALDERGVTKYRFTG-- 60

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
              +         +    L +         +   A   + N     + +    K+     
Sbjct: 61  VHMNHYEDDLTYDVTFPALRIYAPDR--PQVTARADLGKMNGEGTIIDLYDNAKVIRAQG 118

Query: 150 --------LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                   +  D     + + +  + +  PV +     V++AN     N +R     G V
Sbjct: 119 PDLHQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPSVMNANGLVFNNVTRQVQLLGNV 178

Query: 202 SVVVNPGVLQKK 213
              +      K+
Sbjct: 179 RGRIEGLGAPKQ 190


>gi|153208984|ref|ZP_01947190.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212219028|ref|YP_002305815.1| hypothetical protein CbuK_1507 [Coxiella burnetii CbuK_Q154]
 gi|120575584|gb|EAX32208.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212013290|gb|ACJ20670.1| hypothetical protein CbuK_1507 [Coxiella burnetii CbuK_Q154]
          Length = 195

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/196 (10%), Positives = 43/196 (21%), Gaps = 9/196 (4%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           + +K          +   L+            +          M+      Y +      
Sbjct: 3   RNMKISLLLIVAACLSTLLILRKTTSDERPSQAQLNHRPNAF-MRDVNYYQYDEGG---L 58

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L +                Q           +     + A+S +       +Y+    K+
Sbjct: 59  LHSHLVSPLITHFPYQNSFQFTRPHYLIYTDKRIPWNITANSGKSQQGIKRIYLWDHVKV 118

Query: 145 KVKDNLRLDFETAVLDV-----KNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                      T    +     +     ++DPV IT  + V+ A                
Sbjct: 119 HEPPQPTEPETTITTSMLTLFPERSFAKTNDPVTITRPNAVIKATGMTSNLKKGLVHLLS 178

Query: 200 QVSVVVNPGVLQKKEN 215
               V        K+N
Sbjct: 179 HSRGVYEVEPAPGKKN 194


>gi|237798601|ref|ZP_04587062.1| hypothetical protein POR16_07170 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021454|gb|EGI01511.1| hypothetical protein POR16_07170 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 190

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/183 (7%), Positives = 41/183 (22%), Gaps = 9/183 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
             F    V +      +          +                   Y  D   +Y + +
Sbjct: 10  LLFGVLAVLLAAVGYWNVSPESFMDQPAGSADDTAIDYYAINTRSVQYLPDGTLQYDMTS 69

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++ +        +  L    L +          ++ +     + A   + +    +++  
Sbjct: 70  DKVE--HVKATDVSLLTMPNLHMYR--GGEFPWHVQSKRGEVSSAGDQVELMDAVRVERT 125

Query: 148 DNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           D       +      +  +     +   V I  +  V +A   +             V  
Sbjct: 126 DEKQRTTIITSSRMTVFPQKQYAETDQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRG 185

Query: 204 VVN 206
              
Sbjct: 186 QYE 188


>gi|113866419|ref|YP_724908.1| hypothetical protein H16_A0390 [Ralstonia eutropha H16]
 gi|113525195|emb|CAJ91540.1| Uncharacterized protein conserved in bacteria [Ralstonia eutropha
           H16]
          Length = 209

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 45/190 (23%), Gaps = 14/190 (7%)

Query: 26  FLKFF-FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KY 83
            ++              F L           +           M +F  ++ + D   K 
Sbjct: 12  VMRLLPLLLMAFVAGSTFWLVQINSPKEDPAAQSAKKHEPDYFMDRFSATELAPDGSTKI 71

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP-- 141
               ER             +    +           +   A   R N     + +     
Sbjct: 72  RFTGER--MVHFEDDQTYEVTRPAMRAYEPDR--PPVTARADMGRMNAEGSVIDLYGNGF 127

Query: 142 ------FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
                   +     L        L V +  + +  PV +T    V++AN     N +R  
Sbjct: 128 VMRQQGVDVSKDPQLTAASSYFQLLVNDDIVKTDKPVKLTRGPSVMTANGLIFNNVTREV 187

Query: 196 VFAGQVSVVV 205
              G V   +
Sbjct: 188 QLLGNVRGTI 197


>gi|256821876|ref|YP_003145839.1| hypothetical protein Kkor_0651 [Kangiella koreensis DSM 16069]
 gi|256795415|gb|ACV26071.1| protein of unknown function DUF1239 [Kangiella koreensis DSM 16069]
          Length = 185

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 23/183 (12%), Positives = 57/183 (31%), Gaps = 15/183 (8%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY- 83
           + + +    AT  I  W     W R +      +++       +      ++ K      
Sbjct: 7   RSMLWLLVPATFAIAYW-----WDRSTEPKPDFVEISSNPDYYLSNTETIEFDKSGQPLR 61

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
           S      KT          L+   +       +     + +  A  N  +  L +     
Sbjct: 62  SFT--TVKTLHYKDIMQTHLEQPVMRF--NDDQNPSWTVSSKKAISNELSEQLILEGNVT 117

Query: 144 MKVKD-----NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++++      N+ L      +D  + T  +  P+ +    F ++A   + +  + +  F 
Sbjct: 118 VELERQPAQSNVLLTMPVLKIDFASETAFTDAPIELIDGRFRMTAKGMQADLRTNNIEFK 177

Query: 199 GQV 201
            +V
Sbjct: 178 SEV 180


>gi|312959000|ref|ZP_07773519.1| hypothetical protein PFWH6_0897 [Pseudomonas fluorescens WH6]
 gi|311286770|gb|EFQ65332.1| hypothetical protein PFWH6_0897 [Pseudomonas fluorescens WH6]
          Length = 190

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/191 (5%), Positives = 43/191 (22%), Gaps = 10/191 (5%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            + I+     F       +     +          ++                  +  D 
Sbjct: 3   SKKIRNF-LLFGVIAALFLAVGYWNISPERFLDQPAAQVDKGAIDYYATNAYSVQFLPDG 61

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
             +Y + +++ +        +  L + +L +          ++ +     N     + + 
Sbjct: 62  KVQYEMTSDKVE--HLKASEVTLLTNPDLNLYR--GTEFPWHVTSKRGEVNPDGTQVELI 117

Query: 140 QPFKMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++        +  +      +  +     +   V I  +  V +    +        
Sbjct: 118 DSVRVARTDAKNRDTVITSSRMTVFPQKQYAQTEQDVRIDGAGGVSTGKGMKAYLKESRI 177

Query: 196 VFAGQVSVVVN 206
                V     
Sbjct: 178 HLLSNVRGQYE 188


>gi|22138776|emb|CAD43109.1| hypothetical protein [Pseudomonas stutzeri]
 gi|327479597|gb|AEA82907.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 190

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/188 (9%), Positives = 48/188 (25%), Gaps = 12/188 (6%)

Query: 23  FIQFLKF--FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD-FEPMIMKKFILSDYSKD 79
            ++ L+F          +V     +          +            +       Y  D
Sbjct: 1   MLRKLRFPALLTLIAAVLVAIGYWNIRPESFMQQPTVASGETPDVDFYVINSRTVQYQAD 60

Query: 80  R-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
               Y + AE+ +        +  L   +  + + R      ++ +     +     + +
Sbjct: 61  GKRNYEMTAEKVE--HIKASDVSLLTKPD--LLSYRGGEHPWHVRSERGEVSAEGDEVLL 116

Query: 139 SQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               +++  D       L      +        ++  V I  ++ V +A   +       
Sbjct: 117 IDKVRVERTDAKGRPTILTTSRLTVWPDKDYAETNQAVRIDAANGVTTATGMKAYLDDGR 176

Query: 195 AVFAGQVS 202
            +    V 
Sbjct: 177 MLLLSNVR 184


>gi|330877183|gb|EGH11332.1| hypothetical protein PSYMP_17006 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 190

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/183 (8%), Positives = 40/183 (21%), Gaps = 9/183 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
             F    V +      +                              Y  D   +Y + A
Sbjct: 10  LLFGVLAVLLAAVGYWNISPESFMDKPLGSADDTVIDYYAINTRSMQYLPDGTLQYDMTA 69

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++ +        +  L    L +          ++ +     + A   + +    +++  
Sbjct: 70  DKVE--HVKSTDVSLLTTPNLNMYR--GGEFPWHVQSKRGEVSSAGDQVELIDAVRVERT 125

Query: 148 DNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           D       +      +  +     +   V I  +  V +A   +             V  
Sbjct: 126 DEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRG 185

Query: 204 VVN 206
              
Sbjct: 186 QYE 188


>gi|170729947|ref|YP_001775380.1| hypothetical protein Xfasm12_0759 [Xylella fastidiosa M12]
 gi|167964740|gb|ACA11750.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 189

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 47/181 (25%), Gaps = 7/181 (3%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN 95
           + +       S       ++++          ++ F L        K SL     +   N
Sbjct: 11  LLLAAIVSGWSAWHQRKHTQATQLRDIAADYTVQDFKLVALDTQTGKESLTLLGQQMQHN 70

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----L 150
                  +                  L A +   N     L + Q  K     +      
Sbjct: 71  QIDSTAEVTAP--LFMIPDQAGQHWTLQAQTGWINKDGTLLRLRQDVKGDSPTDLGQVPT 128

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVL 210
               ++  +   +    ++D V ITH   + +     +   ++      +V+    P   
Sbjct: 129 TFRTQSLDIYPNHHLAKTTDAVTITHQGIIQTGVGFEVNTKTQQYKLNSKVNTRYEPSAA 188

Query: 211 Q 211
           +
Sbjct: 189 R 189


>gi|221069834|ref|ZP_03545939.1| protein of unknown function DUF1239 [Comamonas testosteroni KF-1]
 gi|220714857|gb|EED70225.1| protein of unknown function DUF1239 [Comamonas testosteroni KF-1]
          Length = 206

 Score = 61.7 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/191 (9%), Positives = 56/191 (29%), Gaps = 16/191 (8%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDRVKYSLVAE 88
            P   + ++                S  +          +K F++ ++        L + 
Sbjct: 16  LPVLIMGLLALGTWWLVRNAPKPLSSGTERAVRHDPDYFLKDFVIKNFEASGR---LKSR 72

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
              T+         L+  +  + +   +       ++ A  N     + +     +  + 
Sbjct: 73  LNGTTGEHFPDTDTLEIQDARMLSFTPDGRKTIGSSNRALSNGDGSEIQMFGQAVITREP 132

Query: 149 -----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
                       ++L+ E   L       +++ PV++T      + +  +  +  +    
Sbjct: 133 VPATATQKALPGMKLESEFLQLWPNEERASTNKPVVMTRGSDKFTGDSMQYGHLDQILQM 192

Query: 198 AGQVSVVVNPG 208
            G+V  V+ P 
Sbjct: 193 QGRVKGVIQPS 203


>gi|71274805|ref|ZP_00651093.1| Protein of unknown function DUF1239 [Xylella fastidiosa Dixon]
 gi|71900941|ref|ZP_00683055.1| Protein of unknown function DUF1239 [Xylella fastidiosa Ann-1]
 gi|71164537|gb|EAO14251.1| Protein of unknown function DUF1239 [Xylella fastidiosa Dixon]
 gi|71729300|gb|EAO31417.1| Protein of unknown function DUF1239 [Xylella fastidiosa Ann-1]
          Length = 189

 Score = 61.3 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/181 (11%), Positives = 47/181 (25%), Gaps = 7/181 (3%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN 95
           + +       S       ++++          ++ F L        K SL     +   N
Sbjct: 11  LLLAAIVSGWSAWHQRKHTQATQLRDIAADYTVQDFKLVALDTQTGKKSLTLLGQQMQHN 70

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----L 150
                  +                  L A +   N     L + Q  K     +      
Sbjct: 71  QIDSTAEVTAP--LFMIPDQAGQHWTLQAQTGWINKDGTLLRLRQDVKGDSPTDLGQVPT 128

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVL 210
               ++  +   +    ++D V ITH   + +     +   ++      +V+    P   
Sbjct: 129 TFRTQSLDIYPNHHLAKTTDAVTITHQGIIQTGVGFEVNTKTQQYKLNSKVNTRYEPSAA 188

Query: 211 Q 211
           +
Sbjct: 189 R 189


>gi|330501875|ref|YP_004378744.1| hypothetical protein MDS_0961 [Pseudomonas mendocina NK-01]
 gi|328916161|gb|AEB56992.1| hypothetical protein MDS_0961 [Pseudomonas mendocina NK-01]
          Length = 188

 Score = 61.3 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/183 (8%), Positives = 44/183 (24%), Gaps = 9/183 (4%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-Y 83
           + L          +V      +    S          +     +       +  D    Y
Sbjct: 4   KILNILIFALIAIVVAALGYWNLAPDSARVTQQSGDNNVVDFYVIGARTVQFQDDGKVHY 63

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            + A++ +        I  +   +L +           + +  A  +     + +    +
Sbjct: 64  RMTADKLE--HVKSTDITLVDTPKLDLYR--GTELPWKVTSQRAEVSPGGVEVELIDDVR 119

Query: 144 MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +   D       +      +        +   V I  ++ V +A   +   +    +   
Sbjct: 120 IARTDAKNRPTIITSSRMTVIPDKEYAQTEQAVRIVAANGVTTAQGMKAYLNDGRMLLQS 179

Query: 200 QVS 202
            V 
Sbjct: 180 NVR 182


>gi|294670260|ref|ZP_06735153.1| conserved hypothetical protein [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307997|gb|EFE49240.1| conserved hypothetical protein [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 194

 Score = 61.3 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 24/189 (12%), Positives = 47/189 (24%), Gaps = 13/189 (6%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR--VKYSLV 86
             FP     ++G              +            M       +  +    +  L 
Sbjct: 9   LLFPLVLAAVLGGLSAWLDRISEVTVEEVALNPKEPQYSMSGIAGRRFDSEGLLRE-QLD 67

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           AE A     S + +         +   R       +  + AR++         Q   +  
Sbjct: 68  AEAAWQLPKSTEVVFR----RPEMKMYRQGVKTYQINGNEARYDTETRQALFEQQVVLHK 123

Query: 147 KDNL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
           +        +L  E   +D    T  S  PV  ++     SA            +   +V
Sbjct: 124 EAGDGRPAGKLTAERITVDTVKKTAASDRPVQFSYGLSHGSAGGFSYNEEQGLLLLPSRV 183

Query: 202 S-VVVNPGV 209
              + +P  
Sbjct: 184 KATIYDPKN 192


>gi|312797341|ref|YP_004030263.1| hypothetical protein RBRH_02133 [Burkholderia rhizoxinica HKI 454]
 gi|312169116|emb|CBW76119.1| unnamed protein product [Burkholderia rhizoxinica HKI 454]
          Length = 201

 Score = 61.3 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 47/184 (25%), Gaps = 10/184 (5%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVAER 89
                V   G + L            S D           F +S   +    +Y + A  
Sbjct: 12  LVIMAVLAAGTYWLLQNTLPRPSQGVSADKAHTPDYFADHFSISMLDESGVTQYRIAAAS 71

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK---- 145
                +       L       P        +      A  N     + +    ++     
Sbjct: 72  MVHYEDDAATHATLPAIRAFAP----GQPVVTATGKRAVINADGSIVDLYDDARIVRDAG 127

Query: 146 -VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                ++ D E   +   +  I +  PV +      ++AN     N +R     GQV  +
Sbjct: 128 PTDPRMQADSEHFRVLTHDDIIETEKPVKLLRGLSQMTANGMIYNNVTREMRLLGQVRGM 187

Query: 205 VNPG 208
           +   
Sbjct: 188 IAAS 191


>gi|319786674|ref|YP_004146149.1| hypothetical protein Psesu_1068 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465186|gb|ADV26918.1| protein of unknown function DUF1239 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 185

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 44/169 (26%), Gaps = 9/169 (5%)

Query: 45  SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQ 104
            S  ++      +    +    +++ F L    KD  + ++  +  +      + +   +
Sbjct: 20  WSAWKMRGRDAVATGGGERSDYVLRDFELVVLGKDGSE-TVRVQSPELQRRDDESMDVAE 78

Query: 105 DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN----LRLDFETAVLD 160
              LT     +E G   L A     +     L +                +   ++  L 
Sbjct: 79  PVFLT----PAEPGPWKLTAERGWISPDGELLRLDGSVSGDSDPASPAPTKFRTDSLELL 134

Query: 161 VKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
                  +   V ++      +         +R      QV     P  
Sbjct: 135 PGQDLARTDKAVSLSRPGLSQTGTGMEANLKTRQYRLLSQVRTRYEPSA 183


>gi|217966589|ref|YP_002352095.1| hypothetical protein Dtur_0150 [Dictyoglomus turgidum DSM 6724]
 gi|217335688|gb|ACK41481.1| conserved hypothetical protein [Dictyoglomus turgidum DSM 6724]
          Length = 181

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/178 (14%), Positives = 58/178 (32%), Gaps = 6/178 (3%)

Query: 27  LKFFFPFATVTIVGWFLL-SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSL 85
           +K         +VG     +S+  +    + S   L+   +  +K  L   S+  + + +
Sbjct: 1   MKRIILLGIFILVGLVAWGTSYYFVPLEKEVSNTNLEKAGIYAEKVYLKGRSEGNLSWEV 60

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A+       + K  +F  D +  V     +   + +    A  +   + L I      +
Sbjct: 61  SADNLNIDL-NYKHFVFEGDVKGKVYR--DKKLSLLIITKRAEIDRDKNILKIPTELHFE 117

Query: 146 VKDNLRLDFETAVLDVKNIT-INSSDPVIITH-SDFVLSANFARIENSSRSAVFAGQV 201
            +D  +      +        +++   V      +F   A+    + +   A F G V
Sbjct: 118 TEDGFKGIAPEGIWYFDTGIFMSTKGRVKFEKVGEFKAEADMFVFDTNKGKAEFEGNV 175


>gi|33151777|ref|NP_873130.1| hypothetical protein HD0588 [Haemophilus ducreyi 35000HP]
 gi|6969425|gb|AAF33769.1|AF219259_2 YrbK [Haemophilus ducreyi]
 gi|33147998|gb|AAP95519.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 193

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 56/199 (28%), Gaps = 17/199 (8%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKD 79
           ++    F  + IV         +      S   L+  E         S        Y  +
Sbjct: 1   MQIRLTFILLIIVAILGGWYMNQHKPTDYSLTQLIKKEG----TPDYSGRNISTMIYDVN 56

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
                  A+  +             +  + +   ++      + A  A        L++ 
Sbjct: 57  GQPQYF-AKATEIKRYEATQHTEFINPFINLYDTQTRAKQWNISAEQAEI-THEKMLHLV 114

Query: 140 QPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              K+K  +N     ++  +   +D+    + +   V    + F  S    +     + A
Sbjct: 115 GNVKLKALENNAQLQKIVTDKLTIDLNTQDVFTDSKVTSIGAGFSSSGIGLKGNLKQQVA 174

Query: 196 VFAGQVSVVVNPGVLQKKE 214
                V   + P V+Q+ +
Sbjct: 175 TLIKDVKTHIEPTVIQQSK 193


>gi|313894674|ref|ZP_07828237.1| conserved hypothetical protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313440864|gb|EFR59293.1| conserved hypothetical protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 178

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 45/173 (26%), Gaps = 4/173 (2%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAK- 91
              +       L   I       + +         +  F  +D  +++    + A  A+ 
Sbjct: 7   LIAIVAAIVLALIGLIVYIMKDSNEVTTTQNPSGQLVNFQGADLQEEKDGKLVWALSAEK 66

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR 151
             ++     I L + +              + A  A      ++L I Q       +   
Sbjct: 67  IEYDPRTKAIVLTNLKGLFYQDD---VTTTITAPHAVLTGDRNSLDIDQGVTATNTEGAE 123

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              E    D K  T+ S         D  L+ +      S +     G   + 
Sbjct: 124 FKTEALHFDNKTKTLTSKSAFTYNSKDVTLTGDKLEGNMSLKIIKAIGNAKLT 176


>gi|284049010|ref|YP_003399349.1| protein of unknown function DUF1239 [Acidaminococcus fermentans DSM
           20731]
 gi|283953231|gb|ADB48034.1| protein of unknown function DUF1239 [Acidaminococcus fermentans DSM
           20731]
          Length = 182

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/177 (11%), Positives = 51/177 (28%), Gaps = 5/177 (2%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLV 86
           K       V ++    + +W+  S  +   +     + +          +K+  K + L 
Sbjct: 5   KRTLLVIAVAVLLMGGVIAWLLSSKPTTGPVKDNGKDVLQEVNGSTIQETKNGKKVWELT 64

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
            +       +   +  ++    T          M + A     ++ +  + +++      
Sbjct: 65  VQSLLYDKKA--QLAHMKGINGTFYQDDG--RTMTVTADEGEVHMDSKDVVLTKNPHGVT 120

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
            D      +      K+ T+     V +   D V +A  A    +   A       V
Sbjct: 121 SDGGDAVADKFTWINKDQTVVGEGNVRLKKDDTVATAKKATFNVALDQAKLEEDAHV 177


>gi|258622782|ref|ZP_05717800.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258584970|gb|EEW09701.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 187

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 45/183 (24%), Gaps = 17/183 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR--------VKYSLVA 87
           +  +    +SSW       +     +   P  ++  + S  + +           Y +  
Sbjct: 6   IVYILLLFISSWSLYYLLEQEQDSTIQVAP-NLELPMFSGKNLENISYNEQGIRNYVIT- 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
                   +  G    +   L V  +     +  + A        +  L +      K  
Sbjct: 64  -SIHLDHYAKSGNTLFRAPILKVY-REGTLQEWEITARRGIL-SKDQVLTLYDDVLAKNL 120

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L      + +K+    +  PV +    F       +   +  SA     V  
Sbjct: 121 LPDSGFDTLTTSEMSIQLKSRDFWADKPVELRGPQFETHGQSMKGNFADHSAELYNNVQG 180

Query: 204 VVN 206
              
Sbjct: 181 RYE 183


>gi|146305908|ref|YP_001186373.1| hypothetical protein Pmen_0873 [Pseudomonas mendocina ymp]
 gi|145574109|gb|ABP83641.1| protein of unknown function DUF1239 [Pseudomonas mendocina ymp]
          Length = 188

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/183 (9%), Positives = 48/183 (26%), Gaps = 9/183 (4%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-Y 83
           + L          IV      +    ST      +        +       Y  D    Y
Sbjct: 4   KILNTLIFALIAVIVAALGYWNIAPDSTRQTQQSNDEQAIDFYVIGARSVQYQDDGKLHY 63

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            + A++ +   ++   +I +   +L +           + +  A  +     + +    +
Sbjct: 64  RMTADKLEHIKSTDITLIEM--PKLDLYRGDE--LPWNVTSKRAEVSPGGVEVELIDDVR 119

Query: 144 MKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +   D       +      +        +   V I  ++ V +A   +   +    +   
Sbjct: 120 IARTDAKNRPTIITSSRMTVIPDKEYAQTEQAVRIVAANGVTTAQGMKAYLNDGRMLLQS 179

Query: 200 QVS 202
            V 
Sbjct: 180 NVR 182


>gi|253997918|ref|YP_003049981.1| hypothetical protein Msip34_0205 [Methylovorus sp. SIP3-4]
 gi|253984597|gb|ACT49454.1| protein of unknown function DUF1239 [Methylovorus sp. SIP3-4]
          Length = 251

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 50/179 (27%), Gaps = 12/179 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGII 101
                       +   +L      I+  F+ +  + +    Y L A +            
Sbjct: 21  FWIDRSVQPPERRPDANLRHDPDYILDNFVTTRTNVNGALAYVLAAVK--MKHYPDDDTT 78

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-----KVKDNLRLDFET 156
            L+                 +       +    T+       +     K K  + +  + 
Sbjct: 79  ELERPR--FTQYAVNKPYTQIEGQRGNVSSDGETVEFMDNVIVIRQASKDKGEMMVRTQY 136

Query: 157 AVLDVKNITINSSDPVIITH-SDFVLSANFARIENSSRSAVFAGQVSVVV-NPGVLQKK 213
             +  K     +  PV+IT   + V+ AN       +++    G+V     +P V +K 
Sbjct: 137 LKMFPKQEVAVTDKPVVITQAPETVIHANGMVFNKKNQTVNLRGRVRAHYLSPSVTKKA 195


>gi|258625808|ref|ZP_05720687.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258582046|gb|EEW06916.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 187

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 46/183 (25%), Gaps = 17/183 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR--------VKYSLVA 87
           +  +    ++SW       +    ++   P  ++  + S  + +           Y +  
Sbjct: 6   IVYILLLFIASWSLYYLLEQEQDSMIQVAP-NLELPMFSGKNLENISYNEQGIRNYVIT- 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
                   +  G    +   L V  +     +  + A        +  L +      K  
Sbjct: 64  -SIHLDHYAKSGNTLFRAPILKVY-REGTLQEWEITARRGIL-SKDQVLTLYDDVLAKNL 120

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L      + +K+    +  PV +    F       +   +  SA     V  
Sbjct: 121 LPDSGFDTLTTSEMSIQLKSRDFWADKPVELRGPQFETHGQSMKGNFADHSAELYNNVQG 180

Query: 204 VVN 206
              
Sbjct: 181 RYE 183


>gi|303256246|ref|ZP_07342262.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|331001307|ref|ZP_08324933.1| hypothetical protein HMPREF9439_02594 [Parasutterella
           excrementihominis YIT 11859]
 gi|302860975|gb|EFL84050.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|329569034|gb|EGG50830.1| hypothetical protein HMPREF9439_02594 [Parasutterella
           excrementihominis YIT 11859]
          Length = 197

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/191 (12%), Positives = 53/191 (27%), Gaps = 14/191 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSI---DLLDFEPMIMKKFILSDYSKDRVKYSLVAER 89
              + ++      S+         ++     L+    I +   ++ +  D +     A+ 
Sbjct: 8   LIAIALLVTLCAMSYWYSVKAELENVTHLSDLNSPDFIARDITITQFDDDGIA---KAKV 64

Query: 90  -AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM---- 144
            AK   +   G    +       +       +   +  A        ++      +    
Sbjct: 65  FAKEVEHYSDGHANAKFP--EYASLNPNEAQITAKSDRATMVDGGAVIHFYNNVDIRQAA 122

Query: 145 -KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
            K     RL            T  S  PV +T  +          +N  R+     +V  
Sbjct: 123 TKDAPASRLLTSQLDAYPDTDTYKSDKPVALTRGEDTSHGIGMDYDNVDRTFKLRSRVQT 182

Query: 204 VVNPGVLQKKE 214
           V+ P  +++ E
Sbjct: 183 VIQPKTVKEVE 193


>gi|74316554|ref|YP_314294.1| hypothetical protein Tbd_0536 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056049|gb|AAZ96489.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 190

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/171 (14%), Positives = 48/171 (28%), Gaps = 11/171 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGII 101
                    T +       D E + M+ F            Y L A+R      +G  + 
Sbjct: 22  FAIERAVQVTPAPEHAAESDPEGI-MENFDALRTDATGRPQYRLSAKRL--KHYTGSRLT 78

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----LRLDFET 156
            L+           E G++   A  A  +     + +     +    +     + L    
Sbjct: 79  ELELPR--FVQIDPEAGEIRAAAREATISPTGDEVDLRGDVNVVRAAHAGQSAMTLRTAR 136

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
            ++  +   + S  PV I      + A     +   R    +G+V     P
Sbjct: 137 LLVFPEQDQLRSPGPVDIRDDLLTVRAGAMHYDARLRVIKLSGRVHTRYLP 187


>gi|29654082|ref|NP_819774.1| hypothetical protein CBU_0748 [Coxiella burnetii RSA 493]
 gi|154706632|ref|YP_001424155.1| hypothetical protein CBUD_0761 [Coxiella burnetii Dugway 5J108-111]
 gi|161831228|ref|YP_001596941.1| hypothetical protein COXBURSA331_A1204 [Coxiella burnetii RSA 331]
 gi|165923985|ref|ZP_02219817.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212212787|ref|YP_002303723.1| hypothetical protein CbuG_1255 [Coxiella burnetii CbuG_Q212]
 gi|29541348|gb|AAO90288.1| hypothetical protein CBU_0748 [Coxiella burnetii RSA 493]
 gi|154355918|gb|ABS77380.1| hypothetical protein CBUD_0761 [Coxiella burnetii Dugway 5J108-111]
 gi|161763095|gb|ABX78737.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
 gi|165916571|gb|EDR35175.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212011197|gb|ACJ18578.1| hypothetical protein CbuG_1255 [Coxiella burnetii CbuG_Q212]
          Length = 195

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/196 (10%), Positives = 42/196 (21%), Gaps = 9/196 (4%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           + +K          +   L+            +          M+      Y +      
Sbjct: 3   RNMKISLLLIVAACLSTLLILRKTTSDERPSQAQLNHRPNAF-MRDVNYYQYDEGG---L 58

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L +                Q           +     + A+S +       +Y+    K+
Sbjct: 59  LHSHLVSPLITHFPYQNSFQFTRPHYLIYTDKRIPWNITANSGKSQQGIKRIYLWDHVKV 118

Query: 145 KVKDNLRLDFETAVLDV-----KNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                      T          +     ++DPV IT  + V+ A                
Sbjct: 119 HEPPQPTEPETTITTSTLTLFPERSFAKTNDPVTITRPNAVIKATGMTSNLKKGLVHLLS 178

Query: 200 QVSVVVNPGVLQKKEN 215
               V        K+N
Sbjct: 179 HSRGVYEVEPAPGKKN 194


>gi|330807557|ref|YP_004352019.1| hypothetical protein PSEBR_a849 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375665|gb|AEA67015.1| Conserved hypothetical protein, putative exported membrane protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 189

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/191 (7%), Positives = 44/191 (23%), Gaps = 11/191 (5%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            + I+            I       +        + +  + +             Y  D 
Sbjct: 3   SKKIRT--IVVFGCIAAIFAAVGYWNISPERFLDQPAAQVEEKIDWYATNTHTLQYLPDG 60

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
             +Y + +++          I  +   +L +          ++ +  A  N     + + 
Sbjct: 61  KVQYEMTSDKV--DHVKATDITLVTKPDLNMFR--GTEFPWHVQSEHAEVNSGGTEVELI 116

Query: 140 QPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++   D       +      +  +     +  PV I  +  V +    +        
Sbjct: 117 DSVRVARTDEKNRTTIITSTRMTVFPQQEYAQTEQPVRIDGAGGVSTGTGMKAYLKESRI 176

Query: 196 VFAGQVSVVVN 206
                V     
Sbjct: 177 HLLSNVRGQYE 187


>gi|313199983|ref|YP_004038641.1| hypothetical protein MPQ_0216 [Methylovorus sp. MP688]
 gi|312439299|gb|ADQ83405.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 241

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 50/179 (27%), Gaps = 12/179 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGII 101
                       +   +L      I+  F+ +  + +    Y L A +            
Sbjct: 11  FWIDRSVQPPERRPDANLRHDPDYILDNFVTTRTNVNGALAYVLAAVK--MKHYPDDDTT 68

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-----KVKDNLRLDFET 156
            L+                 +       +    T+       +     K K  + +  + 
Sbjct: 69  ELERPR--FTQYAVNKPYTQIEGQRGNVSSDGETVEFMDNVIVIRQASKDKGEMMVRTQY 126

Query: 157 AVLDVKNITINSSDPVIITH-SDFVLSANFARIENSSRSAVFAGQVSVVV-NPGVLQKK 213
             +  K     +  PV+IT   + V+ AN       +++    G+V     +P V +K 
Sbjct: 127 LKMFPKQEVAVTDKPVVITQAPETVIHANGMVFNKKNQTVNLRGRVRAHYLSPSVTKKA 185


>gi|308271829|emb|CBX28437.1| hypothetical protein N47_G37610 [uncultured Desulfobacterium sp.]
          Length = 163

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 5/124 (4%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           ++SL A  A   ++  K   F +D  +T  T+ ++  ++YL A        +  + I+  
Sbjct: 39  EWSLEARSAI--YSEDKKEAFFKDLTVTFFTKDNQ--EVYLSADKGTLKTESGNIEINGN 94

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
             +K  ++  L       D K   I S  PV +T     L A+   I+ ++  A   G+V
Sbjct: 95  VVIK-NNDYMLKTGKINYDNKKRIIQSKAPVELTGKSSNLIASSMAIDLNTNKAELIGKV 153

Query: 202 SVVV 205
             + 
Sbjct: 154 DGIF 157


>gi|238028654|ref|YP_002912885.1| hypothetical protein bglu_1g31180 [Burkholderia glumae BGR1]
 gi|237877848|gb|ACR30181.1| Hypothetical protein bglu_1g31180 [Burkholderia glumae BGR1]
          Length = 204

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/190 (11%), Positives = 47/190 (24%), Gaps = 13/190 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD--FEPMIMKKFILSDYSKDR-VKYSLV 86
             P   +  +                 +I              F +++       +Y L 
Sbjct: 10  LLPVIAMAALAGVTYWLLQATLPPPGEAIARPKTHSPDYFADNFSVTELDDSGATQYRLT 69

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A +             L      +   +     +   A     N     + +    K+  
Sbjct: 70  ASKLV--HYEDDETSVLDSP--ALRAFQPGKPVVTATALRGTVNGDVSVVDLYDNAKIVR 125

Query: 147 KDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSA-NFARIENSSRSAVFAGQ 200
                   +  D +   + V +  I +  PV +     + +A N  +  N +R     G 
Sbjct: 126 AAGAGDPPMEADSQHFRVLVNDDVIETEKPVKLQRGLSIANATNGMKYNNVTRVIDLYGN 185

Query: 201 VSVVVNPGVL 210
           V   +    +
Sbjct: 186 VRGTIAASDV 195


>gi|300313257|ref|YP_003777349.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
 gi|300076042|gb|ADJ65441.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
          Length = 202

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/190 (10%), Positives = 57/190 (30%), Gaps = 10/190 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVA 87
                     +G   +   +R +   +++          ++ F       + +  Y +  
Sbjct: 17  VILVLLIGAALGSLWVLQSMRAAGDQQAAQRPRGKPDYYLENFSYVKMGPNGLPRYDMSG 76

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK---- 143
            +              +  +  V         M L++ +AR       +++         
Sbjct: 77  VK----MVHYPTDDSFEITKPVVHNLDQGKPPMELYSDTARVTDEQTQIHMYGNANAIRA 132

Query: 144 -MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
             K ++ +++  +  +L   +  + +  PV +T     L+       N+++     G V 
Sbjct: 133 PYKGREQMQVVSDYLLLLPDDEIVKTDKPVAMTMGTTRLNGVGMVANNATQVVQLFGNVR 192

Query: 203 VVVNPGVLQK 212
               P   ++
Sbjct: 193 GYYEPTPKKR 202


>gi|262170534|ref|ZP_06038212.1| YrbK protein [Vibrio mimicus MB-451]
 gi|261891610|gb|EEY37596.1| YrbK protein [Vibrio mimicus MB-451]
          Length = 187

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 45/183 (24%), Gaps = 17/183 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR--------VKYSLVA 87
           +  +    ++SW       +     +   P  ++  + S  + +           Y +  
Sbjct: 6   IVYILLLFIASWSLYYLLEQEQDSTIQVAP-NLELPMFSGENLENISYSEQGIRNYVIT- 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
                   +  G    +   L V  +     +  + A        +  L +      K  
Sbjct: 64  -SIHLDHYAKSGNTLFRAPILKVY-REGTLQEWEITARRGIL-SKDQVLTLYDDVLAKNL 120

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L      + +K+    +  PV +    F       +   +  SA     V  
Sbjct: 121 LPDSGFDTLTTSEMSIQLKSRDFWADKPVELRGPQFETHGQSMKGNFADHSAELYNNVQG 180

Query: 204 VVN 206
              
Sbjct: 181 RYE 183


>gi|254787686|ref|YP_003075115.1| hypothetical protein TERTU_3818 [Teredinibacter turnerae T7901]
 gi|237684860|gb|ACR12124.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 210

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/200 (9%), Positives = 56/200 (28%), Gaps = 24/200 (12%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLV 86
           +F+  F  + I    +L            +           +      ++ +  ++Y+  
Sbjct: 5   RFYLLFIAMGIASIVMLWDSSENVITPPKAEPAPQIPYAFAENAATRYFNDNGVLEYAFT 64

Query: 87  AE-----RAKTSFNSGKGIIFLQD-FELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
           A      R             + D    T+  + + +   ++ +   +   ++  + +  
Sbjct: 65  ANLLEHFRVLGDNRQPVDEYTMVDHPHFTIYQEDTPW---HVESVDGKLVRSSEQIALWD 121

Query: 141 PFKMK--------------VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
             ++                ++   L  E   ++       + +PV I     V++A   
Sbjct: 122 TVRIWQEPPERLPGEEAPAYREASELTTEKLDINPVEKVAYTDEPVKILTPYGVINAVGM 181

Query: 187 RIENSSRSAVFAGQVSVVVN 206
                +R      +V  +  
Sbjct: 182 TANFKNRKIELHHKVHAIHR 201


>gi|167041249|gb|ABZ06005.1| hypothetical protein ALOHA_HF4000005D21ctg1g10 [uncultured marine
           microorganism HF4000_005D21]
 gi|167045753|gb|ABZ10399.1| hypothetical protein ALOHA_HF4000APKG3108ctg1g10 [uncultured marine
           bacterium HF4000_APKG3108]
          Length = 198

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/133 (11%), Positives = 43/133 (32%), Gaps = 4/133 (3%)

Query: 61  LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
              E  I +    +        + + +E+A         I+++ + ++T+         +
Sbjct: 52  DSKERNIFENVEYNSLYDMDKPFKVKSEKAYILIKE-PDIVYMTNMQVTLDMDDGRV--V 108

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + +   R+N   +  +     K        +  E   L     +    + V +T+    
Sbjct: 109 IITSDKGRYNKVTYDCFFENNVKAI-DGKTTVLAENLDLLATEDSATVYNNVFLTNDKGS 167

Query: 181 LSANFARIENSSR 193
           L A+    +  ++
Sbjct: 168 LRADKIHYDFETK 180


>gi|238019689|ref|ZP_04600115.1| hypothetical protein VEIDISOL_01563 [Veillonella dispar ATCC 17748]
 gi|237863730|gb|EEP65020.1| hypothetical protein VEIDISOL_01563 [Veillonella dispar ATCC 17748]
          Length = 178

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 45/173 (26%), Gaps = 4/173 (2%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAK- 91
              +       L   I         +     +   +  F  +D  +++    + A  A+ 
Sbjct: 7   LIAIVAAIVLALIGLIVYIMKDSGDVSTTQNQNGQLVNFQGADLQEEKDGKLVWALSAEK 66

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR 151
             ++     I L + +              + A  A      ++L I Q       D   
Sbjct: 67  IEYDPRTKAIVLTNLKGLFYQDD---VTTTITAPHAVLTGDRNSLDIDQGVTATNTDGAE 123

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              +    D K  T+ S         D  L+ +      S +     G   + 
Sbjct: 124 FKTDALHFDNKTKTLTSKSAFTYNSKDITLTGDKLEGNMSLKKIKAIGNAKLT 176


>gi|282850057|ref|ZP_06259439.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282580246|gb|EFB85647.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 178

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 47/173 (27%), Gaps = 4/173 (2%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAK- 91
              + +   F L   I       +       +   +  F  +D  +++    + A  A+ 
Sbjct: 7   LIAIVVAIVFALIGLIVFIMKDSNEATSTQNQSGQLVNFQGADLQEEKDGKLVWALSAEK 66

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR 151
             ++     I L + +              + A  A      ++L I Q       +   
Sbjct: 67  IEYDPRTKAIVLTNLKGLFYQDD---VTTTITAPHAVLTGDRNSLDIDQGVTATNTEGAE 123

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              E    D K  T+ S         D  L+ +      S +     G   + 
Sbjct: 124 FKTEALHFDNKTKTLTSKTAFTYNSKDVTLTGDKLEGNMSLKIIKAIGHAKLT 176


>gi|312142807|ref|YP_003994253.1| protein of unknown function DUF1239 [Halanaerobium sp.
           'sapolanicus']
 gi|311903458|gb|ADQ13899.1| protein of unknown function DUF1239 [Halanaerobium sp.
           'sapolanicus']
          Length = 192

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/172 (10%), Positives = 52/172 (30%), Gaps = 5/172 (2%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMK-KFILSDYSKD-RVKYSLV 86
            F       I+   L  +         + ++ ++            S  +++   +  L+
Sbjct: 6   IFLGLFIFMIIVISLFLTLDDPPFIEPNDLNEVEEGAEEELEDVRFSIINRNQNHELKLI 65

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +ER        +  + L   E+ V  +        L     ++      + +    +++ 
Sbjct: 66  SERV--DNYQSENRMELYPVEIEVYDREDGELLYTLKGDFGQYFTREDYIELRGNVEIES 123

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
                ++ +     +    +   D V I  +DF  +A     + + R+    
Sbjct: 124 D-RYFIEADELDYFLNEDFLEGRDSVQIRGADFTSTAKRFDSDLNLRNLRLY 174


>gi|227326633|ref|ZP_03830657.1| hypothetical protein PcarcW_04639 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 195

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 66/191 (34%), Gaps = 13/191 (6%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            +  ++L  F     + ++GW +       +  +      +        +     YS   
Sbjct: 2   SKTKRWLTAFLALLVLILIGWNIADDDTVTAPDANDPAVPVYTSEKTNTQV----YSPAG 57

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              Y L++E+A+  + + + + +      T+  ++       + A  A+    +  LY+ 
Sbjct: 58  KLSYRLISEKAE--YFNDEQLSWFTKPVATLFNEQGT-ATWSVRADRAKL-TKDKMLYLY 113

Query: 140 QPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++          R+    A +++    ++S D V +  + F  S    R    +++A
Sbjct: 114 GNVEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGASFTSSGMKMRGNLRNKTA 173

Query: 196 VFAGQVSVVVN 206
               +V     
Sbjct: 174 ELIEKVKTSYE 184


>gi|269797610|ref|YP_003311510.1| hypothetical protein Vpar_0547 [Veillonella parvula DSM 2008]
 gi|294793352|ref|ZP_06758497.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
 gi|294795171|ref|ZP_06760305.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
 gi|269094239|gb|ACZ24230.1| protein of unknown function DUF1239 [Veillonella parvula DSM 2008]
 gi|294453963|gb|EFG22338.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
 gi|294455783|gb|EFG24148.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
          Length = 178

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 47/173 (27%), Gaps = 4/173 (2%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAK- 91
              + +     L   I       +  +    +   +  F  +D  +++    + A  A+ 
Sbjct: 7   LIAIVVAIVLALIGLIVFIMKDSNEANSTQNQSGQLVNFQGADLQEEKDGKLVWALSAEK 66

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR 151
             ++     I L + +              + A  A      ++L I Q       +   
Sbjct: 67  IEYDPRTKAIVLTNLKGLFYQDD---VTTTITAPHAVLTGDRNSLDIDQGVTATNTEGAE 123

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              E    D K  T+ S         D  L+ +      S +     G   + 
Sbjct: 124 FKTEALHFDNKTKTLTSKTAFTYNSKDVTLTGDKLEGNMSLKIIKAIGHAKLT 176


>gi|206900433|ref|YP_002251685.1| hypothetical protein DICTH_1877 [Dictyoglomus thermophilum H-6-12]
 gi|206739536|gb|ACI18594.1| conserved hypothetical protein [Dictyoglomus thermophilum H-6-12]
          Length = 215

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/119 (12%), Positives = 36/119 (30%), Gaps = 8/119 (6%)

Query: 101 IFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR----LDFET 156
           IF+    +TVP        + + A    ++    T        +  K        +    
Sbjct: 7   IFMILIFITVPVLSQTKNPVKITAQKISYDYGKKTTRAEGNVVVIYKPGQEDETRITATL 66

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
              +     + +   V I+  D  +     +++           V++V+     +K +N
Sbjct: 67  VFYNQDTNVVEAPGKVNISQKDLSIVGEDLKVDLKKEVLELKKNVNMVLQ----RKADN 121



 Score = 39.7 bits (91), Expect = 0.30,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 36/96 (37%), Gaps = 7/96 (7%)

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKM----KVKDNLRLD---FETAVLDVKNITINS 168
              D+ +     + +L    L + +   M    K  + + +     ++ V  +KN T N 
Sbjct: 85  SQKDLSIVGEDLKVDLKKEVLELKKNVNMVLQRKADNKVEITKLFAQSVVYSLKNKTGNM 144

Query: 169 SDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           +  V I   D  +S++ A  +       F   V +V
Sbjct: 145 TGGVRIERDDLTVSSSSADFDTDKEIYTFVDNVKMV 180


>gi|188591125|ref|YP_001795725.1| hypothetical protein RALTA_A0334 [Cupriavidus taiwanensis LMG
           19424]
 gi|170938019|emb|CAP63003.1| conserved hypothetical protein, DUF1239; putative TRANSMEMBRANE
           PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 209

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 45/190 (23%), Gaps = 14/190 (7%)

Query: 26  FLKFF-FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KY 83
            ++        +     F L           +           M +F  ++ + D   K 
Sbjct: 12  VMRLLPLLLMAIVAGSTFWLVQINSPREDQAAQTAKKHEPDYFMDRFSATELAPDGSTKI 71

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP-- 141
               ER             +    +           +   A   R N     + +     
Sbjct: 72  RFTGER--MIHFEDDQTYEVTRPAMRAYEPDR--PPVTARADIGRMNAEGTVIDLYGNGY 127

Query: 142 ------FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
                         L        L V +  + +  PV +T    V++AN     N +R  
Sbjct: 128 VLRQQGADPSKDPQLTAASSYFQLLVNDDIVKTDKPVKLTRGPSVMTANGLIFNNVTREV 187

Query: 196 VFAGQVSVVV 205
              G V   +
Sbjct: 188 QLLGNVRGTI 197


>gi|167561502|ref|ZP_02354418.1| hypothetical protein BoklE_02994 [Burkholderia oklahomensis EO147]
 gi|167568731|ref|ZP_02361605.1| hypothetical protein BoklC_02724 [Burkholderia oklahomensis C6786]
          Length = 204

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 45/187 (24%), Gaps = 11/187 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
                      G + L                          F +++  +    +Y L A
Sbjct: 11  IPLVAMAALAGGTYWLLQATLPPPGESVVRPKSHTPDYFADNFSVTELDQTGSTQYRLTA 70

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
             A            L      +   +     +   A     N     + +    ++   
Sbjct: 71  --AGLVHYEDDETSDLTQP--ALRAFQPGKPTVTATAKRGTVNGDVSIVDLYDEARILRA 126

Query: 146 ---VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN-FARIENSSRSAVFAGQV 201
                  ++ D +   + V +  I +  PV +     + +A    +  N +R     G V
Sbjct: 127 AGGTDPQMQADSQHFRVLVNDDVIETEKPVKLQRGLSIANAAAGMKYNNVTRVIELYGNV 186

Query: 202 SVVVNPG 208
              +   
Sbjct: 187 RGTIATS 193


>gi|291612910|ref|YP_003523067.1| hypothetical protein Slit_0439 [Sideroxydans lithotrophicus ES-1]
 gi|291583022|gb|ADE10680.1| protein of unknown function DUF1239 [Sideroxydans lithotrophicus
           ES-1]
          Length = 195

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/144 (11%), Positives = 42/144 (29%), Gaps = 12/144 (8%)

Query: 73  LSDYSKD--RVK-YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
            S  + +      Y+L AE+             L+  ++T              A +   
Sbjct: 54  FSAVTLNLQGRPRYTLSAEKLW--HYPDDDSTHLEMPKVTSLYADR--PPTITSAQTGMV 109

Query: 130 NLANHTLYISQPFKMK-----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
           +     +Y+     +           R       +        ++  V++T+   ++ A 
Sbjct: 110 SSKGDDVYLYDDVNVVRPASGDLGEQRFVTGYLHVVPDRDWAETNQSVVMTNQYNIIRAV 169

Query: 185 FARIENSSRSAVFAGQVSVVVNPG 208
              ++N +R+     +V     P 
Sbjct: 170 GMELDNQARTVKLLSRVRANHEPN 193


>gi|149925778|ref|ZP_01914042.1| hypothetical protein LMED105_06122 [Limnobacter sp. MED105]
 gi|149825895|gb|EDM85103.1| hypothetical protein LMED105_06122 [Limnobacter sp. MED105]
          Length = 199

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 58/192 (30%), Gaps = 10/192 (5%)

Query: 21  VRFIQFLKFFFPFA-TVTIVGWFLLSSW-IRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
             F   +  F P   T  +       +    +S FS S           ++ F +  +  
Sbjct: 9   SAFFNLISQFIPLLLTFALAATSYWFAIQSELSLFSTSGKSDPTSSDYYLRNFSVQSHDL 68

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFEL-TVPTQRSEYGDMYLFAHSARFNLANHTLY 137
              KYS++   A      G     + +     +    S  G +   A    + L    ++
Sbjct: 69  AENKYSIIRSNAAEHIPQG----NVWNITAPELEQFESGNGMVKGNAQKGVYLLDTDEIF 124

Query: 138 ISQPFKMKVKDN---LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           +     +  ++      +  E   +D     I++   V++T       A  A + N +  
Sbjct: 125 LRDNVVVTSQNEGLLTTMKSEEIRIDNITNEISTDKNVLVTRPGQRFEAQGATLNNDTGE 184

Query: 195 AVFAGQVSVVVN 206
               G +   + 
Sbjct: 185 LTAQGSIKFRIE 196


>gi|254497760|ref|ZP_05110533.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254353053|gb|EET11815.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 190

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/186 (9%), Positives = 51/186 (27%), Gaps = 9/186 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            +  F  +T+       S   + T       L +   M +    +  ++ D +  +L+  
Sbjct: 8   IWLFFTLITLACSGWYYSHSSLITRLDRE-TLANSVEMTVSHLKVRQFNTDGMLVNLLTT 66

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                  +G   ++L   +  +   + E     + +++ +       +  S    +  K 
Sbjct: 67  PIMQHIQNGD--VYLFQ-KPHILVSQEEQPPWDIRSNNGKSVEGGKRITFSGNVIVHQKP 123

Query: 149 NLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
             +     L  E  +        ++   V       ++ +         +      Q   
Sbjct: 124 GNKTQESTLKTEEVIYFPNEKKASTDLLVTYEQPGNIIQSEGMNAYLDEKRVELLHQARG 183

Query: 204 VVNPGV 209
              P  
Sbjct: 184 SYVPKN 189


>gi|297569294|ref|YP_003690638.1| protein of unknown function DUF1239 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925209|gb|ADH86019.1| protein of unknown function DUF1239 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 191

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/166 (12%), Positives = 50/166 (30%), Gaps = 4/166 (2%)

Query: 42  FLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGII 101
           FL    + +           + +   M++   +      +++   A        +G    
Sbjct: 30  FLAPPPVPVGDDEVRERRPTEEQHFTMEQVRFAQEIDGTLEW--RANSRDLRSGAGGEGF 87

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
           FL   E       +E   +++ A   R++ A   L +    ++   D   L  +      
Sbjct: 88  FLTGVEAVFFRDEAEQ--VWIDADHGRYDQALAVLELEDNVRLLDADGFSLRTQALNYYE 145

Query: 162 KNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
           +   ++S   V I+  +                   +G+V  +  P
Sbjct: 146 REGRVSSRVGVEISGDEVSARGQSLDYFLVDGRYELSGEVEFLTVP 191


>gi|318040070|ref|ZP_07972026.1| hypothetical protein SCB01_00115 [Synechococcus sp. CB0101]
          Length = 188

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/183 (8%), Positives = 43/183 (23%), Gaps = 9/183 (4%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-Y 83
           + L          +V      +    S          +             +  D    Y
Sbjct: 4   KILNTLIFALIAVVVAALGYWNLAPDSARQTQRTSDDNVVDFYAVGARTVQFQDDGKLHY 63

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            + A++ +        I  +   +L +           + +  A  +     + +    +
Sbjct: 64  RMTADKLE--HIKSTDITLIDTPKLKLYR--GTELPWEVTSQRAEVSPGGVEVELIDDVR 119

Query: 144 MKVKDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +   D       +      +        +   V I  ++ V +A   +   +    +   
Sbjct: 120 IARTDAKSRPTVITSSRMTVIPDKEYAQTEQAVRIVAANGVTTAQGMKAYLNDGRMILQS 179

Query: 200 QVS 202
            V 
Sbjct: 180 NVR 182


>gi|224369874|ref|YP_002604038.1| hypothetical protein HRM2_27840 [Desulfobacterium autotrophicum
           HRM2]
 gi|223692591|gb|ACN15874.1| hypothetical protein HRM2_27840 [Desulfobacterium autotrophicum
           HRM2]
          Length = 201

 Score = 59.0 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 51/168 (30%), Gaps = 5/168 (2%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGK 98
           +G                 I +     +++ K   +       +++L A  A       +
Sbjct: 26  IGGLYYKQRFFSGDLVLKKISVDSKATLLLNKMHQTSTRNSIKEWTLDASSA--KLLKDE 83

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAV 158
               + D  +   T  ++  +++L + +   +   H +  S    +       L      
Sbjct: 84  NKAQMTDVRVVFFTDNAK--EIHLSSTNGLLDTKTHDMSFSDNVVVTYDQ-YTLKTAELH 140

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            D K   + S+  + I   + +L A+    +    +    G V    +
Sbjct: 141 YDKKRHILYSNVHISIMDKESILEADTMETDLDKNTTRLRGNVKGTFS 188


>gi|262401815|ref|ZP_06078380.1| YrbK protein [Vibrio sp. RC586]
 gi|262351787|gb|EEZ00918.1| YrbK protein [Vibrio sp. RC586]
          Length = 187

 Score = 59.0 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/183 (10%), Positives = 46/183 (25%), Gaps = 17/183 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR-VKYSLVA 87
           +  +    ++SW       +     +   P  ++  + S        Y++     Y +  
Sbjct: 6   IVYILLLFIASWSLYYLLEQKQDSTIQVAP-NLELPMFSGENLENISYNEQGIRNYVIT- 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
                   +  G    +   L V  +     +  + A        +  L +      K  
Sbjct: 64  -SIHLDHYAKSGNTLFRAPILKVY-REGTLQEWEITARRGIL-SKDQVLTLYDDVLAKNL 120

Query: 146 --VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L      + +K+    +  PV +    F       +   +  SA     V  
Sbjct: 121 LPDSGFDTLATSEMSIQLKSRDFWADKPVELRGPQFETQGQSMKGNFADHSAELYNNVQG 180

Query: 204 VVN 206
              
Sbjct: 181 RYE 183


>gi|220932588|ref|YP_002509496.1| Protein of unknown function (DUF1239) [Halothermothrix orenii H
           168]
 gi|219993898|gb|ACL70501.1| Protein of unknown function (DUF1239) [Halothermothrix orenii H
           168]
          Length = 198

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 55/174 (31%), Gaps = 5/174 (2%)

Query: 29  FFFPFATVTIVGWFLLS-SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLV 86
                 ++ + G F    + I  S   +S+ D        +K   L+ YSK +  +  + 
Sbjct: 9   IILIVLSIMVAGVFFTFRAGINTSDNPESTPDKQTGTYRELKGARLTLYSKSKDIRLEVS 68

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +       N+    I +   E+ V   ++E         +  +      L +S P  ++ 
Sbjct: 69  SSNVTNRDNNK--TIDMTGIEVKVRDNKTEELLYTFSGQNGLYLADRGELRVSGPVVLQK 126

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
              + L+  +      +  I     V +    F +  +       S   +  G 
Sbjct: 127 D-MITLNSGSLCWKENSDIITGKGGVKLDLPRFTIEGDKMEAAPGSGLVMIHGN 179


>gi|71909032|ref|YP_286619.1| hypothetical protein Daro_3420 [Dechloromonas aromatica RCB]
 gi|71848653|gb|AAZ48149.1| Protein of unknown function DUF1239 [Dechloromonas aromatica RCB]
          Length = 193

 Score = 59.0 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 50/183 (27%), Gaps = 11/183 (6%)

Query: 30  FFPFATVTIVGWF-LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
            FP   + ++            S   K           I + F +  +      +Y L A
Sbjct: 8   LFPIIMLALLAGLTFWLQSTIDSGNEKHDGKFRHDPDAIAENFTVRRFDATGEVRYRLTA 67

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
                          L+   L      +    + +  + A+      T+YI +   +   
Sbjct: 68  --PYLEHFPDDDSSELKSPILISYRPDA--PSITVKGNYAKVTSKGETVYIWENVSVTRA 123

Query: 148 D-----NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                  L                 ++ PV IT     ++   A I+N++ + V   QV 
Sbjct: 124 GAADRLELVARMPDLTAQPDAGFAFTNSPVEITQGQSWMTGVGAHIDNNNSTFVLQSQVK 183

Query: 203 VVV 205
              
Sbjct: 184 GQY 186


>gi|329121344|ref|ZP_08249970.1| hypothetical protein HMPREF9083_0431 [Dialister micraerophilus DSM
           19965]
 gi|327469753|gb|EGF15219.1| hypothetical protein HMPREF9083_0431 [Dialister micraerophilus DSM
           19965]
          Length = 177

 Score = 58.6 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 40/122 (32%), Gaps = 5/122 (4%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           + L A+R     +       +   E            + + A SA FN   + LY+    
Sbjct: 58  WKLKADRVNIDKDKN-----VMSIEGAECIFNDNGISLNVNADSAIFNKNENVLYLKGSI 112

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
           K    D   L  E    + K   ++S  P  I      L+A+    +   ++    G  S
Sbjct: 113 KGHSDDGTSLKAENLKYESKTGILSSDKPFFIEKDGHKLTADSFTADRILKTVKAKGNAS 172

Query: 203 VV 204
           + 
Sbjct: 173 LT 174


>gi|323498692|ref|ZP_08103682.1| YrbK protein [Vibrio sinaloensis DSM 21326]
 gi|323316248|gb|EGA69269.1| YrbK protein [Vibrio sinaloensis DSM 21326]
          Length = 187

 Score = 58.6 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/183 (13%), Positives = 53/183 (28%), Gaps = 17/183 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR-VKYSLVA 87
           +  +       W     + +         P  +++ + S        Y+ D    Y + +
Sbjct: 6   IGYLILVFALCWSGYYYYERQQKQSPKVSP-DLEQPMFSGQTLTNTSYTDDGIRSYVITS 64

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
                   +  G    +   L V  +     +  + A +   +  NH L +S    +K  
Sbjct: 65  NSL--DHFAKSGDTVFEKPILKVY-KDGLMQEWEITAATGVLD-KNHILTLSTNVIVKNL 120

Query: 148 DN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
            +      L  E+  + + N    + + VII    F       +   +  +A     V  
Sbjct: 121 LSDSGFDTLSTESMNIALDNRDFWADNQVIINGPQFETVGQAMKGNFADHNATLYKSVQG 180

Query: 204 VVN 206
              
Sbjct: 181 RYE 183


>gi|323140932|ref|ZP_08075845.1| hypothetical protein HMPREF9443_00610 [Phascolarctobacterium sp.
           YIT 12067]
 gi|322414670|gb|EFY05476.1| hypothetical protein HMPREF9443_00610 [Phascolarctobacterium sp.
           YIT 12067]
          Length = 184

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 53/180 (29%), Gaps = 9/180 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKF---ILSDYSKDRVK-Y 83
           K         ++    + +W+ +S     ++   D     +       +    KD  K +
Sbjct: 5   KVILSVLAGIVIAG-AIIAWLMLSGDKPITVKPGDGVTAQINASLKNSMVKREKDGKKLW 63

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
               E             +L+  +  V      +  + + A      + ++  ++    K
Sbjct: 64  EFTVEEVVNDKAK--NTAYLKGIKGKVYRADGSF--IDISADKGSAGMKSNDFFLEGNIK 119

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
             +     L  +    + +   I ++    +    +  +A+ A   ++ +     G   V
Sbjct: 120 AVLNTGGELYADKISWNQEKELITATGHFKMHKDAYTATADSAVTTSAFKHIKLKGNAKV 179


>gi|302036695|ref|YP_003797017.1| hypothetical protein NIDE1341 [Candidatus Nitrospira defluvii]
 gi|300604759|emb|CBK41091.1| exported protein of unknown function [Candidatus Nitrospira
           defluvii]
          Length = 190

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/178 (11%), Positives = 57/178 (32%), Gaps = 10/178 (5%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL---LDFEPMIMKKFILSDYSKDRV 81
           ++++      +V +  +       R +  S S        +     ++ F  +    D V
Sbjct: 4   RWIRRGLLALSVVLAAFLGYLLVTRSNPGSSSRSVAPVGTESADARIQDFTFTQTKGDLV 63

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ- 140
           ++ + AE+A+      +    L + ++T+   + +  ++ L       +       +S  
Sbjct: 64  QWKVQAEQAR--LFEKESRAILNNVQITMYGAQGK--ELTLSGDEGTLDTQTKNFQLSNR 119

Query: 141 --PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             P  ++ +    +     V       I + D V I      ++      +  +    
Sbjct: 120 TTPIVVETQSGYTIQTNHLVWTDARHEIQTPDHVTINGHGLQVTGRGLLGKMDTEEFQ 177


>gi|242279724|ref|YP_002991853.1| hypothetical protein Desal_2258 [Desulfovibrio salexigens DSM 2638]
 gi|242122618|gb|ACS80314.1| protein of unknown function DUF1239 [Desulfovibrio salexigens DSM
           2638]
          Length = 196

 Score = 58.6 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/191 (9%), Positives = 63/191 (32%), Gaps = 10/191 (5%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL------DFEPMIMKKFILSDY 76
            +  + +F    ++ +    LL             +         +   +  ++  L   
Sbjct: 3   RVGLVLYFILALSLGVSAGTLLGKKYGTFPHMAREVVENPLLSNKNQSDISAEEIELIQG 62

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +   +++ L A  A   ++  KG++      +T    R    ++++ A     +     L
Sbjct: 63  TGGDIEWILRAGSA--DYDQEKGLVIADKPRVTYYLGRDRK-EVFVSALHGEVSQKGEGL 119

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +    K     ++ L  +      K+  +     V +      +++   +++  +R  +
Sbjct: 120 KLWDDVKGHY-GDMGLVADRLDFKPKDNLLFLEGNVKVQSPTVYITSKRVKVDLVTREIM 178

Query: 197 FAGQVSVVVNP 207
               +  +++P
Sbjct: 179 IEDGMEALISP 189


>gi|326565404|gb|EGE15581.1| hypothetical protein E9K_03026 [Moraxella catarrhalis 103P14B1]
 gi|326573392|gb|EGE23360.1| hypothetical protein E9Y_09076 [Moraxella catarrhalis 101P30B1]
 gi|326575711|gb|EGE25634.1| hypothetical protein E9W_02045 [Moraxella catarrhalis CO72]
          Length = 191

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 53/176 (30%), Gaps = 10/176 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           +       + +           +               +   K I +D      +Y+L A
Sbjct: 4   RILSVLGVIALAVAVWFFYQEDVEVKPALPEVPTVDSEVTQIKAIQTDPKTGATEYTLTA 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK---- 143
           +    + N    ++       T+  Q  +     L A  A     +  L +SQ F+    
Sbjct: 64  DSLIQNANGQDEMLG-----ATIHWQPPQGETYTLTADRATLEQNSGDLRLSQGFRLVRA 118

Query: 144 -MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
               K  + ++    + + KN TI+S DP+ +        A   R    +    F 
Sbjct: 119 ATADKPEMIIEGLNIIGNTKNRTISSQDPLTVQQGIDRFKAQGFRANLQTGEYEFD 174


>gi|326560506|gb|EGE10888.1| hypothetical protein E9G_06132 [Moraxella catarrhalis 7169]
 gi|326565764|gb|EGE15926.1| hypothetical protein E9Q_09295 [Moraxella catarrhalis BC1]
          Length = 191

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 53/176 (30%), Gaps = 10/176 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           +       + +           +               +   K I +D      +Y+L A
Sbjct: 4   RILSVLGVIALAVAVWFFYQEDVEVKPALPEVPTVDSEVTQIKAIQTDPKTGATEYTLTA 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK---- 143
           +    + N    ++       T+  Q  +     L A  A     +  L +SQ F+    
Sbjct: 64  DSLIQNANGQDEMLG-----ATIHWQPPQGETYTLTADRATLEQNSGDLRLSQGFRLVRA 118

Query: 144 -MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
               K  + ++    + + KN T++S DP+ +        A   R    +    F 
Sbjct: 119 ATADKPEMIIEGLNIIGNTKNRTVSSQDPLTVQQGMDRFKAQGFRANLQTGEYEFD 174


>gi|307544516|ref|YP_003896995.1| hypothetical protein HELO_1926 [Halomonas elongata DSM 2581]
 gi|307216540|emb|CBV41810.1| protein of unknown function DUF1239 [Halomonas elongata DSM 2581]
          Length = 194

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 15/165 (9%), Positives = 42/165 (25%), Gaps = 8/165 (4%)

Query: 53  FSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS--LVAERAKTSFNSGKGIIFLQDFELTV 110
                 D        ++    + +  +   +   +      T  +    +  L+   + +
Sbjct: 34  PGPVPQDAAGEPDYYLEDVEATRFDAEGYPHQRLITPRLVHTPID---DVTRLESPNVKL 90

Query: 111 PTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSS 169
             +          A   R     + L +S   +++  +++ +L  +    D       S 
Sbjct: 91  --RDDGGRHWTARAERGRLETGGNPLILSGDVRLEAPEEHWQLTTQELHYDADTGHAWSE 148

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
            P  ++     +             A     V     P   +  E
Sbjct: 149 TPATLSQPPQSMQGERFDAWLHDNRARLTDNVRGHHPPATDEDPE 193


>gi|42522413|ref|NP_967793.1| hypothetical protein Bd0840 [Bdellovibrio bacteriovorus HD100]
 gi|39574945|emb|CAE78786.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 341

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/200 (14%), Positives = 49/200 (24%), Gaps = 44/200 (22%)

Query: 55  KSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQR 114
           K            M    L +       + L A  A+   +   G   LQ   +      
Sbjct: 59  KEDPGPSSLADQKMGGVHLVESQSGNRDWELFAVSAE--GSQAGGKWSLQQVRVLFY--N 114

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
            E  +  +       +  +  L +      K ++       +     K   I S + V++
Sbjct: 115 QEKLEFTVTGDEGTIDDKSKDLSVIGNVVTKSENGYVFKTPSIFYSSKTRQIVSPEQVLM 174

Query: 175 THSD----------------------------------------FVLSANFARIENSSRS 194
                                                       F +SA+ A     SR 
Sbjct: 175 EGPRDSSGGGLFLKGASMKVLVEQSKMLIQNKVTAQKPMKDGKTFDISADGAEFSGKSRE 234

Query: 195 AVFAGQVSVVVNPGVLQKKE 214
           A F G V +  +   L+  E
Sbjct: 235 ARFLGAVRMNYDNMKLEGPE 254


>gi|269104092|ref|ZP_06156789.1| YrbK protein [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163990|gb|EEZ42486.1| YrbK protein [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 187

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/179 (12%), Positives = 52/179 (29%), Gaps = 16/179 (8%)

Query: 40  GWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR-VKYSLVAERAK 91
              +L +        +      D   +  +K + +        Y++     Y +  + A 
Sbjct: 9   LLVVLVAVWSGYYLLQKHWQSDDQVTIDSEKPVFTGDVVSNTSYNEKGIRSYQI--DSAH 66

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV----K 147
               S  G        L V  Q     +  + A+ A     +  L +    ++       
Sbjct: 67  IEHFSISGNTTFSKPVLWVY-QDGSKTEWRVSANDALL-TQDQVLEMKGNVRIFNLLPES 124

Query: 148 DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
               +  +   L++ N   ++ D V+IT + F    +  +       A     V  +  
Sbjct: 125 AIQVISTDNLRLNLVNKDFDTQDHVVITGTSFENEGDGLKGNMDRNVATLLNNVKGIYE 183


>gi|198284716|ref|YP_002221037.1| hypothetical protein Lferr_2636 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666614|ref|YP_002427395.1| hypothetical protein AFE_3028 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198249237|gb|ACH84830.1| protein of unknown function DUF1239 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518827|gb|ACK79413.1| hypothetical protein AFE_3028 [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 189

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 47/167 (28%), Gaps = 8/167 (4%)

Query: 44  LSSWIR--ISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGI 100
             SW +  IS         +       +  ++  Y+          A+ A      G   
Sbjct: 28  WWSWPQHPISLPQIDWHGQIHKGDQAAEDVVMRQYTAAGNLDLLATAQAAY--HVPGVDQ 85

Query: 101 IFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLD 160
             L    +       +    +L A     +  +  + +       ++ + RL  E    D
Sbjct: 86  TVLSQVAVERFKPGQQ---THLRADQGLVDDRSQRITLWGNVVGTLQPDTRLLTERVYYD 142

Query: 161 VKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
            +   I S +PV +      ++    R    ++      +V     P
Sbjct: 143 PQTGIITSPEPVRLERGRDWMTGVGLRASVKTQEVDILHEVRGAYIP 189


>gi|94309251|ref|YP_582461.1| hypothetical protein Rmet_0306 [Cupriavidus metallidurans CH34]
 gi|93353103|gb|ABF07192.1| conserved hypothetical protein; putative exported protein
           [Cupriavidus metallidurans CH34]
          Length = 208

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 22/191 (11%), Positives = 50/191 (26%), Gaps = 16/191 (8%)

Query: 35  TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTS 93
            +     F L         +  +          M +F  ++ ++D   K      +    
Sbjct: 22  AIVAGSTFWLVQINSPHEATAQAQVKRHVPDYYMDRFSATELAEDGNTKIRFTGVK--MV 79

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV------- 146
                    +    +           +   A+    N     + +     +         
Sbjct: 80  HFEDDQTYEVTTPAMRNYEPDR--PPVTANANRGVMNAEGSIIDLYGNAFIVRQAGTDVS 137

Query: 147 -KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
               +    +   L V +  + +  PV +T    V++AN     N +R     G V   +
Sbjct: 138 KDPRMTAASQYFQLLVNDDIVKTDKPVELTRGPSVMNANGLIFNNVTREVQLLGNVRGTI 197

Query: 206 ---NPGVLQKK 213
              +PG    +
Sbjct: 198 IMNSPGQASAQ 208


>gi|261493297|ref|ZP_05989823.1| hypothetical protein COK_1705 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496563|ref|ZP_05992943.1| hypothetical protein COI_2285 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307766|gb|EEY09089.1| hypothetical protein COI_2285 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310941|gb|EEY12118.1| hypothetical protein COK_1705 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 194

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/198 (9%), Positives = 46/198 (23%), Gaps = 19/198 (9%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR 80
           +       +  V      S           +   +       +            Y    
Sbjct: 4   RLTVILLIIVAVLGGWYYSLQEKENTGLDQLIKKEG------QPEYVGNKMSTTVYDLKG 57

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
                 A+  +                + +  + S      + A  A        L +  
Sbjct: 58  NPQYF-AQATEIKRYESTERTEFFKPFIELFAKESTQKQWKVSADYAEI-TKEKMLNLKG 115

Query: 141 PFKMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             K+          ++  +T  +D+    I +   V    S F  +    +     + A 
Sbjct: 116 NIKLVALDPASRLQQITTDTLTVDLNTQDIFTESTVKSIGSGFTTTGVGLKGNLKQQVAT 175

Query: 197 FAGQVSVVVNPGVLQKKE 214
               V   + P ++Q+ +
Sbjct: 176 LQKDVKSYIEPTIIQETK 193


>gi|302063706|ref|ZP_07255247.1| hypothetical protein PsyrptK_27299 [Pseudomonas syringae pv. tomato
           K40]
          Length = 166

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 11/129 (8%), Positives = 35/129 (27%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + A++ +    +   +  L    L +          ++ +     + A   + +   
Sbjct: 40  QYDMTADKVEHVMAT--DVSLLTTPNLHMYR--GGEFPWHVTSKRGEVSSAGDQVELIDD 95

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 96  VRVERTDEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 155

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 156 LSNVRGQYE 164


>gi|237746784|ref|ZP_04577264.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378135|gb|EEO28226.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 201

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/193 (11%), Positives = 60/193 (31%), Gaps = 10/193 (5%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
                 L   F    +  +G   L+  IR +    +++        I++ F       D 
Sbjct: 7   SALRVRLTIVFVVVLILTLGSMWLNMVIRKTATDAAALAQRTEPDFIVENFRYFKMKPDG 66

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
             +Y  +  +          +I        + +  ++     + +  A     N  +++ 
Sbjct: 67  QAQYEAIGTKMTHFPIEDSYLID----NPVIFSLNNDSQLQTIKSKEAYVEDFNSKIHMR 122

Query: 140 QPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               M  + +      +L  E  ++   +  + S   VI+  +  V++    +  N++  
Sbjct: 123 NDVVMNREPSATKGPFKLTSEYVLVYPDDEIMTSDREVIVHDNHSVMTGVGMQANNATSE 182

Query: 195 AVFAGQVSVVVNP 207
                +  +   P
Sbjct: 183 LQIFNRARITYQP 195


>gi|219870360|ref|YP_002474735.1| hypothetical protein HAPS_0083 [Haemophilus parasuis SH0165]
 gi|219690564|gb|ACL31787.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 192

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 51/190 (26%), Gaps = 10/190 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YS 84
            L          + GW    S     T     I        I +K   S Y  +    YS
Sbjct: 4   RLNIILATLAAVLAGW--YYSQQSDDTRLSQLIKKEGSAEYIGQKISTSAYDLNGKPQYS 61

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
             AE  K         I      L +    S      + A  A     +  L +    K+
Sbjct: 62  AQAEEVKR--YESTQRIEFLKPLLNLFDAESALKQWQVEADYADV-TKDKILNLRGNIKI 118

Query: 145 K----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                     +++ E   +D+    I S   V  T   F  +    +     ++A     
Sbjct: 119 NSLDPTSRLQKIEAEVLSIDLNTQDIFSDSMVKSTGIGFTSTGIGLKGNLKKQTATLTKD 178

Query: 201 VSVVVNPGVL 210
           V   + P  +
Sbjct: 179 VKTYIEPKFI 188


>gi|296113132|ref|YP_003627070.1| hypothetical protein MCR_0912 [Moraxella catarrhalis RH4]
 gi|295920826|gb|ADG61177.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
          Length = 191

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 54/176 (30%), Gaps = 10/176 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           +       + +           +               +   K I +D      +Y+L A
Sbjct: 4   RILSVLGVIALAVAVWFFYQEDVEVKPALPEVPTVDSEVTQIKAIQTDPKTGATEYTLTA 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV- 146
           +    + N    ++       T+  Q  +     L A  A     +  L +SQ F++   
Sbjct: 64  DSLIQNANGQDEMLG-----ATIHWQPPQGETYTLTADRATLEQNSGDLRLSQGFRLVRA 118

Query: 147 ----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
               K  + ++    + + KN TI+S DP+ +        A   R    +    F 
Sbjct: 119 ATAAKPEMIIEGLNIIGNTKNRTISSRDPLTVQQGIDRFKAQGFRANLQTGEYEFD 174


>gi|227112736|ref|ZP_03826392.1| hypothetical protein PcarbP_07229 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 188

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 62/184 (33%), Gaps = 9/184 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLV 86
           K +       +V   +  +     T +    +         +K     YS      Y L+
Sbjct: 5   KRWLTAFLALLVLILIGWNIADDDTVAAPDANDPAVPVYTSEKTNTQVYSPAGKLSYRLI 64

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +E+A+  + + + + +      T+  ++       + A  A+    +  LY+    ++  
Sbjct: 65  SEKAE--YFNEEQLSWFTTPVATLFNEQGT-ATWSVRADRAKL-TKDKMLYLYGNVEVNS 120

Query: 147 KDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                   R+    A +++    ++S D V +  + F  S    R    +++A    +V 
Sbjct: 121 LTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGASFTSSGMKMRGNLRNKTAELIEKVK 180

Query: 203 VVVN 206
               
Sbjct: 181 TSYE 184


>gi|326564161|gb|EGE14397.1| hypothetical protein E9O_06793 [Moraxella catarrhalis 12P80B1]
 gi|326570415|gb|EGE20455.1| hypothetical protein E9U_03463 [Moraxella catarrhalis BC8]
          Length = 191

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 54/176 (30%), Gaps = 10/176 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           +       + +           I               +   K I +D      +Y+L A
Sbjct: 4   RILSVLGVIALAVAVWFFYQEDIEVKPALPEVPTVDSEVTQIKAIQTDPKTGATEYTLTA 63

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV- 146
           +    + N    ++       T+  Q  +     L A  A     +  L +SQ F++   
Sbjct: 64  DSLIQNANGQDEMLG-----ATIHWQPPQGETYTLTADRATLEQNSGDLRLSQGFRLVRA 118

Query: 147 ----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
               K  + ++    + + KN TI+S DP+ +        A   R    +    F 
Sbjct: 119 ATAAKPEMIIEGLNIIGNTKNRTISSRDPLTVQQGIDRFKAQGFRANLQTGEYEFD 174


>gi|108757694|ref|YP_629319.1| hypothetical protein MXAN_1058 [Myxococcus xanthus DK 1622]
 gi|108461574|gb|ABF86759.1| hypothetical protein MXAN_1058 [Myxococcus xanthus DK 1622]
          Length = 183

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/181 (13%), Positives = 58/181 (32%), Gaps = 13/181 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT 92
               +++           S    S         +++    L  +  DR    + +  A+ 
Sbjct: 4   LLAASLLILVFAPGCKPGSGEGASGGQP--PPEVVLHGARLESFEGDR---LIRSGTARQ 58

Query: 93  -SFNSGKGIIFLQDFELTVPTQR-------SEYGDMYLFAHSARFNLANHTLYISQPFKM 144
            S+    G ++  D  + +P             G + + A +   +LA+  +  S    +
Sbjct: 59  VSYQRTTGEVWATDATIRIPPGSSSQGAPPGTEGGVEVSAPNMEGSLASKQVVASGGVII 118

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           +    +         D      + ++ V +   D+ L A+   +     +  FAG V  V
Sbjct: 119 RTGKGMEARTPRLTYDATTERAHGNEGVTVKGPDYRLRADRFELFFPDETFNFAGSVESV 178

Query: 205 V 205
           +
Sbjct: 179 L 179


>gi|50119251|ref|YP_048418.1| hypothetical protein ECA0291 [Pectobacterium atrosepticum SCRI1043]
 gi|49609777|emb|CAG73211.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 188

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/193 (11%), Positives = 67/193 (34%), Gaps = 17/193 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLL---SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS 77
            +  ++L  F     + ++GW +    +     +      +   +     +         
Sbjct: 2   SKTKRWLTAFLALLVLILIGWNIADDDTVVAPDANDPAVPVYTSEKTNTQVYSP------ 55

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
             ++ Y L++E+A+  + + + + +      T+  ++       + A  A+    +  LY
Sbjct: 56  AGKLSYRLISEKAE--YFNDEQLSWFTTPVATLFNEQGT-ATWSVRADRAKL-TKDKMLY 111

Query: 138 ISQPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +    ++          R+    A +++    ++S D V +  + F  S    R    ++
Sbjct: 112 LYGHVEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSSGMKMRGNLRNK 171

Query: 194 SAVFAGQVSVVVN 206
           +A    +V     
Sbjct: 172 TAELIEKVKTSYE 184


>gi|326795050|ref|YP_004312870.1| hypothetical protein Marme_1778 [Marinomonas mediterranea MMB-1]
 gi|326545814|gb|ADZ91034.1| protein of unknown function DUF1239 [Marinomonas mediterranea
           MMB-1]
          Length = 195

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/189 (11%), Positives = 58/189 (30%), Gaps = 10/189 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYS 84
           + K       +              +    S+ +L D     ++     +Y+ D   + +
Sbjct: 9   WAKKLLILLAIAASATAFFWYGASPTLTLVSTDELSDSPDYFLENVTSREYTIDGKLEQT 68

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           +   +     ++ +        ++   T    +   Y  A   + N AN  + ++    +
Sbjct: 69  IKTSKLSHFNSNKQ--TEAISPKIETVTNDIAW---YAEADFGKLNDANKDILLTSNAFV 123

Query: 145 K----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                   + RL+ ++   +  + ++ S     +     +  A+  R      +A F G 
Sbjct: 124 TRKDSTTTSNRLNADSIHYNDVDKSLISLGNAELITQQGITKADTIRSFVDLETAQFKGN 183

Query: 201 VSVVVNPGV 209
           VS       
Sbjct: 184 VSGHYEQAT 192


>gi|326577177|gb|EGE27071.1| hypothetical protein EA1_04475 [Moraxella catarrhalis O35E]
          Length = 191

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 54/177 (30%), Gaps = 18/177 (10%)

Query: 30  FFPFATVTIVGWFLLS-SWIRISTFSKSSIDLLDFEPM--IMKKFILSDYSKDRVKYSLV 86
                 + +  WF             +      +   +  I      +  +    +Y+L 
Sbjct: 8   VLGVIALAVAVWFFYQEDIEVKPALPEVPTVDSEVTQIKAIQTDPK-TGAT----EYTLT 62

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK--- 143
           A+    + N    ++       T+  Q  +     L A  A     +  L +SQ F+   
Sbjct: 63  ADSLIQNANGQDEMLG-----ATIHWQPPQGETYTLTADRATLEQNSGDLRLSQGFRLVR 117

Query: 144 --MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
                K  + ++    + + KN TI+S DP+ +        A   R    +    F 
Sbjct: 118 AATADKPEMIIEGLNIIGNTKNRTISSRDPLTVQQGIDRFKAQGFRANLQTGEYEFD 174


>gi|238022121|ref|ZP_04602547.1| hypothetical protein GCWU000324_02027 [Kingella oralis ATCC 51147]
 gi|237866735|gb|EEP67777.1| hypothetical protein GCWU000324_02027 [Kingella oralis ATCC 51147]
          Length = 191

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/169 (10%), Positives = 47/169 (27%), Gaps = 11/169 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGII 101
                +         +D        M +     Y         L A  A       +  +
Sbjct: 22  AWLGRVSEVVIEAVKLDPAK-PQYTMTQIHGKRYDISGSLNQDLTAPLAWQLP--DQKNV 78

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR-----LDFET 156
           + Q   L    + +E     + + +AR+ + +  ++  Q   +    +       +  + 
Sbjct: 79  YFQQPTLKTYRENNEQ--YTVSSQTARYEIESKKVFFEQNVVLTKTPDAERPAGKVVTDY 136

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             +D +     +  PV   +     +A     +N +       +V   +
Sbjct: 137 LNVDTQTEIAETDAPVQYEYGRSHGTATGLTYDNKNGLLNLKSKVKAQI 185


>gi|167585438|ref|ZP_02377826.1| hypothetical protein BuboB_08884 [Burkholderia ubonensis Bu]
          Length = 204

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/147 (11%), Positives = 44/147 (29%), Gaps = 11/147 (7%)

Query: 69  KKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A +             L      +   +     +   A   
Sbjct: 51  DNFSVTELDQSGTTQYRLTAAKLI--HYEDTESSDLTTP--AMRAFQPGKPVVTTTAKRG 106

Query: 128 RFNLANHTLYISQPFKMKV-----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    ++          ++ D +   + V +  I +  PV +     +++
Sbjct: 107 TVNGDVSIVDLYDDARILRAAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVN 166

Query: 183 A-NFARIENSSRSAVFAGQVSVVVNPG 208
           A +  +  N +R     G V   +   
Sbjct: 167 ATDGMKYNNVTRVIELYGNVRGTIAAS 193


>gi|313673393|ref|YP_004051504.1| hypothetical protein Calni_1433 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940149|gb|ADR19341.1| hypothetical protein Calni_1433 [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 178

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 45/179 (25%), Gaps = 9/179 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           K+ F  A + +V  F+      I+    +           ++ F L     +   Y + A
Sbjct: 6   KYLFYIAVLLLVAIFVGFVVYDINRPEVTRKSSETSY---IEGFYLKSNLDNGSFYKINA 62

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
            +A   F +            +   +      +        F    +             
Sbjct: 63  SKAYLFFENETVTFD----NCSFYYEDQVKI-VKGNGERCLFKKDKYVTIEKGLEGFYNS 117

Query: 148 DNLRL-DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
              +         D+          V     D  + +   R   +     F+G+V VV 
Sbjct: 118 IEFKGGKDSHFFYDLGKYEGLVDGGVFARDGDNSIRSEKMRFNKNDIFVEFSGKVEVVY 176


>gi|167835391|ref|ZP_02462274.1| hypothetical protein Bpse38_02801 [Burkholderia thailandensis
           MSMB43]
          Length = 204

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 45/187 (24%), Gaps = 11/187 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
                      G + L                          F +++  +    +Y L A
Sbjct: 11  IPLVAMAALAGGTYWLLQATLPPPGEALVRPKSHTPDYFANNFSVTELDQTGSTQYRLTA 70

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
             A            L      +   +     +   A     N     + +    ++   
Sbjct: 71  --AGLVHYEDDETSELAQP--ALRAFQPGKPTVTATAKRGAVNGDVSIVDLYDDARILRA 126

Query: 148 DN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN-FARIENSSRSAVFAGQV 201
                  ++ D +   + V +  I +  PV +     + +A    +  N +R     G V
Sbjct: 127 AGAGDPPMQADSQHFRVLVNDDVIETEKPVKLQRGLSIANAAAGMKYNNVTRVIELYGNV 186

Query: 202 SVVVNPG 208
              +   
Sbjct: 187 RGTIAAS 193


>gi|326560123|gb|EGE10513.1| hypothetical protein E9M_07896 [Moraxella catarrhalis 46P47B1]
 gi|326571100|gb|EGE21124.1| hypothetical protein E9S_05227 [Moraxella catarrhalis BC7]
          Length = 191

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 55/177 (31%), Gaps = 18/177 (10%)

Query: 30  FFPFATVTIVGWFLLS-SWIRISTFSKSSIDLLDFEPM--IMKKFILSDYSKDRVKYSLV 86
                 + +  WF             +      +   +  I      +  +    +Y+L 
Sbjct: 8   VLGVIALAVAVWFFYQEDIEVKPALPEVPTVDSEVTQIKAIQTDPK-TGAT----EYTLT 62

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           A+    + N    ++       T+  Q  +     L A  A     +  L +SQ F++  
Sbjct: 63  ADSLIQNANGQDEMLG-----ATIHWQPPQGETYTLTADRATLEQNSGDLRLSQGFRLVR 117

Query: 147 -----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
                K  + ++    + + KN TI+S DP+ +        A   R    +    F 
Sbjct: 118 AATAAKPEMIIEGLNIIGNTKNRTISSRDPLTVQQGIDRFKAQGFRANLQTGEYEFD 174


>gi|255535446|ref|YP_003095817.1| hypothetical protein FIC_01307 [Flavobacteriaceae bacterium
           3519-10]
 gi|255341642|gb|ACU07755.1| hypothetical protein FIC_01307 [Flavobacteriaceae bacterium
           3519-10]
          Length = 196

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 60/193 (31%), Gaps = 5/193 (2%)

Query: 25  QFLKFFFPFATVTIV-GWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
           +F K F+      +    F   +         +     +F   I+ K  +       +K 
Sbjct: 3   RFRKIFYSNIAGLLGCAIFFALTSCEEDLTQVNKNTNTNFPSQIINKANIVQRDSGMIKL 62

Query: 84  SLVAERAKT-SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
              A   +   +     I+  +   +    ++       + A  A+FN            
Sbjct: 63  RATAPLIEKYEYIDSPYIVAKKGINILFYDKKKPNVPGKIVAKYAKFNEKKRFYEAKGNV 122

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV--LSANFARIENSSRSAVFAGQ 200
           ++   +N     ++   D     I +SD V +T  D    + AN  + ++      F   
Sbjct: 123 RITTNENQMFAMQSVFWDQGKRLIYTSDTVYVTDKDGSTLVGANGMKAKDDFSEYTFFNN 182

Query: 201 VSVVVNPGVLQKK 213
            S  ++   + +K
Sbjct: 183 -SGNISAQKIPEK 194


>gi|254466650|ref|ZP_05080061.1| cell envelope biogenesis protein YhbN [Rhodobacterales bacterium
           Y4I]
 gi|206687558|gb|EDZ48040.1| cell envelope biogenesis protein YhbN [Rhodobacterales bacterium
           Y4I]
          Length = 170

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 42/130 (32%), Gaps = 3/130 (2%)

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQ--DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
               + A+    +   G           +  +         +Y  A  +        L  
Sbjct: 38  QPVEVTADNLAVNQADGSAEFTGNVLIVQGIMRLSADTVLVIYKTADDSGAKAGIERLEA 97

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           +    +    +   + E A   +   TI  +  V++      L++N   +  +S +A  A
Sbjct: 98  AGNVVLVSGPDA-AEAERAEYTIDTGTIVMTGNVLLNQEGGTLASNRLEVNLTSGTAKMA 156

Query: 199 GQVSVVVNPG 208
           G+V  ++NP 
Sbjct: 157 GRVKTILNPS 166



 Score = 35.5 bits (80), Expect = 5.6,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 28/102 (27%), Gaps = 9/102 (8%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRL---------DFETAVLDVKNITINS 168
             + + A +   N A+ +   +    +                   + +        + +
Sbjct: 38  QPVEVTADNLAVNQADGSAEFTGNVLIVQGIMRLSADTVLVIYKTADDSGAKAGIERLEA 97

Query: 169 SDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVL 210
           +  V++        A  A     + + V  G V +    G L
Sbjct: 98  AGNVVLVSGPDAAEAERAEYTIDTGTIVMTGNVLLNQEGGTL 139


>gi|323697963|ref|ZP_08109875.1| protein of unknown function DUF1239 [Desulfovibrio sp. ND132]
 gi|323457895|gb|EGB13760.1| protein of unknown function DUF1239 [Desulfovibrio desulfuricans
           ND132]
          Length = 205

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 46/132 (34%), Gaps = 4/132 (3%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            + L+A+ AK +   G   +             ++  ++Y+ A     +  N  L +   
Sbjct: 71  SWKLLAKSAKYNQELGIIAVDFPQLTAFF---GADRQEVYVQADRGEVDQENDNLSLYDG 127

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
              +   NL LD +          +     V +   D  + A    I+  +R  V AG V
Sbjct: 128 VSGRF-GNLALDAQYLDYVGAIGKVYLKGGVTVRRPDMTVQAKAMEIDLVTRQLVAAGGV 186

Query: 202 SVVVNPGVLQKK 213
             ++ P  L K 
Sbjct: 187 EALLAPEGLGKS 198


>gi|257092274|ref|YP_003165915.1| hypothetical protein CAP2UW1_0639 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044798|gb|ACV33986.1| protein of unknown function DUF1239 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 195

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/178 (10%), Positives = 51/178 (28%), Gaps = 12/178 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGII 101
               +       ++          I+         K     Y+LVA+             
Sbjct: 22  FWLRYATELPDERNDGKSRHDPDFIVTTATAHKLDKSGQLLYTLVADE--IRHYPDDDTA 79

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD-----NLRLDFET 156
            L + +  +         + + A     +     + +S+  +++         L L+   
Sbjct: 80  DLTNPK--LEYFDPTKPTVTISAVRGHVSPKGERVELSERVEVRRAATDRQAELVLETPD 137

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV--NPGVLQK 212
             +        +   V+IT     +     +I+N  ++ +   QV+  +  +P   + 
Sbjct: 138 LTVLTDEEQAFTKSRVVITQGKSWVQGVGMQIDNKLQTYLLESQVTGEIASHPAKTKP 195


>gi|85713033|ref|ZP_01044070.1| Uncharacterized conserved secreted protein [Idiomarina baltica
           OS145]
 gi|85693136|gb|EAQ31097.1| Uncharacterized conserved secreted protein [Idiomarina baltica
           OS145]
          Length = 186

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 56/197 (28%), Gaps = 23/197 (11%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            R +  L     F  V I+ W           F  S  D  + +   M     +      
Sbjct: 2   SRRVALLLLV-LFGAVIILLW---------RPFQPSDGDDANVQTRKMT-PDFTASGLKT 50

Query: 81  VKYSLVAERAKTSFNSGK------GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
             Y      A              G+  L +  +             + A        + 
Sbjct: 51  RLYESGGRLAHQVTAEHMSHYIQIGLTELSNP-VYSVYTDERQATWQVSAEQGTL-YDDQ 108

Query: 135 TLYISQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
           TL + +  ++          R++ E  V+D+   T+N+  PV I+     +  +    + 
Sbjct: 109 TLILERNVEILALQPDTSIKRVNTEYLVIDIPAETMNTDYPVTISGPQIAVQGHGLNADL 168

Query: 191 SSRSAVFAGQVSVVVNP 207
            + +      V  V NP
Sbjct: 169 YAETMELKRHVKTVFNP 185


>gi|254520954|ref|ZP_05133009.1| putative secreted protein [Stenotrophomonas sp. SKA14]
 gi|219718545|gb|EED37070.1| putative secreted protein [Stenotrophomonas sp. SKA14]
          Length = 191

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/150 (9%), Positives = 36/150 (24%), Gaps = 8/150 (5%)

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
               I+  F +    +   + S            G   I +      +P +  +     L
Sbjct: 43  GVDYILHDFTIVALDEQGKE-STTLRAPLLERQRGDQTISIATPLFEMPDKDGK--HWTL 99

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITHS 177
            + +   +     + +                     +   +  K     +   V +T  
Sbjct: 100 RSETGWLSAKGDEMKLRGNVAGDSPAGPGVPPTTFRTDHLDVFPKESRARTDALVTMTRP 159

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVNP 207
               S     +++ + +  F  Q      P
Sbjct: 160 GMEQSGVGFEVDSKNNTYHFLSQSKGRYTP 189


>gi|332140248|ref|YP_004425986.1| hypothetical protein MADE_1004200 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550270|gb|AEA96988.1| hypothetical protein MADE_1004200 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 192

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/189 (10%), Positives = 54/189 (28%), Gaps = 11/189 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD--YSKDRV-KYS 84
           +     + + I+   +                         K   L+   Y+++    + 
Sbjct: 8   RLGLSISALFILALLMYVPTWMEEQPESQGSSENGALKPAYKAKNLTTTLYNQEGELNHK 67

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + AE          G +  Q  + T+ T+ +      + A        N  + +     +
Sbjct: 68  VFAES--MEHYDQLGFVLFQQPKYTLYTENAT-SPWVVTAQEGTL-YNNDLIQLENQVVI 123

Query: 145 KVKDNLRL----DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
           + + +         E   +++    + S   V I  + +V+ +N       ++       
Sbjct: 124 ENQTSDDFVKSLSTEYIQINLDTKQMTSDQVVEIQGTQYVILSNGFNANLRTQEYELLDH 183

Query: 201 VSVVVNPGV 209
           V    +P  
Sbjct: 184 VQTTYSPSN 192


>gi|293391914|ref|ZP_06636248.1| hypothetical protein D7S_2079 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952448|gb|EFE02567.1| hypothetical protein D7S_2079 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 191

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 61/188 (32%), Gaps = 11/188 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSL 85
            L        + ++ WF   S  +     K  I   D    + +K   + YS    K  L
Sbjct: 4   RLNIILAVIALGLLAWF--YSLNQEDGSLKDLIKTADSPEYVGQKMSTTVYSPTGKKQYL 61

Query: 86  VAERAKTSFNSGKGIIFLQDFE---LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
            A  AK    +  G    Q      L +  Q ++     L A  AR    ++ LY+    
Sbjct: 62  -ATSAKVEHYTSDGHTDFQQPVVLLLDIEIQNTDKESWKLSADKARL-TKDNMLYLDGNV 119

Query: 143 KMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
             +         R++ + AV+++    I+S   V +   +F  +          + A   
Sbjct: 120 IAQSLSAQSRLQRIETQRAVVNLTTQDISSDQMVKLNGQNFNSTGLKLTGNLQQQVATLK 179

Query: 199 GQVSVVVN 206
            QV     
Sbjct: 180 EQVKTYYE 187


>gi|190573141|ref|YP_001970986.1| hypothetical protein Smlt1115 [Stenotrophomonas maltophilia K279a]
 gi|190011063|emb|CAQ44672.1| conserved hypothetical exported protein [Stenotrophomonas
           maltophilia K279a]
          Length = 191

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/151 (11%), Positives = 40/151 (26%), Gaps = 10/151 (6%)

Query: 63  FEPMIMKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY 121
               I+  F +    +   +  +L A R +     G   I +      +P +  +     
Sbjct: 43  GVDYILHDFQIVALDEHGKESTTLRAPRLERQR--GDQTINIATPLFEMPDKDGK--HWT 98

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITH 176
           L A +   +     + +                     +   +  K     +   V +T 
Sbjct: 99  LRAETGWLSAKGDEMKLRGKVAGDSPAGPGVVPTTFRTDHLDVFPKENRARTDALVTMTR 158

Query: 177 SDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
                S     +++ + +  F  Q      P
Sbjct: 159 PGMEQSGVGFEVDSKNNTYHFLSQSKGRYTP 189


>gi|291615981|ref|YP_003518723.1| YrbK [Pantoea ananatis LMG 20103]
 gi|291151011|gb|ADD75595.1| YrbK [Pantoea ananatis LMG 20103]
 gi|327396233|dbj|BAK13655.1| exported protein YrbK [Pantoea ananatis AJ13355]
          Length = 193

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/191 (10%), Positives = 59/191 (30%), Gaps = 22/191 (11%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKD-------- 79
           + +       I    +  ++      + + +   +           +  +          
Sbjct: 5   RRWITLGLALIALVLIGWNFTNRDGDNSAPVANNNQT------PTYTSANSHTVVYNPQG 58

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
            + Y LV+++    +    GI +  +  +T     ++     + A  A+    +  LY+ 
Sbjct: 59  GLAYKLVSDKVT--YFEDSGISWFDNPVMT-TYDENKMPTWTIRADKAKL-TKDRMLYLY 114

Query: 140 QPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++          R+  + A +++    + S D V +    F  +    R    +++A
Sbjct: 115 GHVELNALAQDSQLERIKTDNAQVNLVTQDVASDDQVTLYGRSFNSTGMKMRGNLRTKNA 174

Query: 196 VFAGQVSVVVN 206
               +V     
Sbjct: 175 ELIEKVKTSYE 185


>gi|167855016|ref|ZP_02477790.1| hypothetical protein HPS_10235 [Haemophilus parasuis 29755]
 gi|167853864|gb|EDS25104.1| hypothetical protein HPS_10235 [Haemophilus parasuis 29755]
          Length = 192

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 50/190 (26%), Gaps = 10/190 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YS 84
            L          + GW    S     T     I        I +K   S Y  +    YS
Sbjct: 4   RLNIILATLAAVLAGW--YYSQQSDDTGLSQLIKKEGSAEYIGQKISTSAYDLNGKPQYS 61

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
             AE  K                L +    S      + A  A     +  L +    K+
Sbjct: 62  AQAEEVKR--YESTQRTEFLKPLLNLFDAESALKQWQVEADYADV-TKDKILNLRGNIKI 118

Query: 145 K----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                     +++ E   +D+    I S   V  T   F  +    +     ++A     
Sbjct: 119 NSLDPTSRLQKIEAEVLSIDLNTQDIFSDSMVKSTGIGFTSTGIGLKGNLKKQTATLTKD 178

Query: 201 VSVVVNPGVL 210
           V   + P  +
Sbjct: 179 VKTYIEPKFI 188


>gi|253686682|ref|YP_003015872.1| hypothetical protein PC1_0277 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753260|gb|ACT11336.1| protein of unknown function DUF1239 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 188

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/184 (13%), Positives = 62/184 (33%), Gaps = 9/184 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLV 86
           K +       +V   +  +     T +    +         +K     YS      Y L+
Sbjct: 5   KRWLTAFLALLVLILIGWNIADDDTVAAPDANDPAVPVYTSEKTNTQVYSPAGKLSYRLI 64

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +E+A+  + + + + +      T+  ++       + A  A+    +  LY+    ++  
Sbjct: 65  SEKAE--YFNDEQLSWFTAPVATLFNEQGT-ATWSVRADRAKL-TKDKMLYLYGHVEVNS 120

Query: 147 KDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                   R+    A +++    ++S D V +  + F  S    R    +++A    +V 
Sbjct: 121 LTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSSGMKMRGNLRNKTAELIEKVK 180

Query: 203 VVVN 206
               
Sbjct: 181 TSYE 184


>gi|264680854|ref|YP_003280764.1| hypothetical protein CtCNB1_4722 [Comamonas testosteroni CNB-2]
 gi|262211370|gb|ACY35468.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
          Length = 206

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/196 (9%), Positives = 58/196 (29%), Gaps = 26/196 (13%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLD-------FEPMIMKKFILSDYSKDRVKY 83
            P   + ++                S  +           +  ++K F  S   K+    
Sbjct: 16  LPVLIMGLLALGTWWLVRNAPKPIVSGAEKAVRHDPDYFLKDFVIKNFEASGRLKN---- 71

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            L                 L+ ++  + +   +       ++ A  N     + +     
Sbjct: 72  RLNGATG----EHFPDTDTLEVYDARMLSFTPDGRKTVGSSNRALSNGDGSEIQMFGQAV 127

Query: 144 MKVKD-----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
           ++ +             +RL+ E   +   +  ++++  V++T  +   + +  +  +  
Sbjct: 128 IQREPVPATATQKALPAMRLESEFLQIWPNDERVSTNKAVVMTRGNDRFTGDSMQYAHLD 187

Query: 193 RSAVFAGQVSVVVNPG 208
           +     G+V  V+ P 
Sbjct: 188 QILQMQGRVKGVIQPS 203


>gi|238899000|ref|YP_002924682.1| hypothetical protein HDEF_1946 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466760|gb|ACQ68534.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 205

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 63/194 (32%), Gaps = 21/194 (10%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD----FEPMIMKKFILSDYSKDRVKYS 84
            F     +  + W LL  +      S  ++   D     + +    + L  +      Y+
Sbjct: 11  LFLSVIVIIFLSWNLLDYFDPDLKDSTITLGPNDPIYQAQEIRTDIYNLEGFLS----YT 66

Query: 85  LVAERAKT--------SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           + A+ A            N  + I +     + +        D  L A  A+    N  L
Sbjct: 67  ITAQNAARYVHKKQAGDSNGPENITWFTKPVMVLF-DDILQPDWSLKADKAKLTDDNKML 125

Query: 137 YISQPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
           Y+    ++          ++  E+A +++    I+S+D V +   DF  S    R    S
Sbjct: 126 YLYVDVELNHLIQSSYLKKITTESAKINLVTQDISSNDSVNLYGVDFFSSGMKMRGNLRS 185

Query: 193 RSAVFAGQVSVVVN 206
           + A    +V     
Sbjct: 186 KKANLVEKVKTNYE 199


>gi|313892353|ref|ZP_07825945.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
 gi|313119212|gb|EFR42412.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
          Length = 177

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 41/122 (33%), Gaps = 5/122 (4%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           + L A+R     +       +   E            + + A SA FN   + LY+    
Sbjct: 58  WKLKADRVNIDKDKN-----VMSIEGAECIFNDNGISLDVNADSAIFNKNENVLYLKGSI 112

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
           K    D   +  E    + K   ++S  P  I  +   L+A+    +   ++    G  S
Sbjct: 113 KGHSDDGTSIKAENLKYESKTGILSSDRPFFIEKAGHKLTADSFTADRILKTVKAKGNAS 172

Query: 203 VV 204
           + 
Sbjct: 173 LT 174


>gi|298492952|ref|YP_003723129.1| hypothetical protein Aazo_4860 ['Nostoc azollae' 0708]
 gi|298234870|gb|ADI66006.1| protein of unknown function DUF1239 ['Nostoc azollae' 0708]
          Length = 411

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 50/176 (28%), Gaps = 6/176 (3%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVAER 89
            P     ++G F   +          S +      +      L  + +       + A++
Sbjct: 42  LPLTLFLVIGLFACGNPSPHKPNRGDSSNQDTNSKLTFFGVALEQFDEVGRPIWKVKAKK 101

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD- 148
           A   +   K I   Q+ +  +           +   +A        L++           
Sbjct: 102 A--KYTKEKEIGEAQNPDGELYQ--DGKVVYTIRGETADIQQDGKQLFLKGKIIATDPHN 157

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              L         K   +   + +  TH +   +A   R++   +   FAG+V  +
Sbjct: 158 GTILKGNELEWRHKEDLLIVRNQLNGTHKELQATAQEVRVKTREQRIEFAGKVVAI 213



 Score = 37.4 bits (85), Expect = 1.5,   Method: Composition-based stats.
 Identities = 10/102 (9%), Positives = 29/102 (28%), Gaps = 7/102 (6%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
            +  ++ +  + A   +   ++Y++       +    L        ++   + +   V+ 
Sbjct: 310 HQAENVTVTGNKAEVKILQKSVYLTGNVNAVGQHKQSLKSNLLTWYLERKLLEAQGNVVY 369

Query: 175 --THSDFVLSANFARIENSSRSAVFAGQ-----VSVVVNPGV 209
                   L    A     + + V  G      V   + P  
Sbjct: 370 LQVDPPLNLQGATALANLQTDNIVVKGGSYNDRVVTEIIPQE 411


>gi|88861161|ref|ZP_01135795.1| hypothetical protein PTD2_17232 [Pseudoalteromonas tunicata D2]
 gi|88816883|gb|EAR26704.1| hypothetical protein PTD2_17232 [Pseudoalteromonas tunicata D2]
          Length = 184

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/185 (10%), Positives = 53/185 (28%), Gaps = 11/185 (5%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYS 84
             +       + ++ W     +I+           +     I  +   + ++ D    + 
Sbjct: 3   LARLSLSIFFLALMSWLWYPYFIQPQQQITQKKSDVAEPDYIATELKQTVFNSDGKISHK 62

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + A + +       G         T+ ++   +    + A  A    +   L +    + 
Sbjct: 63  VSATKMEQ--YQDLGFTHFTAPVFTLYSKNGIWE---ISAAEATLYESKK-LILEVNVEA 116

Query: 145 ----KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
               K      +  +   +D+ + T+ S  PV IT  + +++         S        
Sbjct: 117 VNLDKTAMLQNIKADYIEVDITHSTMQSERPVEITGPNILITGKGLIANFESEVIELINH 176

Query: 201 VSVVV 205
              + 
Sbjct: 177 TQTIY 181


>gi|300776812|ref|ZP_07086670.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
 gi|300502322|gb|EFK33462.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
          Length = 196

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/173 (11%), Positives = 48/173 (27%), Gaps = 7/173 (4%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT 92
            A +     F + +         +     +F   I+    +          +L A+    
Sbjct: 12  IACLFSCAIFFILTSCEEDLTKANGNQSKNFPSQIINNANIIQRDSG--FVTLKAKAPII 69

Query: 93  SFNS---GKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
                     ++  +  ++    ++       + A  AR              +++  + 
Sbjct: 70  EKYELIDSPYVVARKGIDIEFFDKKKPKVPGRITAKYARIFEYKKFYEAKGDVRIRTNEG 129

Query: 150 LRLDFETAVLDVKNITINSSDPVIITHSDFV--LSANFARIENSSRSAVFAGQ 200
            R   ++   D K   I + D V +T  D    + AN    ++      F   
Sbjct: 130 QRFAMQSIYWDQKKNRIYTKDTVYVTMEDGSTLVGANGMTAKDDFSEYTFYNN 182


>gi|52425769|ref|YP_088906.1| hypothetical protein MS1714 [Mannheimia succiniciproducens MBEL55E]
 gi|52307821|gb|AAU38321.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 191

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 65/189 (34%), Gaps = 10/189 (5%)

Query: 24  IQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL-DFEPMIMKKFILSDYSKDRVK 82
           I++         + ++ WF   +  +             ++    M+  I S     + +
Sbjct: 3   IRW-NIILGTIALVLLAWFYTLNQDKPDLTRLIKAPESPEYTGHKMETTIFS--PAGKKQ 59

Query: 83  YSLVAERAK-TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           Y   ++ A+    +     +    F L V T+        L A SA     ++ LY++  
Sbjct: 60  YQAYSDTARHYDQDGHTEFVNPVVFALEVETENQGKQSWKLTAKSATL-TKDNLLYLNGE 118

Query: 142 FKMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
              +         R++ E AV+++KN  I S + V I   +F  S          ++A  
Sbjct: 119 VVAQSLDPISRLQRIETEAAVVNLKNQDITSDNMVTIRGLNFTSSGLKLTGNLKQQAATL 178

Query: 198 AGQVSVVVN 206
             QV     
Sbjct: 179 KEQVKTHYE 187


>gi|299531901|ref|ZP_07045301.1| hypothetical protein CTS44_13948 [Comamonas testosteroni S44]
 gi|298720076|gb|EFI61033.1| hypothetical protein CTS44_13948 [Comamonas testosteroni S44]
          Length = 206

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/196 (9%), Positives = 58/196 (29%), Gaps = 26/196 (13%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLD-------FEPMIMKKFILSDYSKDRVKY 83
            P   + ++                S  +           +  ++K F  S   K+    
Sbjct: 16  LPVLIMGLLALGTWWLVRNAPKPIVSGAEKAVRHDPDYFLKDFVIKNFEASGRLKN---- 71

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
            L                 L+ ++  + +   +       ++ A  N     + +     
Sbjct: 72  RLNGATG----EHFPDTDTLEVYDARMLSFTPDGRRTVGSSNRALSNGDGSEIQMFGQAV 127

Query: 144 MKVKD-----------NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
           ++ +             +RL+ E   +   +  ++++  V++T  +   + +  +  +  
Sbjct: 128 IQREPVPATATQKALPAMRLESEFLQIWPNDERVSTNKAVVMTRGNDRFTGDSMQYAHLD 187

Query: 193 RSAVFAGQVSVVVNPG 208
           +     G+V  V+ P 
Sbjct: 188 QILQMQGRVKGVIQPS 203


>gi|325520919|gb|EGC99895.1| hypothetical protein B1M_34304 [Burkholderia sp. TJI49]
          Length = 204

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/147 (12%), Positives = 45/147 (30%), Gaps = 11/147 (7%)

Query: 69  KKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A +             L D    +   +     +   A   
Sbjct: 51  DNFSVTELDQSGTTQYRLTAAKLI--HYEDTESSDLTDP--AMRAFQPGKPVVTTTALRG 106

Query: 128 RFNLANHTLYISQPFKMKV-----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    ++          ++ D +   + V +  I +  PV +     +++
Sbjct: 107 TVNGDVSIVDLYDNARILRAAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVN 166

Query: 183 A-NFARIENSSRSAVFAGQVSVVVNPG 208
           A +  +  N +R     G V   +   
Sbjct: 167 ATDGMKYNNVTRVIELYGNVRGTIAAS 193


>gi|302185309|ref|ZP_07261982.1| hypothetical protein Psyrps6_03159 [Pseudomonas syringae pv.
           syringae 642]
          Length = 190

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/168 (7%), Positives = 38/168 (22%), Gaps = 9/168 (5%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIF 102
            +           S                  Y  D   +Y + +++ +        +  
Sbjct: 25  WNISPESFMDQPVSTVDDTVIDYYAINAHSVQYLPDGKLQYDMTSDKVE--HVKATDVTL 82

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAV 158
           L   +L +          ++ +     +     + +    +++  D       +      
Sbjct: 83  LTTPDLHMYR--GGEFPWHVQSKKGEVSSGGDQVELIDSVRVERTDEKQRTTIITSSRMT 140

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +  +     +   V I  +  V +A   +             V     
Sbjct: 141 VFPQKQYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRGQYE 188


>gi|302877522|ref|YP_003846086.1| hypothetical protein Galf_0277 [Gallionella capsiferriformans ES-2]
 gi|302580311|gb|ADL54322.1| protein of unknown function DUF1239 [Gallionella capsiferriformans
           ES-2]
          Length = 191

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 46/142 (32%), Gaps = 10/142 (7%)

Query: 67  IMKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH 125
           IM  F  +      V  + L A +             L    +T+    SE   +Y+  +
Sbjct: 48  IMDNFHATKMDLQGVPRFLLSATQ--MRHYPDHDTTELDFPRVTML--SSERPPLYVNGN 103

Query: 126 SARFNLANHTLYISQPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
               +     +   +   ++         + L  E   +      +N+  PV + + +  
Sbjct: 104 RGNVSSRGDEVLFHENVVVRRDAGGDQSAMTLKTEYLRVLPNQDWVNTDRPVTMFNLNTT 163

Query: 181 LSANFARIENSSRSAVFAGQVS 202
           + A    ++N +R+     QV 
Sbjct: 164 VHAIGLEMDNKARTMKLLSQVR 185


>gi|261868145|ref|YP_003256067.1| hypothetical protein D11S_1472 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413477|gb|ACX82848.1| hypothetical protein D11S_1472 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 191

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 57/189 (30%), Gaps = 13/189 (6%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL-DFEPMIMKKFILSDYSKDRVKYS 84
            L        + ++ WF   +    S           ++    M   + S       K  
Sbjct: 4   RLNIILAVIALGLLAWFYSLNKEDGSLKDLIKTADSPEYVGQKMSTTVYS---PTGKKQY 60

Query: 85  LVAERAKTSFNSGKGIIFLQDFE---LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           L A  AK    +  G    Q      L +  Q ++     L A  AR    ++ LY+   
Sbjct: 61  L-ATSAKVEHYTSDGHTDFQQPVVLLLDIEIQNTDKESWKLSADKARL-TKDNMLYLDGN 118

Query: 142 FKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
              +         R++ + AV+++    I+S   V +   +F  +          + A  
Sbjct: 119 VIAQSLSAQSRLQRIETQRAVVNLTTQDISSDQMVKLNGQNFNSTGLKLTGNLQQQVATL 178

Query: 198 AGQVSVVVN 206
             QV     
Sbjct: 179 KEQVKTYYE 187


>gi|194364735|ref|YP_002027345.1| hypothetical protein Smal_0957 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347539|gb|ACF50662.1| protein of unknown function DUF1239 [Stenotrophomonas maltophilia
           R551-3]
          Length = 191

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/151 (9%), Positives = 36/151 (23%), Gaps = 8/151 (5%)

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
               I+  F +    +   + S            G   I +      +P +  +     L
Sbjct: 43  GVDYILHDFQIVALDEHGKE-STTLRAPLLERQRGDQTINIATPLFEMPDKDGK--HWTL 99

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITHS 177
            A +   +     + +                     +   +  K     +   V +T  
Sbjct: 100 RAETGWLSAKGDEMKLRGNVAGDSPAAPGTVPTTFRTDHLDVFPKENRARTDALVTMTRP 159

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
               S     +++ + +  F  Q      P 
Sbjct: 160 GMEQSGVGFEVDSKNNTYHFLSQSKGRYTPK 190


>gi|325266391|ref|ZP_08133069.1| hypothetical protein HMPREF9098_0796 [Kingella denitrificans ATCC
           33394]
 gi|324982184|gb|EGC17818.1| hypothetical protein HMPREF9098_0796 [Kingella denitrificans ATCC
           33394]
          Length = 190

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 65/193 (33%), Gaps = 12/193 (6%)

Query: 25  QFLKFFFPF-ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-K 82
           +  +F FP    V +         +   +  +  ++  +    ++ +     Y      +
Sbjct: 3   RLRQFAFPLSLAVILGALSAWLGQVSQISIEEVPLNPKE-PQYLIAQAAAKRYDSTGSLQ 61

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
             LV+ +A       +  ++ +  +L + TQ  E  + ++ A  AR+ LA+  ++  Q  
Sbjct: 62  QQLVSPKAWQLP--DQKNVYFEQPDLRIWTQ--ERAEYHVTAQQARYELASKKIFFEQEV 117

Query: 143 KMKVKDNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +    + +     +      +D       +   V   + +   SA     +  +     
Sbjct: 118 TLDKSADAQRDAAQVRTSQLTVDTVRKIAETPAAVHYRYGNSQGSAQGMTYDYQNGQLNL 177

Query: 198 AGQVSVVVNPGVL 210
             QV  ++    L
Sbjct: 178 PAQVKALIYAKSL 190


>gi|32033611|ref|ZP_00133922.1| COG3117: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207822|ref|YP_001053047.1| hypothetical protein APL_0338 [Actinobacillus pleuropneumoniae L20]
 gi|165975796|ref|YP_001651389.1| hypothetical protein APJL_0354 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149612|ref|YP_001968137.1| hypothetical protein APP7_0343 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249489|ref|ZP_07335696.1| hypothetical protein APP6_0890 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303252580|ref|ZP_07338743.1| hypothetical protein APP2_1558 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307245162|ref|ZP_07527254.1| hypothetical protein appser1_3710 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247332|ref|ZP_07529380.1| hypothetical protein appser2_3290 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249556|ref|ZP_07531543.1| hypothetical protein appser4_3670 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307251885|ref|ZP_07533786.1| hypothetical protein appser6_4050 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254110|ref|ZP_07535956.1| hypothetical protein appser9_3640 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256380|ref|ZP_07538163.1| hypothetical protein appser10_3870 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258573|ref|ZP_07540309.1| hypothetical protein appser11_3730 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260808|ref|ZP_07542495.1| hypothetical protein appser12_3800 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307262936|ref|ZP_07544558.1| hypothetical protein appser13_3590 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126096614|gb|ABN73442.1| hypothetical protein APL_0338 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875897|gb|ABY68945.1| hypothetical protein APJL_0354 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914743|gb|ACE60995.1| hypothetical protein APP7_0343 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648548|gb|EFL78741.1| hypothetical protein APP2_1558 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302651563|gb|EFL81712.1| hypothetical protein APP6_0890 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853942|gb|EFM86155.1| hypothetical protein appser1_3710 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856176|gb|EFM88331.1| hypothetical protein appser2_3290 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858411|gb|EFM90480.1| hypothetical protein appser4_3670 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860577|gb|EFM92589.1| hypothetical protein appser6_4050 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862934|gb|EFM94882.1| hypothetical protein appser9_3640 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865206|gb|EFM97106.1| hypothetical protein appser10_3870 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867367|gb|EFM99219.1| hypothetical protein appser11_3730 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869534|gb|EFN01324.1| hypothetical protein appser12_3800 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871562|gb|EFN03284.1| hypothetical protein appser13_3590 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 198

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/157 (8%), Positives = 41/157 (26%), Gaps = 13/157 (8%)

Query: 70  KFILSD-------YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
               +        Y          AE  +        +       + +    +      +
Sbjct: 40  NPDYTGNRITTSVYDLKGKPQYF-AEAKEIKRYQNTELTEFIQPLVELFDAETALKQWKV 98

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSD 178
            A  A        L +    K++  D      +++ +   +D+    I++   V      
Sbjct: 99  SADYAEI-TKEKILNLDGNVKLQALDKNARLQKIETDKLRIDLNTQDISTESVVKSVGLG 157

Query: 179 FVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
              +    +     + A     V   + P ++++  +
Sbjct: 158 ISTTGTGLKGNLKRQVATITKDVKTYLEPTIIKQSND 194


>gi|78067587|ref|YP_370356.1| hypothetical protein Bcep18194_A6118 [Burkholderia sp. 383]
 gi|77968332|gb|ABB09712.1| protein of unknown function DUF1239 [Burkholderia sp. 383]
          Length = 204

 Score = 56.3 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/144 (12%), Positives = 45/144 (31%), Gaps = 11/144 (7%)

Query: 69  KKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A  A            L D    +   +     +   +   
Sbjct: 51  DNFSVTELDQSGSTQYRLTA--ANLIHYEDTEDSDLTDP--AMRAFQPGKPVVTTTSKRG 106

Query: 128 RFNLANHTLYISQPFKMKV-----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    ++          ++ D +   + V +  I +  PV +     +++
Sbjct: 107 TVNGDVSIVDLYDDARILRAAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVN 166

Query: 183 A-NFARIENSSRSAVFAGQVSVVV 205
           A +  +  N +R     G V   +
Sbjct: 167 ATDGMKYNNVTRVIELYGNVRGTI 190


>gi|304396321|ref|ZP_07378202.1| protein of unknown function DUF1239 [Pantoea sp. aB]
 gi|304355830|gb|EFM20196.1| protein of unknown function DUF1239 [Pantoea sp. aB]
          Length = 190

 Score = 55.9 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 61/198 (30%), Gaps = 27/198 (13%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            +  +++        + ++GW              +  D         +    +      
Sbjct: 2   SKSRRWITLILTLIALVLIGW-----------NLTNQDDNGTPVGPDSQSPTYTSADSHT 50

Query: 81  --------VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
                   + Y LV+++    + S   + + ++  +T     ++     L A  A+    
Sbjct: 51  VVYNPQGALSYKLVSDKVT--YFSDDELSWFENPVMT-TYDENKIPTWTLRADKAKL-TK 106

Query: 133 NHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
           +  LY+    ++          R+  + A +++    + S D V +    F  +    R 
Sbjct: 107 DRMLYLYGHVELNTLTQDSQLERIKTDNAQINLVTQDVTSDDQVTLYGRSFNSTGMKMRG 166

Query: 189 ENSSRSAVFAGQVSVVVN 206
              +++A    +V     
Sbjct: 167 NLRTKNAELIEKVKTSYE 184


>gi|170734133|ref|YP_001766080.1| hypothetical protein Bcenmc03_2799 [Burkholderia cenocepacia MC0-3]
 gi|169817375|gb|ACA91958.1| protein of unknown function DUF1239 [Burkholderia cenocepacia
           MC0-3]
          Length = 204

 Score = 55.9 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/144 (12%), Positives = 45/144 (31%), Gaps = 11/144 (7%)

Query: 69  KKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A +             L D    +   +     +   A   
Sbjct: 51  DNFSVTELDQTGTTQYRLTAAKLV--HYEDTEGSDLTDP--AMRAFQPGKPVVTTTAKRG 106

Query: 128 RFNLANHTLYISQPFKMKV-----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    ++          ++ D +   + V +  I +  PV +     +++
Sbjct: 107 TVNGDVSIVDLYDDARILRAAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVN 166

Query: 183 A-NFARIENSSRSAVFAGQVSVVV 205
           A +  +  N +R     G V   +
Sbjct: 167 ATDGMKYNNVTRVIELYGNVRGTI 190


>gi|192358832|ref|YP_001983261.1| hypothetical protein CJA_2802 [Cellvibrio japonicus Ueda107]
 gi|190684997|gb|ACE82675.1| conserved hypothetical protein [Cellvibrio japonicus Ueda107]
          Length = 202

 Score = 55.9 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 34/123 (27%), Gaps = 5/123 (4%)

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
           +        +         L       E    +L AH  R +L    L++SQ   ++ + 
Sbjct: 80  QVNPDAPGEQDYTLFDTPRLRFQDNPDE-APWHLSAHLGRSSLNGKLLFLSQDVLIQQET 138

Query: 149 N----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                ++++    ++        +   V +  +   + A                 V  +
Sbjct: 139 ASQGLIQIETTELLVKPAEQYAETDKAVKMRSAKGQVDAVGMTALMRDSRVQLQSDVRAI 198

Query: 205 VNP 207
             P
Sbjct: 199 YEP 201


>gi|169633849|ref|YP_001707585.1| hypothetical protein ABSDF2322 [Acinetobacter baumannii SDF]
 gi|169796520|ref|YP_001714313.1| hypothetical protein ABAYE2490 [Acinetobacter baumannii AYE]
 gi|184157547|ref|YP_001845886.1| hypothetical protein ACICU_01227 [Acinetobacter baumannii ACICU]
 gi|213156367|ref|YP_002318787.1| hypothetical protein AB57_1411 [Acinetobacter baumannii AB0057]
 gi|215483983|ref|YP_002326208.1| hypothetical protein ABBFA_002306 [Acinetobacter baumannii
           AB307-0294]
 gi|239503717|ref|ZP_04663027.1| hypothetical protein AbauAB_15517 [Acinetobacter baumannii AB900]
 gi|260557956|ref|ZP_05830168.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|301346197|ref|ZP_07226938.1| hypothetical protein AbauAB0_08120 [Acinetobacter baumannii AB056]
 gi|301510176|ref|ZP_07235413.1| hypothetical protein AbauAB05_01324 [Acinetobacter baumannii AB058]
 gi|301594400|ref|ZP_07239408.1| hypothetical protein AbauAB059_01275 [Acinetobacter baumannii
           AB059]
 gi|332853948|ref|ZP_08435068.1| hypothetical protein HMPREF0021_02651 [Acinetobacter baumannii
           6013150]
 gi|332870204|ref|ZP_08439099.1| hypothetical protein HMPREF0020_02749 [Acinetobacter baumannii
           6013113]
 gi|332874281|ref|ZP_08442200.1| hypothetical protein HMPREF0022_01818 [Acinetobacter baumannii
           6014059]
 gi|169149447|emb|CAM87333.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169152641|emb|CAP01636.2| conserved hypothetical protein [Acinetobacter baumannii]
 gi|183209141|gb|ACC56539.1| hypothetical protein ACICU_01227 [Acinetobacter baumannii ACICU]
 gi|193076933|gb|ABO11666.2| hypothetical protein A1S_1238 [Acinetobacter baumannii ATCC 17978]
 gi|213055527|gb|ACJ40429.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213986458|gb|ACJ56757.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|260408466|gb|EEX01772.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|322507861|gb|ADX03315.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323517458|gb|ADX91839.1| hypothetical protein ABTW07_1410 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332728304|gb|EGJ59685.1| hypothetical protein HMPREF0021_02651 [Acinetobacter baumannii
           6013150]
 gi|332732371|gb|EGJ63628.1| hypothetical protein HMPREF0020_02749 [Acinetobacter baumannii
           6013113]
 gi|332737506|gb|EGJ68414.1| hypothetical protein HMPREF0022_01818 [Acinetobacter baumannii
           6014059]
          Length = 182

 Score = 55.9 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/160 (11%), Positives = 38/160 (23%), Gaps = 7/160 (4%)

Query: 53  FSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPT 112
             K  I          +   L+          + AE  +   +  +    L     T+  
Sbjct: 27  AKKLDIGSAKNMTYSAQGVHLTQTDDKGN-LYIRAEVRQLEQDMQQKTSKLDQLNATMYK 85

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV---KDNLRLDFETAVLDVKNITINSS 169
                 D   FA  A     N  + +S          +  +    +      K   I ++
Sbjct: 86  L--GKVDATFFAKQAYGYDDNQKVVLSGDVVATKLAPQGTIEFQTDELTGYPKTRDIETN 143

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
             V +        +   +   ++    F   +     P  
Sbjct: 144 HQVTVQSPQGEFVSKGLKANLNNGQYEFF-NIRGKYAPKS 182


>gi|107023721|ref|YP_622048.1| hypothetical protein Bcen_2174 [Burkholderia cenocepacia AU 1054]
 gi|116690808|ref|YP_836431.1| hypothetical protein Bcen2424_2788 [Burkholderia cenocepacia
           HI2424]
 gi|254247189|ref|ZP_04940510.1| hypothetical protein BCPG_01974 [Burkholderia cenocepacia PC184]
 gi|105893910|gb|ABF77075.1| protein of unknown function DUF1239 [Burkholderia cenocepacia AU
           1054]
 gi|116648897|gb|ABK09538.1| protein of unknown function DUF1239 [Burkholderia cenocepacia
           HI2424]
 gi|124871965|gb|EAY63681.1| hypothetical protein BCPG_01974 [Burkholderia cenocepacia PC184]
          Length = 204

 Score = 55.9 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/144 (12%), Positives = 45/144 (31%), Gaps = 11/144 (7%)

Query: 69  KKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A +             L D    +   +     +   A   
Sbjct: 51  DNFSVTELDQTGTTQYRLTAAKLV--HYEDTEGSDLTDP--AMRAFQPGKPVVTTTAKRG 106

Query: 128 RFNLANHTLYISQPFKMKV-----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    ++          ++ D +   + V +  I +  PV +     +++
Sbjct: 107 TVNGDVSIVDLYDDARILRAAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLSLVN 166

Query: 183 A-NFARIENSSRSAVFAGQVSVVV 205
           A +  +  N +R     G V   +
Sbjct: 167 ATDGMKYNNVTRVIELYGNVRGTI 190


>gi|292490481|ref|YP_003525920.1| hypothetical protein Nhal_0337 [Nitrosococcus halophilus Nc4]
 gi|291579076|gb|ADE13533.1| protein of unknown function DUF1239 [Nitrosococcus halophilus Nc4]
          Length = 147

 Score = 55.9 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/148 (11%), Positives = 45/148 (30%), Gaps = 11/148 (7%)

Query: 68  MKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
           M++F L+   ++ +  Y L  E            + +         Q        + A  
Sbjct: 1   MEEFTLTLMDQEGLPLYRL--EGTHMVHYPATDTVEVTAPHAVFYHQ--VVPRWEVVAER 56

Query: 127 ARFNLANHTLYISQPFKMKV------KDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
              N     +Y+     ++        + +++  +   ++ +     ++ PV + ++   
Sbjct: 57  GLTNSQGDEIYLLGEVVIRQFGADAKTNKMKILTQDVRVEPRAEYAETNQPVTLLNNLGK 116

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPG 208
             A  A++           QV     P 
Sbjct: 117 THAVGAQVYLKEERIELLSQVRGDYEPA 144


>gi|209694096|ref|YP_002262024.1| hypothetical protein VSAL_I0501 [Aliivibrio salmonicida LFI1238]
 gi|208008047|emb|CAQ78186.1| putative membrane protein [Aliivibrio salmonicida LFI1238]
          Length = 187

 Score = 55.9 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 58/183 (31%), Gaps = 17/183 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR-VKYSLVA 87
           + +    L++SW     + + +       P  ++  + +        Y ++    Y + A
Sbjct: 6   LFMTLLLLIASWSGYYLYYEYAKSEQQVIP-DLQTPVFTGKNVSNNNYDENGVRNYQINA 64

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           +       +G     +         +  +  +  + +     N  +HTLY++    +K  
Sbjct: 65  KALARFAQTGNTNFTIPHL---FVFKEGKVKEWEIISDVGVLN-KDHTLYLTGNVIIKNL 120

Query: 148 DN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   +  ++  +++      + D V +    F  +    +   +S+       V  
Sbjct: 121 LPEAAFDTMTTDSMTIELTTKDFMTDDVVNLVGPTFETTGVGMKGNFTSQQTTLLENVQG 180

Query: 204 VVN 206
           +  
Sbjct: 181 IYE 183


>gi|90415752|ref|ZP_01223686.1| hypothetical protein GB2207_10551 [marine gamma proteobacterium
           HTCC2207]
 gi|90333075|gb|EAS48245.1| hypothetical protein GB2207_10551 [marine gamma proteobacterium
           HTCC2207]
          Length = 187

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 63/187 (33%), Gaps = 14/187 (7%)

Query: 29  FFFPFATVTIVGWFLLS-----SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY 83
               F    I G+ L+      +++R ++         D     +     S    +  ++
Sbjct: 6   LLAVFLAFMIGGFVLIWDSPPEAFLRQTSSQMDKKPQADSYMTAVTSRRFSQLGSE--QF 63

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
           SL  +  +  F  G+  + +Q        +      + L A+S   + A+  L +    +
Sbjct: 64  SL--DSPRIEFFQGESTVKVQQPR--FLARGDTPHPLALTANSGVLDNASGRLDLQDAVQ 119

Query: 144 MKVKDNL---RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
            ++        L  ++    V +    +  P  +  +    S    +I+  + + V   +
Sbjct: 120 GQITTAEGLAELTTDSLTYLVDSSVATTDQPFKLLSAQGQASGTGLKIDLINDTVVIQSK 179

Query: 201 VSVVVNP 207
           V V  +P
Sbjct: 180 VRVTHDP 186


>gi|270159889|ref|ZP_06188545.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|289165357|ref|YP_003455495.1| hypothetical protein LLO_2025 [Legionella longbeachae NSW150]
 gi|269988228|gb|EEZ94483.1| putative lipoprotein [Legionella longbeachae D-4968]
 gi|288858530|emb|CBJ12411.1| Conserved hypothetical protein [Legionella longbeachae NSW150]
          Length = 190

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/182 (7%), Positives = 41/182 (22%), Gaps = 8/182 (4%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT 92
           F T+ ++           +        L +     +    +  +++     +L+      
Sbjct: 11  FFTLILLACSGWYYSHSTTLIRLDHETLANSVDTTISHVTVRQFNQKGTLANLLTAPLLQ 70

Query: 93  SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR- 151
               G  +   ++    +     E     + +   +       +       +      + 
Sbjct: 71  HIQKG-NVYLFENP--HIIVSEDEQAPWDIRSEKGKSIDGGKQVTFLGNVIVHQNKGNKS 127

Query: 152 ----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
               L  E      K     S+  V    S  ++ +         +      +      P
Sbjct: 128 QESTLKTEEVTYFPKEKKAISNVLVTYEQSGNIVQSTGMNAYLDEKRVELLHRARGSYVP 187

Query: 208 GV 209
             
Sbjct: 188 AN 189


>gi|71735455|ref|YP_276270.1| hypothetical protein PSPPH_4148 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483489|ref|ZP_05637530.1| hypothetical protein PsyrptA_09553 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|298488494|ref|ZP_07006524.1| hypothetical protein PSA3335_3968 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556008|gb|AAZ35219.1| Protein of unknown function (DUF1239) superfamily [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298156835|gb|EFH97925.1| hypothetical protein PSA3335_3968 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322490|gb|EFW78583.1| hypothetical protein PsgB076_21217 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330041|gb|EFW86028.1| hypothetical protein PsgRace4_10452 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330875121|gb|EGH09270.1| hypothetical protein Pgy4_07759 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330888617|gb|EGH21278.1| hypothetical protein PSYMO_07095 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330987094|gb|EGH85197.1| hypothetical protein PLA107_18849 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011538|gb|EGH91594.1| hypothetical protein PSYTB_18044 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 190

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 12/168 (7%), Positives = 38/168 (22%), Gaps = 9/168 (5%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIF 102
            +           S                  Y  D   +Y + +++ +        +  
Sbjct: 25  WNISPESFMDQPVSTVDDTVIDYYAINAHSVQYLPDGTLQYDMTSDKVE--HVKATDVTL 82

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAV 158
           L   +L +          ++ +     +     + +    +++  D       +      
Sbjct: 83  LTTPDLHMYR--GGEFPWHVQSKKGEVSSGGDQVELIDSVRVERTDEKQRTTIITTSRMT 140

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +  +     +   V I  +  V +A   +             V     
Sbjct: 141 VFPQKQYAQTEQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRGQYE 188


>gi|330869984|gb|EGH04693.1| hypothetical protein PSYAE_22583 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 184

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/168 (7%), Positives = 39/168 (23%), Gaps = 9/168 (5%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIF 102
            +      T    S                  Y  D   +Y + +++ +        +  
Sbjct: 19  WNISPESFTDQPMSTVDDTVIDYYAINAHSVQYLPDGTLQYDMTSDKVE--HVKATDVTL 76

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAV 158
           L   +L +          ++ +     +     + +    +++  D       +      
Sbjct: 77  LTTPDLHMYR--GGEFPWHVQSKKGEVSSGGDQVELIDSVRVERTDEKQRTTIITTSRMT 134

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +  +     +   V I  +  V +A   +             V     
Sbjct: 135 VFPQKQYAQTEQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRGQYE 182


>gi|332994377|gb|AEF04432.1| hypothetical protein ambt_14590 [Alteromonas sp. SN2]
          Length = 192

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 55/187 (29%), Gaps = 16/187 (8%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDRV-KYSL 85
             ++I   F+L+S + I  +          +     K            Y+++    + +
Sbjct: 9   LGLSISVLFILASALYIPIWMDEDPAQQSDQGPDALKPAYKAKNLTTTLYNQEGQLNHKV 68

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A  A        G +  Q    T+ T         + A        N  + +     ++
Sbjct: 69  FA--ASMEHYDQLGFVLFQKPRYTLYT-DDAQSPWEVTATEGTL-YNNELIQLENNVVIE 124

Query: 146 ----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                     +      +++    + S  PV I    +V+++N       ++       V
Sbjct: 125 NQSVDDFVRTIRTAFIEINLYTKQMTSDQPVEIRGLQYVINSNGFNANLRTQEYELIDHV 184

Query: 202 SVVVNPG 208
             + +P 
Sbjct: 185 QTIYSPS 191


>gi|330818338|ref|YP_004362043.1| hypothetical protein bgla_1g34840 [Burkholderia gladioli BSR3]
 gi|327370731|gb|AEA62087.1| hypothetical protein bgla_1g34840 [Burkholderia gladioli BSR3]
          Length = 204

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/149 (12%), Positives = 43/149 (28%), Gaps = 11/149 (7%)

Query: 69  KKFILSDYSKDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A +             L      +   +     +   +   
Sbjct: 51  DNFSVTELDQSGATQYRLTAAKLI--HYEDDETSQLTQP--AMRAFQPGKPVVTATSKRG 106

Query: 128 RFNLANHTLYISQPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    K+          +  D E   + V +  I +  PV +     + +
Sbjct: 107 TVNGDVSIVDLYDDAKILRAAGAGDPPMEADSEHFRVLVNDDVIETEKPVKLQRGLSIAN 166

Query: 183 A-NFARIENSSRSAVFAGQVSVVVNPGVL 210
           A N  +  N +R     G V   +    +
Sbjct: 167 ATNGMKYNNVTRVIDLYGNVRGTIAASDV 195


>gi|77166242|ref|YP_344767.1| hypothetical protein Noc_2790 [Nitrosococcus oceani ATCC 19707]
 gi|76884556|gb|ABA59237.1| Protein of unknown function DUF1239 [Nitrosococcus oceani ATCC
           19707]
          Length = 183

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/181 (9%), Positives = 48/181 (26%), Gaps = 10/181 (5%)

Query: 33  FATVTIVGWFLLSSWI-RISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAK 91
              + ++        +   S +   S          M+KF  +   +  +    +A    
Sbjct: 1   MVALMLIATLTAWELLHEESAYIPRSDLNKRTTDYFMEKFTSTLMDQQGLPLYRLAGT-H 59

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV----- 146
            +       I +   +     Q        + A     N     + +     ++      
Sbjct: 60  MAHYLDNDTIEITAPDAVFYQQ--ATARWKVVAERGLTNSQGDEIDLLGEVIIRQLGADS 117

Query: 147 -KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
              N+++  +   +  +     +  PV + +S     +  AR+           QV    
Sbjct: 118 KTSNMKILTQNVRVKPRIKYAETQQPVTLLNSFGKTHSIGARVYLKDGRIELLSQVRGNY 177

Query: 206 N 206
           +
Sbjct: 178 D 178


>gi|197336092|ref|YP_002155147.1| probable exported protein [Vibrio fischeri MJ11]
 gi|197317582|gb|ACH67029.1| probable exported protein [Vibrio fischeri MJ11]
          Length = 187

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 45/180 (25%), Gaps = 15/180 (8%)

Query: 37  TIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN- 95
            I+      S   +             +  +    + +        Y +   R       
Sbjct: 9   AILLMICSWSGYNLYYDYVKGEQQTTPDQQV---PVFTGKGISNNNYDVSGIRNYQINAK 65

Query: 96  -----SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK----V 146
                   G        L    +  E  +  + +     N  +  LY+S    +K     
Sbjct: 66  ALARFGKTGETNFTTPHL-FVFKDGELKEWEIISDLGVLNKKHE-LYLSGNVIVKNLLPD 123

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
                +  ++  +++      + D V +    F  +    +   +S+ A     V  +  
Sbjct: 124 AAFETMTTDSMKIELTTKDFMTEDVVNLIGPTFETTGVGMKGNFTSQEATLLENVQGIYE 183


>gi|319945407|ref|ZP_08019667.1| hypothetical protein HMPREF0551_2516 [Lautropia mirabilis ATCC
           51599]
 gi|319741193|gb|EFV93620.1| hypothetical protein HMPREF0551_2516 [Lautropia mirabilis ATCC
           51599]
          Length = 202

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/191 (8%), Positives = 50/191 (26%), Gaps = 13/191 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAE 88
                 + +V ++      +                  +++  L     +      + A+
Sbjct: 15  VLILIGLGMVSYYFAKKAEQNHGAPAVEGRPD--PDFFVEQMTLMRADANGNPSVRVEAD 72

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM---- 144
                         +      + +         + +       +     + +  ++    
Sbjct: 73  ----HMLHYPLDQRMAFTRPRIISLDETQPLTTITSRKGSAPDSGDYADLQEDVRVLRTA 128

Query: 145 -KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                 ++L  ETA +D+ +  I+++ PV +   D  L      I +         +V  
Sbjct: 129 TADAPPMQLTTETARVDMVHNLISTAAPVQMQAGDNRLEGVGMEIRDQDHQLELKSRVRG 188

Query: 204 VVNPGVLQKKE 214
              P   +  +
Sbjct: 189 HF-PATTRGDD 198


>gi|119477365|ref|ZP_01617556.1| hypothetical protein GP2143_00287 [marine gamma proteobacterium
           HTCC2143]
 gi|119449291|gb|EAW30530.1| hypothetical protein GP2143_00287 [marine gamma proteobacterium
           HTCC2143]
          Length = 196

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 8/117 (6%), Positives = 27/117 (23%), Gaps = 1/117 (0%)

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-KVKDNL 150
                      +                  + A +      +  + + +   +     + 
Sbjct: 72  QRTLHNPANRSIDIINPVFQFYSGGEYQWRVSAKTGVLFQKSDRVELMKEVIVLSSDRST 131

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
            L      L        +  P+ + + + V  A   + +  ++      +V     P
Sbjct: 132 SLKTPALTLFPNKKQAQTDQPITLVNINGVTRAIGMKTDLETKDIELLNRVRGQYEP 188


>gi|258645772|ref|ZP_05733241.1| conserved hypothetical protein [Dialister invisus DSM 15470]
 gi|260403143|gb|EEW96690.1| conserved hypothetical protein [Dialister invisus DSM 15470]
          Length = 181

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 53/175 (30%), Gaps = 13/175 (7%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS----KDRVKYS-LVAE 88
               ++   +      +     +S+   D     ++    +D +    KD      L A 
Sbjct: 8   IIGVVLMVLITLGVYILFKGDGNSVFTGDDTTQAVE---FNDINLNEEKDGKVIWNLKAR 64

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                  S +   +L D E       +E   + + A       A  T+ +    + K KD
Sbjct: 65  HV--KMESNRNTAYLTDIEGFFAEDGNE---LSIKAKKGIIKRAEQTVNLEGDIEGKTKD 119

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
            L L  +    D K   +++           +L+A+    +      V  G   +
Sbjct: 120 GLILYAKNLTYDGKKQVLSTDCSFTAEKDGRILTADSFTADRVLEKIVAKGHAKL 174


>gi|289627573|ref|ZP_06460527.1| hypothetical protein PsyrpaN_20992 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646999|ref|ZP_06478342.1| hypothetical protein Psyrpa2_04487 [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 190

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 13/168 (7%), Positives = 39/168 (23%), Gaps = 9/168 (5%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIF 102
            +      T    S                  Y  D   +Y + +++ +        +  
Sbjct: 25  WNISPESFTDQPMSTVDDTVIDYYAINAHSVQYLPDGTLQYDMTSDKVE--HVKATDVTL 82

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAV 158
           L   +L +          ++ +     +     + +    +++  D       +      
Sbjct: 83  LTTPDLHMYR--GGEFPWHVQSKKGEVSSGGDQVELIDSVRVERTDEKQRTTIITTSRMT 140

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +  +     +   V I  +  V +A   +             V     
Sbjct: 141 VFPQKQYAQTEQDVRIDGAGGVTTAKGMKAYLKDSRMDLLSNVRGQYE 188


>gi|90413002|ref|ZP_01221000.1| hypothetical protein P3TCK_24160 [Photobacterium profundum 3TCK]
 gi|90326017|gb|EAS42456.1| hypothetical protein P3TCK_24160 [Photobacterium profundum 3TCK]
          Length = 187

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/180 (11%), Positives = 53/180 (29%), Gaps = 17/180 (9%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGK 98
               ++ +W           D +  EP   +K + +        ++   E    S+    
Sbjct: 9   ALLIVICAWFGYYLLENRWKDDIQVEPDA-EKPLFTGSIVTNTAFN---ESGMRSYQIDS 64

Query: 99  GIIFLQDFELT--------VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV---- 146
             +                   +  E  +  + +++A+ +  +  L ++   ++      
Sbjct: 65  DYLEHFSVSGDTDFDKPVLWVYRDGENTEWRISSNTAKLD-KDQVLQMTGNVRIFNLLPE 123

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
                +  +T  LD+     +++D V+IT + F       +       A     V     
Sbjct: 124 SIMKVMQTDTLRLDLITKDFDTADHVVITGTGFQNEGTGMKGNMDRSVATLLNNVKGRYE 183


>gi|75908933|ref|YP_323229.1| hypothetical protein Ava_2721 [Anabaena variabilis ATCC 29413]
 gi|75702658|gb|ABA22334.1| Protein of unknown function DUF1239 [Anabaena variabilis ATCC
           29413]
          Length = 385

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 50/176 (28%), Gaps = 6/176 (3%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAER 89
            P     I+           +T S +S        +     IL    +     + + A++
Sbjct: 11  LPLTIFLIIALVACGVKSPNNTQSNNSDTTNRESNLTFFDVILEQADEVGRPVWRVKAKQ 70

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KD 148
           A   +   K I   +     +           + A  A        L++         K+
Sbjct: 71  A--QYTKEKQIGEAESPYGELYQ--DGKVVYQVKAEKADIEQDGKQLFLKGKIVATDPKN 126

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
            + L         +   +   + +  TH      A  AR++   +   F+GQV   
Sbjct: 127 GIVLYGNELEWRPQEDLLIVRNKINGTHKQVQAVAQEARVKTREQRMEFSGQVVAN 182



 Score = 44.3 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 10/88 (11%), Positives = 25/88 (28%), Gaps = 2/88 (2%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
               ++ + A+     +   T Y++       K    L+ +     +    + + D V+ 
Sbjct: 279 QRVENLTVTANQGEMRIPQKTAYLTGNVNAVGKRRQTLNSQKLTWYLDRKLVEAQDNVVY 338

Query: 175 T--HSDFVLSANFARIENSSRSAVFAGQ 200
                        A     + + V  G 
Sbjct: 339 RQVDPALTFKGETAVGNLDTENIVVKGG 366


>gi|303230194|ref|ZP_07316962.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515120|gb|EFL57094.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 178

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 50/161 (31%), Gaps = 5/161 (3%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFL 103
           L ++I   +   SS    + + +  +   L + +  ++ ++L AE+ +    S    I L
Sbjct: 21  LIAFILHDSGDSSSKGANNGQLVNFQGAELQEENDGKLVWALSAEKIEYDPRSKS--IVL 78

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
            + +              + A  A  +  + +L I         +      +    D K 
Sbjct: 79  TNLKGLFYQDD---VTTTITAPHAVLSGDHSSLDIDGGVTATNTEGANFKTDALHFDNKT 135

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             + S         D  L+ +      S +     G   + 
Sbjct: 136 KMLTSKTAFTYDSKDITLTGDKLEGNMSLKQIKAIGHAKLT 176


>gi|54310340|ref|YP_131360.1| hypothetical protein PBPRA3252 [Photobacterium profundum SS9]
 gi|46914781|emb|CAG21558.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 187

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/180 (11%), Positives = 53/180 (29%), Gaps = 17/180 (9%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGK 98
               ++ +W           D +  EP   +K + +        ++   E    S+    
Sbjct: 9   ALLIVICAWFGYYLLENRWKDDIQVEPDA-EKPLFTGSIVTNTAFN---ESGMRSYQIDS 64

Query: 99  GIIFLQDFELT--------VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV---- 146
             +                   +  E  +  + +++A+ +  +  L ++   ++      
Sbjct: 65  EYLEHFSVSGDTDFDKPVLWVYRDGENTEWRISSNTAKLD-KDQVLQMTGNVRIFNLLPE 123

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
                +  ET  LD+     +++D V+IT + F       +       A     V     
Sbjct: 124 SIMKVMQTETLRLDLITKDFDTADHVVITGTGFQNEGTGMKGNMDRSVATLLNNVKGRYE 183


>gi|59710997|ref|YP_203773.1| hypothetical protein VF_0390 [Vibrio fischeri ES114]
 gi|59479098|gb|AAW84885.1| probable exported protein [Vibrio fischeri ES114]
          Length = 187

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/158 (10%), Positives = 47/158 (29%), Gaps = 12/158 (7%)

Query: 53  FSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPT 112
                + +   + +    + +S        Y + A+       +G+         L    
Sbjct: 34  TPDQQVPVFTGKGITNNNYDVSGI----RNYQINAKALARFGKTGE--TNFTTPHL-FVF 86

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMK----VKDNLRLDFETAVLDVKNITINS 168
           +  E  +  + +     N  +  LY+S    +K          +  ++  +++      +
Sbjct: 87  KDGELKEWEIISDLGVLNKKHE-LYLSGNVIVKNLLPDAAFETMTTDSMKIELTTKDFMT 145

Query: 169 SDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            D V +    F  +    +   +S+ A     V  +  
Sbjct: 146 EDVVNLIGPTFETTGVGMKGNFTSQEATLLENVQGIYE 183


>gi|302340515|ref|YP_003805721.1| protein of unknown function DUF1239 [Spirochaeta smaragdinae DSM
           11293]
 gi|301637700|gb|ADK83127.1| protein of unknown function DUF1239 [Spirochaeta smaragdinae DSM
           11293]
          Length = 209

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 67/205 (32%), Gaps = 16/205 (7%)

Query: 13  QRSKYRQHVRFIQFLKFFFP----FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM 68
           ++ K  +    I+  +   P     + +  + W + +  +       +     +    +M
Sbjct: 2   RKLKRNKQSLCIKGRRLLLPGFFHVSALLFIVWIVAACSVDYEKAKMAEDLGEETPETVM 61

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL-FAHSA 127
             F  ++     + Y + A + +      + ++ L D +            ++L  A S 
Sbjct: 62  HGFRQANVIGHHIVYEIEATQVE--SYPRQKVLKLSDVD--FREFDQNGDQVFLSTAGSM 117

Query: 128 RFNLANHTLYISQPFKMKVKDNL---RLDFETAVLDVKNITINSS--DPVIITHS--DFV 180
            ++L    + +    K+   +      ++ +    D K   I +     V  +      V
Sbjct: 118 EYDLREKRIDLGSGVKILRTNENGSTEIEGDAFSFDEKEKLITAPPTSLVRFSDEESGGV 177

Query: 181 LSANFARIENSSRSAVFAGQVSVVV 205
           L+      E  S +  F+G VS   
Sbjct: 178 LAGRGFSAETDSGTIQFSGGVSGTY 202


>gi|330958011|gb|EGH58271.1| hypothetical protein PMA4326_05466 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 190

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 11/129 (8%), Positives = 34/129 (26%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + A++ +        +  L    L +          ++ +     + A   + +   
Sbjct: 64  QYDMTADKVE--HVKATDVSLLTTPNLNMYR--GGAFPWHVQSKRGEVSSAGDQVELMDS 119

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 120 VRVERTDEKQRTTIITSSRMTVFPQKEYAETDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 179

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 180 LSNVRGQYE 188


>gi|146281420|ref|YP_001171573.1| hypothetical protein PST_1034 [Pseudomonas stutzeri A1501]
 gi|145569625|gb|ABP78731.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 159

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 14/132 (10%), Positives = 38/132 (28%), Gaps = 9/132 (6%)

Query: 76  YSKDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
           Y  D    Y + AE+ +        +  L   +  + + R      ++ +     +    
Sbjct: 26  YQADGKRNYEMTAEKVE--HIKASDVSLLTKPD--LLSYRGGEHPWHVRSERGEVSAEGD 81

Query: 135 TLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
            + +    +++  D       L      +        ++  V I  ++ V +A   +   
Sbjct: 82  EVLLIDKVRVERTDAKGRPTILTTSRLTVWPDKDYAETNQAVRIDAANGVTTATGMKAYL 141

Query: 191 SSRSAVFAGQVS 202
                +    V 
Sbjct: 142 DDGRMLLLSNVR 153


>gi|300113014|ref|YP_003759589.1| hypothetical protein Nwat_0298 [Nitrosococcus watsonii C-113]
 gi|299538951|gb|ADJ27268.1| protein of unknown function DUF1239 [Nitrosococcus watsonii C-113]
          Length = 183

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 17/180 (9%), Positives = 42/180 (23%), Gaps = 9/180 (5%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT 92
                I            S ++             M++F  +      +    +A     
Sbjct: 2   VILTLIATVTAWELLQEESAYAPGGDLNRRTTDYFMEEFTSTLMDPQGLPLYRLAGT-HM 60

Query: 93  SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV------ 146
           +       I +   +     Q        + A     N     + +     +        
Sbjct: 61  AHYLDNDTIEITAPDAVFYQQ--AKARWKVVAEQGLTNSQGDEIDLLGEVIIHQLGADSK 118

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             N+++      +  +     +  PV + +S     +  AR+           QV    +
Sbjct: 119 TINMKILTRNVRVKPQAKYAETQQPVTLLNSFGKTHSIGARVYLKEGRIELLSQVRGNYD 178


>gi|170717853|ref|YP_001784911.1| hypothetical protein HSM_1591 [Haemophilus somnus 2336]
 gi|168825982|gb|ACA31353.1| protein of unknown function DUF1239 [Haemophilus somnus 2336]
          Length = 191

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 29/191 (15%), Positives = 57/191 (29%), Gaps = 14/191 (7%)

Query: 24  IQFLKFFFPFATVTIVGWFL-LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK 82
           I++         + ++ WF  L       +    S    ++    M   + S   K   +
Sbjct: 3   IRW-NIILSVIALVLLAWFYTLQPNDNELSQLIKSSTQPEYIGEKMSTSVFSPTGKK--Q 59

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSE---YGDMYLFAHSARFNLANHTLYIS 139
           Y   A++      +           + +     E        L A  A+    N+ LY+ 
Sbjct: 60  YLATADK--IEHYNEDRRTEFHQPLVYLFDIDDEKFGKQSWKLSAKKAKL-TKNNMLYLD 116

Query: 140 QPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
                +   +     R+  E+AV+++    I S   V I   +F  +          + A
Sbjct: 117 GNVIAETLLDNAKLQRVMTESAVVNLTTQDITSDTMVTIKGQNFSSTGLKLTGNLQQQIA 176

Query: 196 VFAGQVSVVVN 206
               QV     
Sbjct: 177 TLKEQVKTHYE 187


>gi|260429201|ref|ZP_05783178.1| lipopolysaccharide transport periplasmic protein LptA [Citreicella
           sp. SE45]
 gi|260419824|gb|EEX13077.1| lipopolysaccharide transport periplasmic protein LptA [Citreicella
           sp. SE45]
          Length = 170

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 44/143 (30%), Gaps = 3/143 (2%)

Query: 73  LSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
               S+D      + A+  + +   G  +            + +    + ++A       
Sbjct: 27  FGGMSQDTSAPVEVSADSLQVNQTDGTALYEGNVVIGQGEMRLAAPRVLIVYA-EGEGQG 85

Query: 132 ANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
               +  S    +    +   + E A   +    +  +  V++T     L++    +   
Sbjct: 86  RIERMEASGGVTLV-SGDEAAEAENADYTIATGVVVMTGNVLLTQGPNALTSERMTVNLE 144

Query: 192 SRSAVFAGQVSVVVNPGVLQKKE 214
             +A   G+V  V+  G    ++
Sbjct: 145 DGTAQMTGRVRTVIQQGTDAPQQ 167


>gi|113461317|ref|YP_719386.1| hypothetical protein HS_1174 [Haemophilus somnus 129PT]
 gi|112823360|gb|ABI25449.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 206

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/191 (15%), Positives = 57/191 (29%), Gaps = 14/191 (7%)

Query: 24  IQFLKFFFPFATVTIVGWFL-LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK 82
           I++         + ++ WF  L       +    S    ++    M   + S   K   +
Sbjct: 18  IRW-NIILSVIALVLLAWFYTLQPNDNELSQLIKSNTQPEYIGEKMSTSVFSPTGKK--Q 74

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEY---GDMYLFAHSARFNLANHTLYIS 139
           Y   A++      +           + +     E        L A  A+    N+ LY+ 
Sbjct: 75  YLATADK--IEHYNEDRRTEFHQPLVYLFDIDDEKFGTQSWKLSAKKAKL-TKNNMLYLD 131

Query: 140 QPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
                +   +     R+  E+AV+++    I S   V I   +F  +          + A
Sbjct: 132 GNVIAETLLDNAKLQRVMTESAVVNLTTQDITSDTMVTIKGQNFSSTGLKLTGNLQQQIA 191

Query: 196 VFAGQVSVVVN 206
               QV     
Sbjct: 192 TLKEQVKTHYE 202


>gi|206901679|ref|YP_002251686.1| hypothetical protein DICTH_1878 [Dictyoglomus thermophilum H-6-12]
 gi|206740782|gb|ACI19840.1| hypothetical protein DICTH_1878 [Dictyoglomus thermophilum H-6-12]
          Length = 181

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/158 (12%), Positives = 52/158 (32%), Gaps = 5/158 (3%)

Query: 46  SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQD 105
           S+  +    +      +   +  +K  L   ++  + + + A++        K  +F  D
Sbjct: 21  SYYFVPLEKEVENVSSEKAGIYAEKVYLKGRNEGNLSWEVSADKLNIDL-LYKHFVFEGD 79

Query: 106 FELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT 165
            +  V     +   + +    A  +   + L I      + +D  +      +    +  
Sbjct: 80  VKGKVYR--DKNLSLLITTKKAEIDRDKNILKIPTELYFETEDGFKGIAPEGIWYFDSGI 137

Query: 166 -INSSDPVIITH-SDFVLSANFARIENSSRSAVFAGQV 201
            +++   V      +F   A+  R + +   A F G V
Sbjct: 138 FMSTKGRVKFEKVGEFKAEADMFRFDTNKGKAEFEGNV 175


>gi|308189073|ref|YP_003933204.1| hypothetical protein Pvag_3637 [Pantoea vagans C9-1]
 gi|308059583|gb|ADO11755.1| Uncharacterized protein yrbK [Pantoea vagans C9-1]
          Length = 190

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 67/193 (34%), Gaps = 17/193 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS---SWIRISTFSKSSIDLLDFEPMIMKKFILSDYS 77
            +  +++        + ++GW L +       + T S+S     D    ++         
Sbjct: 2   SKSRRWITLILTLIALVLIGWNLTNQDGDGTPVGTDSQSPTYTSDDSHTVVYNP------ 55

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
           +  + Y LV+++    + S   + +  +  +T     ++     L A  A+    +  LY
Sbjct: 56  QGALSYKLVSDKVT--YFSDDELSWFDNPVMT-TFDENKIPTWTLRADKAKL-TKDRMLY 111

Query: 138 ISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +    ++          R+  + A +++    + S D V +    F  +    R    ++
Sbjct: 112 LYGHVELNTLTQDSQLERIKTDNAQINLVTQDVTSDDQVTLYGRSFNSTGMKMRGNLRTK 171

Query: 194 SAVFAGQVSVVVN 206
           +A    +V     
Sbjct: 172 NAELIEKVKTSYE 184


>gi|227824358|ref|ZP_03989190.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904857|gb|EEH90775.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 191

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/191 (13%), Positives = 58/191 (30%), Gaps = 9/191 (4%)

Query: 16  KYRQHVRFIQFLK--FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFIL 73
           K ++  RF++  K         V ++G  +        T              ++   I 
Sbjct: 2   KDKKGKRFMRSDKRTIMMVIGAVLLMGGVIAWLLSSKPTAGTVKKAKETDPHQVIGSTI- 60

Query: 74  SDYSKDRVK-YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
            + +KD  K +SL  E       +      ++  + T   +      M + A     ++ 
Sbjct: 61  -EENKDGRKVWSLTVESMVYDRKAQID--HMKGIKGTFYDEDG--STMTVTADEGDVDVK 115

Query: 133 NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
             ++ +++  K     N  +  +    + +   + +     +T  D V +   A      
Sbjct: 116 TKSVILTKNPKGTTSTNGTVTADKITWNNEKQIVIAEGHARLTKDDVVATGGKATFNVPM 175

Query: 193 RSAVFAGQVSV 203
             A       V
Sbjct: 176 EHATLEQDAHV 186


>gi|134096261|ref|YP_001101336.1| hypothetical protein HEAR3106 [Herminiimonas arsenicoxydans]
 gi|133740164|emb|CAL63215.1| Conserved hypothetical protein; putative exported protein
           [Herminiimonas arsenicoxydans]
          Length = 199

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 50/175 (28%), Gaps = 10/175 (5%)

Query: 42  FLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGI 100
           F L   ++  T               ++KF      K    +Y+L               
Sbjct: 27  FWLVEVMQRQTEDSLPARARTEPDFYVEKFNFVRMGKTGEARYNLTGTE--MKHYPQDDS 84

Query: 101 IFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-----VKDNLRLDFE 155
             +Q+  +   +       M   +  A     +  +++     +         + +L   
Sbjct: 85  YQIQNPVMHSYSMD--KPPMVSRSLRATITNNSSEVHMYDNVHINRPASATSRHFQLKTS 142

Query: 156 TAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVL 210
             +L   +  + +  PV IT  + VL+       N+S     +  V     P  +
Sbjct: 143 YLLLLPDDDVMKTPKPVEITIGESVLTGAGMFANNASGEFRLSSNVKGQYQPPNI 197


>gi|52841074|ref|YP_094873.1| hypothetical protein lpg0838 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54296859|ref|YP_123228.1| hypothetical protein lpp0900 [Legionella pneumophila str. Paris]
 gi|52628185|gb|AAU26926.1| hypothetical protein lpg0838 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750644|emb|CAH12051.1| hypothetical protein lpp0900 [Legionella pneumophila str. Paris]
          Length = 189

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/185 (6%), Positives = 47/185 (25%), Gaps = 10/185 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            +     + + G      +   +    +   L +     + +  +  ++ + V  +L+  
Sbjct: 8   IWLFLTLLILAG--SGWYYAHFNQAIINKKSLSNEVDTTISQLTVKQFNSEGVLINLLTT 65

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                  +   +  L++    +  ++       + +  A+       +   +   +    
Sbjct: 66  PQVEYIPNN-NLHLLKNP--HIIIKQDNQPAWEINSLRAKSFDGGKQITFIEQVVVHQNP 122

Query: 149 NL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L  E      K     +S  V       ++ +         +      +   
Sbjct: 123 GESTRESTLKTEEITYYPKEKKATTSLFVTFEQPGNIIQSTGMNAYLDEKRVELLHKARG 182

Query: 204 VVNPG 208
             +P 
Sbjct: 183 SYDPA 187


>gi|54293813|ref|YP_126228.1| hypothetical protein lpl0869 [Legionella pneumophila str. Lens]
 gi|296106417|ref|YP_003618117.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
 gi|53753645|emb|CAH15103.1| hypothetical protein lpl0869 [Legionella pneumophila str. Lens]
 gi|295648318|gb|ADG24165.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
          Length = 189

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/185 (6%), Positives = 49/185 (26%), Gaps = 10/185 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            +     + + G     +    +  +K ++   +     + +  +  ++ + V  +L+  
Sbjct: 8   IWLFLTLLILAGSGWYYAHFNQAIINKKTL--SNEVDTTISQLTVKQFNSEGVLINLLTT 65

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                  +   +  L++    +  ++       + +  A+       +   +   +    
Sbjct: 66  PQVEYIPNN-NLHLLKNP--HIIIKQDNQPAWEINSLRAKSFDGGKQITFIEQVVVHQNP 122

Query: 149 NL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L  E      K     +S  V       ++ +         +      +   
Sbjct: 123 GESTRESTLKTEEITYYPKEKKATTSLFVTFEQPGNIIQSTGMNAYLDEKRVELLHKARG 182

Query: 204 VVNPG 208
             +P 
Sbjct: 183 SYDPA 187


>gi|332974675|gb|EGK11592.1| hypothetical protein HMPREF0476_0275 [Kingella kingae ATCC 23330]
          Length = 190

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 66/192 (34%), Gaps = 20/192 (10%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY- 83
           +F    FP +   I+G    SSW+   +     +  L+ +            + +  ++ 
Sbjct: 3   RFRSLIFPLSLALILGGI--SSWLDQISQISEEVVQLNPKE-----PQYLGLNVEAKRFD 55

Query: 84  ---SLVAERAKTSFNSGKGI--IFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
              SL  + A            +++Q   L +  Q +   ++   + +AR+ L + T+++
Sbjct: 56  ATGSLHEKLASPRMWQLPDQENVYIQQPHLQLFEQNALQYEVR--SQNARYELNSKTVFL 113

Query: 139 SQPFKMKVKDNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
               ++    +       ++     ++       +  P+   +     S+     ++ + 
Sbjct: 114 DTDVQLDKTADAERPAAQVNTSHLTVNTVTQIAQTDAPIQYQYGQSTGSSVGMTYDHKNG 173

Query: 194 SAVFAGQVSVVV 205
                 +V  ++
Sbjct: 174 QLNLPAKVKALI 185


>gi|148360516|ref|YP_001251723.1| hypothetical protein LPC_2457 [Legionella pneumophila str. Corby]
 gi|148282289|gb|ABQ56377.1| conserved hypothetical protein; DUF1239 [Legionella pneumophila
           str. Corby]
 gi|307609630|emb|CBW99134.1| hypothetical protein LPW_09191 [Legionella pneumophila 130b]
          Length = 189

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/185 (6%), Positives = 49/185 (26%), Gaps = 10/185 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            +     + + G     +    +  +K ++   +     + +  +  ++ + V  +L+  
Sbjct: 8   IWLFLTLLILAGSGWYYAHFNQAIINKKTL--SNEVDTTISQLTVKQFNSEGVLINLLTT 65

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                  +   +  L++    +  ++       + +  A+       +   +   +    
Sbjct: 66  PQVEYIPNN-NLHLLKNP--HIIIKQDNQPAWEINSLRAKSFDGGKQITFIEQVVVHQNP 122

Query: 149 NL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   L  E      K     +S  V       ++ +         +      +   
Sbjct: 123 GENTRESTLKTEEITYYPKEKKATTSLFVTFEQPGNIIQSTGMNAYLDEKRVELLHKARG 182

Query: 204 VVNPG 208
             +P 
Sbjct: 183 SYDPA 187


>gi|85058180|ref|YP_453882.1| hypothetical protein SG0202 [Sodalis glossinidius str. 'morsitans']
 gi|84778700|dbj|BAE73477.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 192

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 54/162 (33%), Gaps = 14/162 (8%)

Query: 49  RISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFEL 108
           +    +       ++   ++            + Y LVA+       + + I +      
Sbjct: 33  QTPVNAGEPTYQSEYTTTVVYNP------AGGLNYKLVADHV--DHFADQHITWFTRPVA 84

Query: 109 TVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN----LRLDFETAVLDVKNI 164
           T     S+     + A  A+    +  LY+    ++    +     R+  + AV+++   
Sbjct: 85  T-TFDESKVPTWTVKADKAKL-TQDRMLYLYGHVQVDSLTDASQLKRITTDNAVVNLVTQ 142

Query: 165 TINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            ++S D V +  + F  +    R    +++A    +V     
Sbjct: 143 DVSSDDEVTLYGTGFNSTGMKMRGNLRNKTAELIEKVKTSYE 184


>gi|114778208|ref|ZP_01453080.1| hypothetical protein SPV1_03198 [Mariprofundus ferrooxydans PV-1]
 gi|114551455|gb|EAU54010.1| hypothetical protein SPV1_03198 [Mariprofundus ferrooxydans PV-1]
          Length = 191

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/177 (10%), Positives = 49/177 (27%), Gaps = 6/177 (3%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           ++LK+         +   +   W           +  +     +   ++ +    RV + 
Sbjct: 6   RWLKWTSLLIATGSIVIAVFLIWSAGPQRPARDSNGTEKPRTEVDAPVIVERKDGRVLWQ 65

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           L A  A        G + L   +L + T+     ++ +    A FN     ++     K+
Sbjct: 66  LRASEASQQL---DGQMHLIGPQLRLYTETG--AEVNINGEQAWFNPLKRNVHFQDHVKV 120

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
                  +  ++ +    +  ++     II                 +        V
Sbjct: 121 VY-GEWTMTSQSLIYSSSSDQLSVPGAFIIHGKTVNAHGKHMVFHRINEQVDVKEGV 176


>gi|126641284|ref|YP_001084268.1| hypothetical protein A1S_1238 [Acinetobacter baumannii ATCC 17978]
          Length = 145

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/144 (11%), Positives = 36/144 (25%), Gaps = 7/144 (4%)

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
           +   L+          + AE  +   +  +    L     T+        D   FA  A 
Sbjct: 6   QGVHLTQTDDKGN-LYIRAEVRQLEQDMQQKTSKLDQLNATMYKL--GKVDATFFAKQAY 62

Query: 129 FNLANHTLYISQPFKMKV---KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANF 185
               N  + +S          +  +    +      K   I ++  V +        +  
Sbjct: 63  GYDDNQKVVLSGDVVATKLAPQGTIEFQTDELTGYPKTRDIETNHQVTVQSPQGEFVSKG 122

Query: 186 ARIENSSRSAVFAGQVSVVVNPGV 209
            +   ++    F   +     P  
Sbjct: 123 LKANLNNGQYEFF-NIRGKYAPKS 145


>gi|187251000|ref|YP_001875482.1| hypothetical protein Emin_0590 [Elusimicrobium minutum Pei191]
 gi|186971160|gb|ACC98145.1| protein of unknown function DUF1239 [Elusimicrobium minutum Pei191]
          Length = 170

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/167 (9%), Positives = 46/167 (27%), Gaps = 5/167 (2%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGK 98
           +   +L  +      +  S    +     ++  ++ +  + +  + L   +A   F+   
Sbjct: 4   LILSVLLCFALGCGNNSQSETDDELGVQTVENAVIYESQQAKQNWILSTTQA--KFHENS 61

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETA 157
               L + +L+          +         ++    + +      K    N  L     
Sbjct: 62  ENAVLINPQLSFKEGDDTLSIIK--GDEGTISMEQGLIVLKGNVFGKSISQNAELRTTLL 119

Query: 158 VLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             D+    I +   V I  +   ++    R            Q + +
Sbjct: 120 NYDINERKIWTERKVEIKRNGVTVTGQGLRANGDFSEIEIKNQTTTL 166


>gi|17227727|ref|NP_484275.1| hypothetical protein all0231 [Nostoc sp. PCC 7120]
 gi|17135209|dbj|BAB77755.1| all0231 [Nostoc sp. PCC 7120]
          Length = 385

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 50/176 (28%), Gaps = 6/176 (3%)

Query: 31  FPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAER 89
            P     I+           +T S +S        +     IL    +     + + A++
Sbjct: 11  LPLTIFLIITLVACGVKAPNNTQSNNSDPANRDSNLTFFDVILEQADEVGRPVWRVKAKQ 70

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KD 148
           A   +   K I   +     +           + A  A        L++         K+
Sbjct: 71  A--QYTKEKQIGEAESPYGELYQ--DGKVVYQVKAEKADIEQDGKQLFLKGKIVATDPKN 126

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
            + L         +   +   + +  TH      A  AR++   +   F+GQV   
Sbjct: 127 GIVLYGNELEWRPQEDLLIVRNKINGTHKQVQAVAQEARVKTREQRMEFSGQVVAN 182



 Score = 44.3 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 9/88 (10%), Positives = 24/88 (27%), Gaps = 2/88 (2%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
               ++ + A+     +   T Y++       K    L+ +     +    + +   V+ 
Sbjct: 279 QRVENLTVTANQGEMRIPQKTAYLTGNVNAVGKRRQTLNSQKLTWYLDRKLVEAQGNVVY 338

Query: 175 T--HSDFVLSANFARIENSSRSAVFAGQ 200
                        A     + + V  G 
Sbjct: 339 RQVDPALTFKGETAVGNLDTENIVVKGG 366


>gi|225872296|ref|YP_002753751.1| hypothetical protein ACP_0623 [Acidobacterium capsulatum ATCC
           51196]
 gi|225792950|gb|ACO33040.1| hypothetical protein ACP_0623 [Acidobacterium capsulatum ATCC
           51196]
          Length = 791

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 55/195 (28%), Gaps = 18/195 (9%)

Query: 24  IQFLKFFFPFATVTIVGW---FLLSSWIRIST-FSKSSIDLLDFEPMIMKKFILSDYSKD 79
           ++ L+ +   A   +V     F L S +R          +L          F  S  S  
Sbjct: 5   VKRLRLWILSAAGLLVVVLAGFFLYSILRFRREVKDLPRELGANIQQTANGFTYSQSSGG 64

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              +++ A + K   N   G   L   ++ +      +    +     R+N         
Sbjct: 65  HTLFTIQASKLKQFRN---GQALLHKVKIILYGPPGTHRQDTIHGTDFRYNPKTGVAQSE 121

Query: 140 QPFKMKVK-----------DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
              ++ V+           + + +       D K+   ++S             A  A  
Sbjct: 122 GDVEIDVESPAGEGQSSAANTIHVKTSGLTFDSKSGEASTSRYTEFASPKGSGHAVGASY 181

Query: 189 ENSSRSAVFAGQVSV 203
            + +   V    V +
Sbjct: 182 NSKTGMLVLNSSVVL 196


>gi|167031977|ref|YP_001667208.1| hypothetical protein PputGB1_0962 [Pseudomonas putida GB-1]
 gi|166858465|gb|ABY96872.1| protein of unknown function DUF1239 [Pseudomonas putida GB-1]
          Length = 190

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/183 (6%), Positives = 37/183 (20%), Gaps = 9/183 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
                    +V     +           +                  +  D   +Y + A
Sbjct: 10  VLLGAIAALLVAIGYWNVSPESFLDKPVAQVDESAIDYYAINAHSVQFLPDGKLQYEMTA 69

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++ +        I  L   +L +          ++ +  A  N     + +    ++   
Sbjct: 70  DKVE--HLKASEITLLTTPDLHMYR--GTEYPWHVQSTRAEVNPDGTEVELIDKVRVART 125

Query: 148 ----DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   +      +  +     +   V I  +    +    +             V  
Sbjct: 126 DEKQRETIITSSRMTVFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGKMDLLSNVRG 185

Query: 204 VVN 206
              
Sbjct: 186 QYE 188


>gi|260494137|ref|ZP_05814268.1| S-layer protein [Fusobacterium sp. 3_1_33]
 gi|260198283|gb|EEW95799.1| S-layer protein [Fusobacterium sp. 3_1_33]
          Length = 901

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 44/132 (33%), Gaps = 5/132 (3%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQ---DFELTVPTQRSEYGDMYLFAHSARFNLA 132
             +   K+   A+            +FL    +  L             + A   +FN  
Sbjct: 60  LDEKESKFE-KAKAIIQGMILSGDNVFLDKDKNLTLDTNILGISPNGWEIKASELKFNKE 118

Query: 133 NHTLYISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              L  ++P   K ++  + +        +    I   D V+I +  F + A+ A  +N+
Sbjct: 119 TKELVSTKPMYAKNEEKGVEILANKFKTTISMDNITLEDGVVIKNKLFSILADKANYDNN 178

Query: 192 SRSAVFAGQVSV 203
           ++     G + +
Sbjct: 179 TKIITLEGNIKL 190



 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 26/96 (27%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L+ +  V   
Sbjct: 293 DIINIYGQIK---GGNPIYSVLADKGEYNINDKKIRIFGNVDITSTKGEKLNLDNFVYSS 349

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T     L A +      ++   
Sbjct: 350 ETKEADMYGNKIKYTSPTNNLEAEYIHYNTVTKEIT 385



 Score = 41.2 bits (95), Expect = 0.086,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 785 LTIDDGEKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 844

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V +   D V++AN    +  +R     G V V  
Sbjct: 845 VYDRVKVVTKDSVITANEGHYDIVNRKIRAKGNVHVDY 882



 Score = 38.5 bits (88), Expect = 0.60,   Method: Composition-based stats.
 Identities = 10/89 (11%), Positives = 26/89 (29%), Gaps = 1/89 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +Y ++ L       N    +  ++   K     +   D      +  +  IN    +
Sbjct: 243 FDMKYDEVGLKGKDIVLNETTQSFKVTGDVKFTY-QDYIFDVSYIEKEPNSDIINIYGQI 301

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQV 201
              +  + + A+      + +     G V
Sbjct: 302 KGGNPIYSVLADKGEYNINDKKIRIFGNV 330


>gi|256027951|ref|ZP_05441785.1| S-layer protein [Fusobacterium sp. D11]
          Length = 901

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 44/132 (33%), Gaps = 5/132 (3%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQ---DFELTVPTQRSEYGDMYLFAHSARFNLA 132
             +   K+   A+            +FL    +  L             + A   +FN  
Sbjct: 60  LDEKESKFE-KAKAIIQGMILSGDNVFLDKDKNLTLDTNILGISPNGWEIKASELKFNKE 118

Query: 133 NHTLYISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              L  ++P   K ++  + +        +    I   D V+I +  F + A+ A  +N+
Sbjct: 119 TKELVSTKPMYAKNEEKGVEILANKFKTTISMDNITLEDGVVIKNKLFSILADKANYDNN 178

Query: 192 SRSAVFAGQVSV 203
           ++     G + +
Sbjct: 179 TKIITLEGNIKL 190



 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 26/96 (27%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L+ +  V   
Sbjct: 293 DIINVYGQIK---GGNPIYSVLADKGEYNINDKKIRIFGNVDITSTKGEKLNLDNFVYSS 349

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T     L A +      ++   
Sbjct: 350 ETKEADMYGNKIKYTSPTNNLEAEYIHYNTVTKEIT 385



 Score = 41.2 bits (95), Expect = 0.086,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 785 LTIDDGEKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 844

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V +   D V++AN    +  +R     G V V  
Sbjct: 845 VYDRVKVVTKDSVITANEGHYDIVNRKIRAKGNVHVDY 882



 Score = 38.5 bits (88), Expect = 0.61,   Method: Composition-based stats.
 Identities = 10/89 (11%), Positives = 26/89 (29%), Gaps = 1/89 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +Y ++ L       N    +  ++   K     +   D      +  +  IN    +
Sbjct: 243 FDMKYDEVGLKGKDIVLNETTQSFKVTGDVKFTY-QDYIFDVSYIEKEPNSDIINVYGQI 301

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQV 201
              +  + + A+      + +     G V
Sbjct: 302 KGGNPIYSVLADKGEYNINDKKIRIFGNV 330


>gi|310818882|ref|YP_003951240.1| hypothetical protein STAUR_1609 [Stigmatella aurantiaca DW4/3-1]
 gi|309391954|gb|ADO69413.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 180

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 58/162 (35%), Gaps = 11/162 (6%)

Query: 52  TFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT-SFNSGKGIIFLQDFELTV 110
               +S    +   +++    L  +  DR    ++A RA+  ++   +G+    D  L +
Sbjct: 18  RPPAASGPASEPPQVVLHGVELQSFEADR---IVLAGRAERMTYQRSEGLFAATDTVLRL 74

Query: 111 PTQRSEYGDMY-------LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
           P+Q      +        + A     +L+   L  S    ++  + +      A  D   
Sbjct: 75  PSQGGAQRAVSGPQGAMEIRAPLMEGSLSTRQLEASGGVVLRTAEGVVARTPRATYDAPA 134

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
            T+   + V +   DF L A+   +     +  F G V  VV
Sbjct: 135 QTVRGREGVAMQGPDFALRADQFNLSLPEGTFSFEGSVETVV 176


>gi|115378038|ref|ZP_01465218.1| hypothetical protein STIAU_1594 [Stigmatella aurantiaca DW4/3-1]
 gi|115364977|gb|EAU64032.1| hypothetical protein STIAU_1594 [Stigmatella aurantiaca DW4/3-1]
          Length = 186

 Score = 53.6 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 58/162 (35%), Gaps = 11/162 (6%)

Query: 52  TFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT-SFNSGKGIIFLQDFELTV 110
               +S    +   +++    L  +  DR    ++A RA+  ++   +G+    D  L +
Sbjct: 24  RPPAASGPASEPPQVVLHGVELQSFEADR---IVLAGRAERMTYQRSEGLFAATDTVLRL 80

Query: 111 PTQRSEYGDMY-------LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
           P+Q      +        + A     +L+   L  S    ++  + +      A  D   
Sbjct: 81  PSQGGAQRAVSGPQGAMEIRAPLMEGSLSTRQLEASGGVVLRTAEGVVARTPRATYDAPA 140

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
            T+   + V +   DF L A+   +     +  F G V  VV
Sbjct: 141 QTVRGREGVAMQGPDFALRADQFNLSLPEGTFSFEGSVETVV 182


>gi|330981131|gb|EGH79234.1| hypothetical protein PSYAP_21567 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 170

 Score = 53.2 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 9/129 (6%), Positives = 33/129 (25%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + +++ +        +  L    L +          ++ +     +     + +   
Sbjct: 44  QYDMTSDKVE--HVKATDVSLLTTPNLNMYR--GGAFPWHVQSKRGEVSSDGDQVELMDS 99

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 100 VRVERTDEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 159

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 160 LSNVRGQYE 168


>gi|163745217|ref|ZP_02152577.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
 gi|161382035|gb|EDQ06444.1| hypothetical protein OIHEL45_06500 [Oceanibulbus indolifex HEL-45]
          Length = 164

 Score = 53.2 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 40/130 (30%), Gaps = 8/130 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDF--ELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              + A+       SG  I        +  +     +   +Y              L  +
Sbjct: 39  PVEVTADNLSVDNASGTAIFTGNVLISQGEMTLSAGKVQVIYRAEDQGI-----AKLEAT 93

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
               +        + + A  D+   T+  S  V++T     LSA    +  +  +A  +G
Sbjct: 94  GGVVLV-AGEDAAESQRADYDIDAGTLVMSGDVLMTQGPSALSAQEMTVNLNDGTAQMSG 152

Query: 200 QVSVVVNPGV 209
            V  ++ PG 
Sbjct: 153 GVKTILQPGS 162



 Score = 36.2 bits (82), Expect = 3.1,   Method: Composition-based stats.
 Identities = 12/106 (11%), Positives = 37/106 (34%), Gaps = 4/106 (3%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT----INS 168
           ++     + + A +   + A+ T   +    +   +      +  V+          + +
Sbjct: 33  EQDTSLPVEVTADNLSVDNASGTAIFTGNVLISQGEMTLSAGKVQVIYRAEDQGIAKLEA 92

Query: 169 SDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           +  V++   +    +  A  +  + + V +G V +   P  L  +E
Sbjct: 93  TGGVVLVAGEDAAESQRADYDIDAGTLVMSGDVLMTQGPSALSAQE 138


>gi|268590744|ref|ZP_06124965.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
 gi|291313517|gb|EFE53970.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
          Length = 191

 Score = 53.2 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/185 (14%), Positives = 57/185 (30%), Gaps = 10/185 (5%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           ++L        + ++GW    +     +     I+                     + Y 
Sbjct: 6   KWLIVILSLVVLGLIGW--NLAGNDSDSAEDKVINDGQPNYQTDDSVTFVYNPTGNLAYK 63

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           LV+E+      +   I +     LT     +      + A  AR    +  LY+    ++
Sbjct: 64  LVSEK--IDNYTEGKITWFSKPVLT-TYNEAGEPTWTVKAFKARL-TNDRILYLYSDVQV 119

Query: 145 KVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                     R+  E+AV+++    ++S D V I       +    +    +++A     
Sbjct: 120 DSLTKESQIQRITTESAVVNLTTQDVSSDDKVTIIGHGLNSTGMKMKGNLRTKTAELIED 179

Query: 201 VSVVV 205
           V    
Sbjct: 180 VKTHY 184


>gi|83721373|ref|YP_441046.1| hypothetical protein BTH_I0489 [Burkholderia thailandensis E264]
 gi|167579778|ref|ZP_02372652.1| hypothetical protein BthaT_16631 [Burkholderia thailandensis TXDOH]
 gi|167617853|ref|ZP_02386484.1| hypothetical protein BthaB_16201 [Burkholderia thailandensis Bt4]
 gi|257140301|ref|ZP_05588563.1| hypothetical protein BthaA_14005 [Burkholderia thailandensis E264]
 gi|83655198|gb|ABC39261.1| Protein of unknown function (DUF1239) superfamily [Burkholderia
           thailandensis E264]
          Length = 204

 Score = 53.2 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/147 (12%), Positives = 42/147 (28%), Gaps = 11/147 (7%)

Query: 69  KKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
             F +++  +    +Y L A  A            L      +   +     +   A   
Sbjct: 51  DNFSVTELDQTGSTQYRLTA--AGLVHYEDDETSDLTQP--ALRAFQPGKPTVTATAKRG 106

Query: 128 RFNLANHTLYISQPFKMKVKDN-----LRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             N     + +    ++          ++ D +   + V +  I +  PV +     + +
Sbjct: 107 TVNGDVSIVDLYDDARILRAAGAGDPPMQADSQHFRVLVNDDVIETEKPVKLQRGLSIAN 166

Query: 183 AN-FARIENSSRSAVFAGQVSVVVNPG 208
           A    +  N +R     G V   +   
Sbjct: 167 AAAGMKYNNVTRVIELYGNVRGTIAAS 193


>gi|317153184|ref|YP_004121232.1| hypothetical protein Daes_1472 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943435|gb|ADU62486.1| protein of unknown function DUF1239 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 206

 Score = 53.2 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 59/186 (31%), Gaps = 10/186 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDL------LDFEPMIMKKFILSDYSKDRVK 82
            F     + I    +  S   I   +   ++       LD   +  +   L   ++  + 
Sbjct: 12  IFLVGLALGIAVKAVFFSDEIIEPTALEPVEGKSRAQLLDEADISAEDIELVQGTQGAMT 71

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           + L+A  A+ +      ++ +   +L+      +  ++Y+ A     +  N  L +    
Sbjct: 72  WKLLATSARYNQERK--LVGVDRPQLS-AYFGVDRQEVYVKADRGEVDQPNDNLTLYDNV 128

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
             +   +L LD            +     V +   D  L A    I+  +     AG V 
Sbjct: 129 TGRF-GSLALDAAHLDYVGAIDKVYLKGGVTVRRPDMTLKAAAVEIDLVTHELKAAGGVE 187

Query: 203 VVVNPG 208
            +  P 
Sbjct: 188 ALFAPK 193


>gi|303230989|ref|ZP_07317732.1| conserved hypothetical protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302514371|gb|EFL56370.1| conserved hypothetical protein [Veillonella atypica ACS-049-V-Sch6]
          Length = 178

 Score = 53.2 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 49/161 (30%), Gaps = 5/161 (3%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFL 103
           L ++I   +   SS    + + +  +   L +    ++ ++L AE+ +    S    I L
Sbjct: 21  LIAFILHDSGDSSSKGANNGQLVNFQGAELQEEKDGKLVWALSAEKIEYDPRSKS--IVL 78

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
            + +              + A  A  +  + +L I         +      +    D K 
Sbjct: 79  TNLKGLFYQDD---VTTTITAPHAVLSGDHSSLDIDGGVTATNTEGANFKTDALHFDNKT 135

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             + S         D  L+ +      S +     G   + 
Sbjct: 136 KMLTSKTAFTYDSKDITLTGDKLEGNMSLKQIKAIGHAKLT 176


>gi|87120459|ref|ZP_01076353.1| hypothetical protein MED121_21917 [Marinomonas sp. MED121]
 gi|86164102|gb|EAQ65373.1| hypothetical protein MED121_21917 [Marinomonas sp. MED121]
          Length = 187

 Score = 53.2 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/187 (6%), Positives = 48/187 (25%), Gaps = 10/187 (5%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL--DFEPMIMKKFILSDYSKDRVKYSL 85
           K+      + I+  F  + W  ++         +        ++      +  +      
Sbjct: 4   KWTLASIILGIMLVFGFTFWFGLTPTQNLVQKSILETAPDYFIENVNTKTFDINGALIE- 62

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM- 144
             +  +       G   + +  ++       +       ++      N  +  +   K+ 
Sbjct: 63  TLDAKEIKHFPAPGETRMIEPVISKTLNSDTWI---AAGNTGLMKDLNKDIIFTGNAKII 119

Query: 145 ---KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
              + +    +   T +   ++ ++ S     +      ++A      + S      G V
Sbjct: 120 HLPETQAETTITSNTIIYTDQDQSLTSFGNAKVVSPQGTVNAETITAFSKSNQVTMQGSV 179

Query: 202 SVVVNPG 208
                  
Sbjct: 180 RGSYEQN 186


>gi|15599655|ref|NP_253149.1| hypothetical protein PA4459 [Pseudomonas aeruginosa PAO1]
 gi|107099956|ref|ZP_01363874.1| hypothetical protein PaerPA_01000977 [Pseudomonas aeruginosa PACS2]
 gi|116052491|ref|YP_792804.1| hypothetical protein PA14_57910 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893550|ref|YP_002442419.1| hypothetical protein PLES_48381 [Pseudomonas aeruginosa LESB58]
 gi|254238879|ref|ZP_04932202.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254244727|ref|ZP_04938049.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296391169|ref|ZP_06880644.1| hypothetical protein PaerPAb_23574 [Pseudomonas aeruginosa PAb1]
 gi|313107044|ref|ZP_07793247.1| hypothetical protein PA39016_000840146 [Pseudomonas aeruginosa
           39016]
 gi|9950695|gb|AAG07847.1|AE004860_3 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587712|gb|ABJ13727.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170810|gb|EAZ56321.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198105|gb|EAZ62168.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218773778|emb|CAW29592.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310879749|gb|EFQ38343.1| hypothetical protein PA39016_000840146 [Pseudomonas aeruginosa
           39016]
          Length = 190

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/169 (9%), Positives = 43/169 (25%), Gaps = 9/169 (5%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSG 97
           V  +  +  + +     +     +      +      Y +D    Y + A + +      
Sbjct: 20  VAGYYWNVGLELFNEQPTRPGQDNTIDYYAENAHSLQYQEDGSLDYEMTAVKLE--HQKA 77

Query: 98  KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLD 153
             I F+   +L +          ++ +  A        + +    ++   D       L 
Sbjct: 78  TDITFVTTPDLLLFR--GNVQPWHIQSARAEVGPKGKEVELIDDVRVARTDAKGQPSILT 135

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                +        +   V I  ++ V +A   +             V 
Sbjct: 136 TTRLTVFPDKNYAQTEQAVKIDAANGVTTAVGMKAYLKDSRMHLLSNVR 184


>gi|330895269|gb|EGH27607.1| hypothetical protein PSYJA_00615 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 190

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 9/129 (6%), Positives = 33/129 (25%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + +++ +        +  L    L +          ++ +     +     + +   
Sbjct: 64  QYDMTSDKVE--HVKATDVSLLTTPNLNMYR--GGAFPWHVQSKRGEVSSDGDQVELMDS 119

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 120 VRVERTDEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 179

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 180 LSNVRGQYE 188


>gi|66047371|ref|YP_237212.1| hypothetical protein Psyr_4144 [Pseudomonas syringae pv. syringae
           B728a]
 gi|289676085|ref|ZP_06496975.1| hypothetical protein PsyrpsF_22615 [Pseudomonas syringae pv.
           syringae FF5]
 gi|63258078|gb|AAY39174.1| Protein of unknown function DUF1239 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330969690|gb|EGH69756.1| hypothetical protein PSYAR_04268 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 190

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 9/129 (6%), Positives = 33/129 (25%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + +++ +        +  L    L +          ++ +     +     + +   
Sbjct: 64  QYDMTSDKVE--HVKATDVSLLTTPNLNMYR--GGAFPWHVQSKRGEVSSDGDQVELMDS 119

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 120 VRVERTDEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 179

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 180 LSNVRGQYE 188


>gi|114764078|ref|ZP_01443317.1| hypothetical protein 1100011001333_R2601_15507 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543436|gb|EAU46451.1| hypothetical protein R2601_15507 [Roseovarius sp. HTCC2601]
          Length = 165

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 47/133 (35%), Gaps = 4/133 (3%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
              + A++ + + + G  +            + +    + +F  +         L  +  
Sbjct: 37  PVEVSADQLQVNQSDGTALYTGNVVIGQGEMRLAAPRVLVVFDEAG---NRIARLEATGG 93

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
             +        + E A  D+   T+  +  V++T     L++    +     +A   G+V
Sbjct: 94  VTLV-SGEEAAESERADYDIDEGTVVMTGNVLLTQGPNALTSERMVVNLEGGTAQMTGRV 152

Query: 202 SVVVNPGVLQKKE 214
             V++ G  ++++
Sbjct: 153 RTVISQGADEQQQ 165


>gi|73540064|ref|YP_294584.1| hypothetical protein Reut_A0358 [Ralstonia eutropha JMP134]
 gi|72117477|gb|AAZ59740.1| Protein of unknown function DUF1239 [Ralstonia eutropha JMP134]
          Length = 208

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/184 (11%), Positives = 52/184 (28%), Gaps = 13/184 (7%)

Query: 35  TVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVAERAKTS 93
            V     F L         +K+ +         +++F  ++ ++D   K     ++    
Sbjct: 22  AVVAGSTFWLVQINSQQEGTKAPVVRKHEADYYIERFSATELAQDGGTKVRFTGDKMVHF 81

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL--- 150
            +     +         P +      +   A   R N     + +     ++ +      
Sbjct: 82  DDDQTYEVTRPAMRAYQPNRP----PVSARADLGRMNAEGSVIDLYGNGFVERQQGADAA 137

Query: 151 -----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                        + + +  + +   V +T    V++AN     N +R     G V   +
Sbjct: 138 KDPLLTAASSYFQVLLNDDIVKTDKAVKLTRGPSVMTANGLIFNNVTREVQLLGNVRGTI 197

Query: 206 NPGV 209
             G 
Sbjct: 198 ITGA 201


>gi|256844993|ref|ZP_05550451.1| S-layer protein [Fusobacterium sp. 3_1_36A2]
 gi|256718552|gb|EEU32107.1| S-layer protein [Fusobacterium sp. 3_1_36A2]
          Length = 901

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/134 (12%), Positives = 42/134 (31%), Gaps = 9/134 (6%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY-----LFAHSARFN 130
             +   K+   A+            +FL   +       +    +      + A   ++N
Sbjct: 60  VDEKESKFE-KAKATIQGMILSGDNVFLD--KARNLALDTNIIGISPNGWKINASELKYN 116

Query: 131 LANHTLYISQPFK-MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
                L  ++P   +  +  + +        +    I     V+I +  F + A+ A   
Sbjct: 117 RETQELISTKPMYAINEEKGVEILGNKFKTTISMDNITLEKGVVIKNKLFSILADKANYN 176

Query: 190 NSSRSAVFAGQVSV 203
           NS++     G + +
Sbjct: 177 NSTKIITLEGNIRL 190



 Score = 43.9 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 9/96 (9%), Positives = 27/96 (28%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L+ E  V   
Sbjct: 293 DIINIYGKIK---GGNPVYSVLADKGEYNVNDKKIRIFGNVDITSTKGEKLNLENFVYSS 349

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T  +  L A +      ++   
Sbjct: 350 ETKEADMYGNKIKYTSPENNLEAEYIHYNTVTKEVT 385



 Score = 40.1 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 30/98 (30%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 785 LTIDDGEKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 844

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V I   D V +AN    +  +R     G V V  
Sbjct: 845 VYDRVKIVTKDSVTTANEGHYDMVNRKIRAKGNVHVDY 882



 Score = 38.5 bits (88), Expect = 0.68,   Method: Composition-based stats.
 Identities = 11/89 (12%), Positives = 28/89 (31%), Gaps = 1/89 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +Y ++ L   +   N    +L ++   K     +   D      +  +  IN    +
Sbjct: 243 FDLKYDEVGLKGKNIVLNETTQSLKVTDDVKFTY-QDYVFDVSYIEKEPNSDIINIYGKI 301

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQV 201
              +  + + A+      + +     G V
Sbjct: 302 KGGNPVYSVLADKGEYNVNDKKIRIFGNV 330



 Score = 34.7 bits (78), Expect = 8.7,   Method: Composition-based stats.
 Identities = 15/150 (10%), Positives = 41/150 (27%), Gaps = 27/150 (18%)

Query: 83  YSLVAERAKTSFNSG-KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           Y++  E+      +  K  I + +  L       +     + A  A +N +   + +   
Sbjct: 129 YAINEEKGVEILGNKFKTTISMDNITLE-KGVVIKNKLFSILADKANYNNSTKIITLEGN 187

Query: 142 FKM-------------------------KVKDNLRLDFETAVLDVKNITINSSDPVIITH 176
            ++                         K    +   F     D+    + ++D   + +
Sbjct: 188 IRLSNRIGEVGDINTLKDVKDIQNKSVNKNDKEMSGTFSKVYFDLNERNLYATDGFDLKY 247

Query: 177 SDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            +  L      +  +++S      V     
Sbjct: 248 DEVGLKGKNIVLNETTQSLKVTDDVKFTYQ 277


>gi|313203680|ref|YP_004042337.1| hypothetical protein Palpr_1205 [Paludibacter propionicigenes WB4]
 gi|312442996|gb|ADQ79352.1| protein of unknown function DUF1239 [Paludibacter propionicigenes
           WB4]
          Length = 210

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 49/184 (26%), Gaps = 15/184 (8%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWI-RISTFSKSSIDLLDFEPMIMKKFILSDYSKDR--V 81
           + +K       +     F++           K S          +    ++    D    
Sbjct: 21  RLIKLGLIGRALICSALFVILLVACTQEKPLKISAVKDRSAMPQLHATEVTTVISDSGIT 80

Query: 82  KYSLVA------ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
           +Y +        +RA   +      I L+              D  + ++ A+FN     
Sbjct: 81  RYRISTPRWDVYDRAAQPYWEFPKGIHLE------RFNPDLKVDANIHSNYAKFNQNEKI 134

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
             +    +M        + E    +     I S   V IT +  +++A       S    
Sbjct: 135 WELKGKVRMINLQGELFETEHLFWNQNLERIYSDTLVRITKAQGIINALSFESNQSMTRY 194

Query: 196 VFAG 199
            F  
Sbjct: 195 SFRN 198


>gi|330950269|gb|EGH50529.1| hypothetical protein PSYCIT7_02447 [Pseudomonas syringae Cit 7]
          Length = 190

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 9/129 (6%), Positives = 33/129 (25%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + +++ +        +  L    L +          ++ +     +     + +   
Sbjct: 64  QYDMTSDKVE--HVKATDVSLLTTPNLNMYR--GGAFPWHVQSKRGEVSSGGDQVELMDS 119

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 120 VRVERTDEKQRTTIITSSRMTVFPQKEYAETDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 179

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 180 LSNVRGQYE 188


>gi|78485319|ref|YP_391244.1| hypothetical protein Tcr_0975 [Thiomicrospira crunogena XCL-2]
 gi|78363605|gb|ABB41570.1| hypothetical protein; predicted transmembrane protein, DUF1239
           [Thiomicrospira crunogena XCL-2]
          Length = 194

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/199 (12%), Positives = 62/199 (31%), Gaps = 16/199 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFIL--SDYSK 78
            + I         A + ++      S  R ST  ++    L     I K      S    
Sbjct: 2   SKKISV--ILLFVAALVVLTIAFKQSVNRDSTSVQTKPLALTHSWQIFKSTSWQVSKQDP 59

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
           +  +  + ++     + +       ++  +    Q  E     + +     ++ + +++ 
Sbjct: 60  NTKQTVIYSDEVF--YQNETKQSRFKNPYII---QDKETSAYTIKSQQG-QSINDQSVHF 113

Query: 139 SQPFKMKV------KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
           +    +++       +N  L  E    +  + T+ S     IT    ++S    +   +S
Sbjct: 114 NGDVVIQMIEKQTPSENKTLKSEQISYNTLSETLTSKVYTEITEPGLIMSGIGFKANMAS 173

Query: 193 RSAVFAGQVSVVVNPGVLQ 211
               F   V  V  P   +
Sbjct: 174 GKYRFLSDVKTVYQPKKTE 192


>gi|26987691|ref|NP_743116.1| hypothetical protein PP_0955 [Pseudomonas putida KT2440]
 gi|24982377|gb|AAN66580.1|AE016286_4 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 190

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 12/183 (6%), Positives = 36/183 (19%), Gaps = 9/183 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
                    +V     +           +                  +  D   +Y + A
Sbjct: 10  VLLGAIAALLVAIGYWNVSPESFLDKPVTQVDESAIDYYAINAHSVQFLPDGKLQYEMTA 69

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           +R          I  +   +L +          ++ +  A  N     + +    ++   
Sbjct: 70  DR--IEHLKTSEITQVTTPDLHLYR--GTEYPWHVQSTRAEVNPDGTEVELIDKVRIART 125

Query: 148 ----DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   +      +  +     +   V I  +    +    +             V  
Sbjct: 126 DEKQRETIITSSRMTVFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGKMDLLSNVRG 185

Query: 204 VVN 206
              
Sbjct: 186 QYE 188


>gi|329905840|ref|ZP_08274228.1| hypothetical protein IMCC9480_2630 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547480|gb|EGF32296.1| hypothetical protein IMCC9480_2630 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 198

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 59/198 (29%), Gaps = 10/198 (5%)

Query: 20  HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKD 79
                  L      +   ++G F +   +R S  +             +K F     +K+
Sbjct: 5   RSANSFRLGLLIALSVALVLGSFWVLEVMRKSGGTDVQNAPRVAPDYYVKNFTFVKMAKN 64

Query: 80  RV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
           R  +Y++  E            I     +  +    +    M + +  A  N  N  + +
Sbjct: 65  RTARYNISGEVLTHLPMDDSYEIT----KPVIYNLSNNRPPMVMRSERALVNSDNSEVQM 120

Query: 139 SQPFKMK-----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                +            L     +L   +  + +  PV +     +L+       N++R
Sbjct: 121 IDNVDVDRPASGTTQRFHLKSAYLLLLPDDDVMKTDTPVEMLMGTTILNGTGMVANNATR 180

Query: 194 SAVFAGQVSVVVNPGVLQ 211
               A +V  V  P V +
Sbjct: 181 QLNLAHRVHGVFAPAVAR 198


>gi|293394218|ref|ZP_06638518.1| hypothetical protein HMPREF0758_1854 [Serratia odorifera DSM 4582]
 gi|291423196|gb|EFE96425.1| hypothetical protein HMPREF0758_1854 [Serratia odorifera DSM 4582]
          Length = 192

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 61/191 (31%), Gaps = 23/191 (12%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR 80
           K +       IV   +  +            D    EPM  +             Y+   
Sbjct: 5   KLWITIILTVIVLALIGWNMADFD-------DDSTAEPMNTQAPTYQSQHTVTIVYNPAG 57

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              Y LVAE     + +   + +     +T+  + +      + A  A+    +  LY+ 
Sbjct: 58  KLSYKLVAEDV--KYYTTDELSWFTQPVMTLFDENA-VATWSVRADRAKL-TKDRMLYLY 113

Query: 140 QPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++          ++  + A +++    ++S D V +  ++F  +    R    +++A
Sbjct: 114 GHVEVNSLTTTSQLEKIKTDNAQVNLVTQDVSSDDEVTLFGTNFTSNGMKMRGNLRAKTA 173

Query: 196 VFAGQVSVVVN 206
               +V     
Sbjct: 174 ELIDKVKTNYE 184


>gi|167822680|ref|ZP_02454151.1| hypothetical protein Bpseu9_03319 [Burkholderia pseudomallei 9]
 gi|226199500|ref|ZP_03795057.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|225928381|gb|EEH24411.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 204

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/175 (10%), Positives = 44/175 (25%), Gaps = 11/175 (6%)

Query: 41  WFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKG 99
            + L                          F +++  +    +Y L A  A         
Sbjct: 23  TYWLLQATLPPPGEAVVRPKSHTPDYFADNFSVTELDQTGSTQYRLTA--AGLVHYEDDE 80

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----LRLDF 154
              L      +   +     +   A     N     + +    ++          ++ D 
Sbjct: 81  TSDLTRP--ALRAFQPGKPTVTATAKRGAVNGDVSIVDLYDDARILRAAGAGDPPMQADS 138

Query: 155 ETAVLDVKNITINSSDPVIITHSDFVLSAN-FARIENSSRSAVFAGQVSVVVNPG 208
           +   + + +  I +  PV +     + +A    +  N +R     G V   +   
Sbjct: 139 QHFRVLINDDVIETEKPVKLQRGLSIANAAAGMKYNNVTRVIELYGNVRGTIAAS 193


>gi|152986934|ref|YP_001350368.1| hypothetical protein PSPA7_5032 [Pseudomonas aeruginosa PA7]
 gi|150962092|gb|ABR84117.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 190

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/169 (9%), Positives = 44/169 (26%), Gaps = 9/169 (5%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSG 97
           V  +  +  + +     +     +      +K     Y ++    Y + A + +      
Sbjct: 20  VAGYYWNVGLELFNEQPARPGQDNTIDYYAEKAHSLQYQENGSLDYEMTAVKLE--HQKA 77

Query: 98  KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLD 153
             I F+   +L +          ++ +  A        + +    ++   D       L 
Sbjct: 78  TDITFVTTPDLLLFR--GNVQPWHIQSARAEVGPKGKEVELIDDVRVARTDAKGQPSILT 135

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                +        +   V I  ++ V +A   +             V 
Sbjct: 136 TTRLTVFPDKNYAQTEQAVKIDAANGVTTAVGMKAYLKDSRMHLLSNVR 184


>gi|104780312|ref|YP_606810.1| hypothetical protein PSEEN1096 [Pseudomonas entomophila L48]
 gi|95109299|emb|CAK13996.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 190

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 10/182 (5%), Positives = 38/182 (20%), Gaps = 9/182 (4%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAE 88
            F      +      +          ++                  +  D   +Y + A+
Sbjct: 11  LFGVVAALLAAVGYWNVSPESFLEQPTAQVDESAIDYYAINAHSVQFLPDGKLQYEMTAD 70

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK- 147
           + +        +  +   +L +          ++ +  A  N     + +    ++    
Sbjct: 71  KVE--HLKASEVTLVTTPDLHMYR--GTEYPWHVQSKRAEVNPDGTEVELIDDVRVARTD 126

Query: 148 ---DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                  +      +  +     +   V I  +    +    +             V   
Sbjct: 127 EKQRETIITSTRMTVFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGRMDLLSNVRGQ 186

Query: 205 VN 206
             
Sbjct: 187 YE 188


>gi|118594083|ref|ZP_01551430.1| hypothetical protein MB2181_00405 [Methylophilales bacterium
           HTCC2181]
 gi|118439861|gb|EAV46488.1| hypothetical protein MB2181_00405 [Methylophilales bacterium
           HTCC2181]
          Length = 191

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/185 (12%), Positives = 39/185 (21%), Gaps = 11/185 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVA 87
            F     + I G     S       S    +        +K F     + D  VKY+   
Sbjct: 8   IFVLVFILFIAGLSYWLSHEVNKELSDDQKNTSSAADFYLKNFNSKQMTSDGFVKYTFQG 67

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK---- 143
           E             FL                  +   S         + +         
Sbjct: 68  ED--MKNYKHSEKTFLSKP--LFIKFDQNNPISNITGDSGEIINMGQEIIVKNNVVLTRL 123

Query: 144 -MKVKDNLRLDFETAVLDVKNITINSSDPVII-THSDFVLSANFARIENSSRSAVFAGQV 201
             K K  + L      +      + S   V I    +  +     + +    +      V
Sbjct: 124 GTKAKKKMSLYTNQLNIIPSEDIVFSKKAVKIIQEPNIEVDGVGMKYDKKENTLKLLSNV 183

Query: 202 SVVVN 206
            V   
Sbjct: 184 KVHYE 188


>gi|330937989|gb|EGH41772.1| hypothetical protein PSYPI_04818 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 190

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 9/129 (6%), Positives = 32/129 (24%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           +Y + +++ +        +  L    L +          ++ +           + +   
Sbjct: 64  QYDMTSDKVE--HVKATDVSLLTTPNLNMYR--GGAFPWHVQSKRGEVWSDGDQVELMDS 119

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +++  D       +      +  +     +   V I  +  V +A   +          
Sbjct: 120 VRVERTDEKQRTTIITSSRMTVFPQKEYAQTDQDVRIDGAGGVTTAKGMKAYLKDSRMDL 179

Query: 198 AGQVSVVVN 206
              V     
Sbjct: 180 LSNVRGQYE 188


>gi|53718175|ref|YP_107161.1| hypothetical protein BPSL0536 [Burkholderia pseudomallei K96243]
 gi|76812015|ref|YP_332181.1| hypothetical protein BURPS1710b_0768 [Burkholderia pseudomallei
           1710b]
 gi|126439596|ref|YP_001057636.1| hypothetical protein BURPS668_0584 [Burkholderia pseudomallei 668]
 gi|126454475|ref|YP_001064882.1| hypothetical protein BURPS1106A_0600 [Burkholderia pseudomallei
           1106a]
 gi|134279886|ref|ZP_01766598.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|167718033|ref|ZP_02401269.1| hypothetical protein BpseD_03378 [Burkholderia pseudomallei DM98]
 gi|167737048|ref|ZP_02409822.1| hypothetical protein Bpse14_03231 [Burkholderia pseudomallei 14]
 gi|167814157|ref|ZP_02445837.1| hypothetical protein Bpse9_03383 [Burkholderia pseudomallei 91]
 gi|167844254|ref|ZP_02469762.1| hypothetical protein BpseB_03114 [Burkholderia pseudomallei B7210]
 gi|167892764|ref|ZP_02480166.1| hypothetical protein Bpse7_03296 [Burkholderia pseudomallei 7894]
 gi|167901259|ref|ZP_02488464.1| hypothetical protein BpseN_03204 [Burkholderia pseudomallei NCTC
           13177]
 gi|167909476|ref|ZP_02496567.1| hypothetical protein Bpse112_03219 [Burkholderia pseudomallei 112]
 gi|167917505|ref|ZP_02504596.1| hypothetical protein BpseBC_03066 [Burkholderia pseudomallei
           BCC215]
 gi|217420122|ref|ZP_03451628.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|237810786|ref|YP_002895237.1| hypothetical protein GBP346_A0511 [Burkholderia pseudomallei
           MSHR346]
 gi|242316940|ref|ZP_04815956.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254181852|ref|ZP_04888449.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254187785|ref|ZP_04894297.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196653|ref|ZP_04903077.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254258279|ref|ZP_04949333.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254296097|ref|ZP_04963554.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52208589|emb|CAH34525.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|76581468|gb|ABA50943.1| putative exported protein [Burkholderia pseudomallei 1710b]
 gi|126219089|gb|ABN82595.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126228117|gb|ABN91657.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|134249086|gb|EBA49168.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|157806142|gb|EDO83312.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157935465|gb|EDO91135.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653396|gb|EDS86089.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|184212390|gb|EDU09433.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|217397426|gb|EEC37442.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|237502796|gb|ACQ95114.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
 gi|242140179|gb|EES26581.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254216968|gb|EET06352.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 204

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 44/175 (25%), Gaps = 11/175 (6%)

Query: 41  WFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKG 99
            + L                          F +++  +    +Y L A  A         
Sbjct: 23  TYWLLQATLPPPGEAVVRPKSHTPDYFADNFSVTELDQTGSTQYRLTA--AGLVHYEDDE 80

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----LRLDF 154
              L      +   +     +   A     N     + +    ++          ++ D 
Sbjct: 81  TSDLTRP--ALRAFQPGKPTVTATAKRGAVNGDVSIVDLYDDARILRAAGAGDPPMQADS 138

Query: 155 ETAVLDVKNITINSSDPVIITHSDFVLSAN-FARIENSSRSAVFAGQVSVVVNPG 208
           +   + V +  I +  PV +     + +A    +  N +R     G V   +   
Sbjct: 139 QHFRVLVNDDVIETEKPVKLQRGLSIANAAAGMKYNNVTRVIELYGNVRGTIAAS 193


>gi|83312814|ref|YP_423078.1| organic solvent tolerance protein OstA [Magnetospirillum magneticum
           AMB-1]
 gi|82947655|dbj|BAE52519.1| Organic solvent tolerance protein OstA [Magnetospirillum magneticum
           AMB-1]
          Length = 927

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 16/175 (9%), Positives = 45/175 (25%), Gaps = 22/175 (12%)

Query: 46  SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQD 105
             IR      +         M     I+    +      L                    
Sbjct: 163 PAIRAEVSPAAQAQRSTSRAMQRASVIMRGEDESGDAVGLK-----RPPRVIPR------ 211

Query: 106 FELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT 165
               + T       +++ A    ++   + +      +M       +  +T   ++K   
Sbjct: 212 PLRHLKTTEDGAEPVHMVADQVIYDREFNVVTAKGRVEMMHD-GRTITADTVSYNMKQDV 270

Query: 166 INSSDPVIITHSDFVLS-ANFARIENSSRSAVFAGQV----SVVVNPGVLQKKEN 215
           + +S  V++T     ++ A++  +        F   V      ++        ++
Sbjct: 271 MGASGNVVLTEPSGEVTHADYFELTGD-----FKNGVARDIRTILADNSRLAAQS 320


>gi|254463023|ref|ZP_05076439.1| OstA family protein [Rhodobacterales bacterium HTCC2083]
 gi|206679612|gb|EDZ44099.1| OstA family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 180

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 62/194 (31%), Gaps = 31/194 (15%)

Query: 32  PFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAK 91
           P  +  ++G  L  S+        ++ D  +    I       D         + +ER  
Sbjct: 5   PILSAVVLG--LALSFGGFVHAQDTNTDPAEGGTTIAFGDRKQDTDA---PIDVTSERLA 59

Query: 92  TSFNSG-----------KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
              N+            +  + L    + V  +  + G  +L A      L N       
Sbjct: 60  VDENANTALFTGDVVVIQDTMTLYAPWVKVFYKEDQSGISHLKAKDGVTLLQNEEA---- 115

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                       + ETA  D++   I  +  V++T     ++++   +     +A+  G+
Sbjct: 116 -----------AEGETADYDLEKEIIVMNGDVLVTQKLSAIASDKMTVRLDEGTALMTGR 164

Query: 201 VSVVVNPGVLQKKE 214
           V  ++      KK+
Sbjct: 165 VKSLLRTNTNSKKD 178


>gi|91201156|emb|CAJ74215.1| unknown protein [Candidatus Kuenenia stuttgartiensis]
          Length = 580

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 13/112 (11%), Positives = 41/112 (36%), Gaps = 3/112 (2%)

Query: 99  GIIFLQDFELTVPTQRS---EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFE 155
               + + E+ +        E   + + +     +  ++  Y+S    + +    RL  E
Sbjct: 12  DKYKIIEPEIELMDDEDPGDEAKRVIITSDIGEMDKISNEGYLSDNVVVHLDKETRLYTE 71

Query: 156 TAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
                  N ++++ + V IT +  V++     ++ ++R         + ++ 
Sbjct: 72  NMQYSPGNKSVHTDEFVTITGTGLVITGKGCEVDLANRKMWIIKDAEMEMDG 123


>gi|157372597|ref|YP_001480586.1| hypothetical protein Spro_4364 [Serratia proteamaculans 568]
 gi|157324361|gb|ABV43458.1| protein of unknown function DUF1239 [Serratia proteamaculans 568]
          Length = 192

 Score = 51.3 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 25/199 (12%), Positives = 60/199 (30%), Gaps = 24/199 (12%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSKDR 80
           K       +  V    L  W        +     +      K             Y+   
Sbjct: 3   KTKLWITILLAVIALALIGWNMTDVNDDAMPGPANS-----KDPTYQSQHTVTIVYNPTG 57

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              Y LVAE     +     + +     +T+  + +      + A  A+    +  LY+ 
Sbjct: 58  KLSYKLVAEDV--KYYEADELSWFTQPVMTLFDENA-VATWSVRADRAKL-TKDRMLYLY 113

Query: 140 QPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++          ++  + A +++    + S D V +  ++F  +    R    +++A
Sbjct: 114 GHVEVNSLTTTSQLEKIKTDNAQVNLVTQDVASDDEVTLYGTNFTSNGMKMRGNLRAKTA 173

Query: 196 VFAGQVSVVVNPGVLQKKE 214
               +V        +Q ++
Sbjct: 174 ELIDKVKTNYE---IQNQQ 189


>gi|251793141|ref|YP_003007869.1| hypothetical protein NT05HA_1437 [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534536|gb|ACS97782.1| conserved hypothetical protein [Aggregatibacter aphrophilus NJ8700]
          Length = 194

 Score = 51.3 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 23/194 (11%), Positives = 62/194 (31%), Gaps = 17/194 (8%)

Query: 24  IQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL-DFEPMIMKKFILSDYSKDRVK 82
           I++         + ++ WF   +       +        ++    M   +   +   + +
Sbjct: 3   IRWT-VILSVIALGLLAWFYSLNQEDEGLNALIKKANSPEYIGQKMNTTVY--FPTGKKQ 59

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTV------PTQRSEYGDMYLFAHSARFNLANHTL 136
           Y   +++ +    +  G    Q  ++ +       +  ++     L A  A+    ++ L
Sbjct: 60  YLATSDKVE--HYTSDGHTDFQKPKVRLLDLEIQNSGSTDKESWELSADKAKL-TKDNML 116

Query: 137 YISQPFKMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
           Y+      +         R++ E+AV+++    I S   V +   +F  +          
Sbjct: 117 YLDGNVVAQSLSPLSRLQRIETESAVVNLTTQDIRSDKMVKLNGQNFSSTGLKLTGNLQQ 176

Query: 193 RSAVFAGQVSVVVN 206
           + A    QV     
Sbjct: 177 QVANLKEQVKTHYE 190


>gi|148546237|ref|YP_001266339.1| hypothetical protein Pput_0994 [Pseudomonas putida F1]
 gi|148510295|gb|ABQ77155.1| protein of unknown function DUF1239 [Pseudomonas putida F1]
          Length = 190

 Score = 51.3 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 11/183 (6%), Positives = 36/183 (19%), Gaps = 9/183 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVA 87
                    +V     +           +                  +  D   +Y + A
Sbjct: 10  VLLGAIAALLVAIGYWNVSPESFLDKPVAQVDESAIDYYAINAHSVQFLPDGKLQYEMTA 69

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           +R          +  +   +L +          ++ +  A  N     + +    ++   
Sbjct: 70  DR--IEHLKTSEVTQVTTPDLHLYR--GTEYPWHVQSTRAEVNPDGTEVELIDKVRIART 125

Query: 148 ----DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                   +      +  +     +   V I  +    +    +             V  
Sbjct: 126 DEKQRETIITSSRMTVFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGKMDLLSNVRG 185

Query: 204 VVN 206
              
Sbjct: 186 QYE 188


>gi|261819638|ref|YP_003257744.1| hypothetical protein Pecwa_0284 [Pectobacterium wasabiae WPP163]
 gi|261603651|gb|ACX86137.1| protein of unknown function DUF1239 [Pectobacterium wasabiae
           WPP163]
          Length = 188

 Score = 51.3 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 49/129 (37%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y L++E+A+  + + + + +      T+  ++       + A  A+    +  LY+   
Sbjct: 60  SYRLISEKAE--YFNDEQLSWFTTPVATLFNEQG-IATWSVRADRAKL-TKDKMLYLYGH 115

Query: 142 FKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          R+    A +++    ++S D V +  + F  S    R    +++A  
Sbjct: 116 VEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSSGMKMRGNLRNKTAEL 175

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 176 IEKVKTSYE 184


>gi|254458018|ref|ZP_05071445.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
 gi|207085411|gb|EDZ62696.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
          Length = 158

 Score = 51.3 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 17/160 (10%), Positives = 50/160 (31%), Gaps = 8/160 (5%)

Query: 47  WIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDF 106
           +I     +    + +D     ++ F L + S+D +   +   +A            + + 
Sbjct: 3   FIGFKPMNIKQQEFVDVPLFQLEAFTLHELSQDGLVTLMKGSKAIRYN----DRYKVFNI 58

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITI 166
           +    T  S+     + A +  +   +  + ++       +D L  + + A  + K+   
Sbjct: 59  D---YTDNSKNFIANMRADNGLYRDKDDVIDLTGNVIYNREDGLIFESQEATYNKKSAIA 115

Query: 167 NSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            ++   +I      +       +N       +  V     
Sbjct: 116 KTNKDYVIYRDSNRVVGTSLTYDNRLNRVK-SKNVVAKYQ 154


>gi|126738423|ref|ZP_01754128.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
 gi|126720222|gb|EBA16928.1| hypothetical protein RSK20926_08162 [Roseobacter sp. SK209-2-6]
          Length = 154

 Score = 51.3 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 43/131 (32%), Gaps = 5/131 (3%)

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQ--DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
               + ++    +  +G           +  +     +   +Y    S +       L  
Sbjct: 26  QPVEVTSDALAVNQANGSAEFNGNVVIVQGVMRLSADKVLVIYKTDESGK--RGIERLEA 83

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           +    +    +   + + A   + + TI  +  V++      L++    +  ++ +A  A
Sbjct: 84  TGNVLLVSGPDA-AEAQKADYSIDSGTIVLTGNVLLNQGAGTLTSQRLEVNLTTGTAKMA 142

Query: 199 GQVSVVVNPGV 209
           G+V  ++ P  
Sbjct: 143 GRVKTILAPSS 153


>gi|53724072|ref|YP_104591.1| hypothetical protein BMA3104 [Burkholderia mallei ATCC 23344]
 gi|67643424|ref|ZP_00442170.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|121601425|ref|YP_991425.1| hypothetical protein BMASAVP1_A0073 [Burkholderia mallei SAVP1]
 gi|124384795|ref|YP_001027499.1| hypothetical protein BMA10229_A1517 [Burkholderia mallei NCTC
           10229]
 gi|126448011|ref|YP_001082465.1| hypothetical protein BMA10247_2945 [Burkholderia mallei NCTC 10247]
 gi|167001031|ref|ZP_02266832.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254174863|ref|ZP_04881524.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254201679|ref|ZP_04908043.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254207011|ref|ZP_04913362.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254357490|ref|ZP_04973764.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52427495|gb|AAU48088.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|121230235|gb|ABM52753.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124292815|gb|ABN02084.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126240881|gb|ABO03974.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|147747573|gb|EDK54649.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147752553|gb|EDK59619.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148026554|gb|EDK84639.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|160695908|gb|EDP85878.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|238524776|gb|EEP88207.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|243063102|gb|EES45288.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 204

 Score = 51.3 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 44/175 (25%), Gaps = 11/175 (6%)

Query: 41  WFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKG 99
            + L                          F +++  +    +Y L A  A         
Sbjct: 23  TYWLLQATLPPPGEAVVRPKSHTPDYFADNFSVTELDQTGSTQYRLTA--AGLVHYEDDE 80

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN-----LRLDF 154
              L      +   +     +   A     N     + +    ++          ++ D 
Sbjct: 81  TSNLTRP--ALRAFQPGKPTVTATAKRGAVNGDVSIVDLYDDARILRAAGAGDPPMQADS 138

Query: 155 ETAVLDVKNITINSSDPVIITHSDFVLSAN-FARIENSSRSAVFAGQVSVVVNPG 208
           +   + V +  I +  PV +     + +A    +  N +R     G V   +   
Sbjct: 139 QHFRVLVNDDVIETEKPVKLQRGLSIANAAAGMKYNNVTRVIELYGNVRGTIAAS 193


>gi|226943410|ref|YP_002798483.1| hypothetical protein Avin_12820 [Azotobacter vinelandii DJ]
 gi|226718337|gb|ACO77508.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 192

 Score = 51.3 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/164 (9%), Positives = 40/164 (24%), Gaps = 9/164 (5%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGIIF 102
            +           +          +       Y  +    Y + AE+ +        I  
Sbjct: 27  WNIRPASFMDKTPAATDDSAIDFYVTNAYTLQYQAEGKLHYEMTAEKVE--HLKTSEITL 84

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM-KVKDN---LRLDFETAV 158
           L   +L +          ++ +     + A   + +    ++ +         L      
Sbjct: 85  LTRPDLLLFR--GTPIPWHVRSERGEVSPAGDQVELVDAVRVERTDTQGRPTILTTSRLS 142

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
           +  +     +  PV I  ++ V +A   +             V 
Sbjct: 143 VFPEREYAETQQPVKIEAANGVTTAVGMKAYLDDSRMHLLSSVR 186


>gi|296327903|ref|ZP_06870439.1| S-layer protein [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
 gi|296155037|gb|EFG95818.1| S-layer protein [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
          Length = 901

 Score = 51.3 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 43/132 (32%), Gaps = 5/132 (3%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQ---DFELTVPTQRSEYGDMYLFAHSARFNLA 132
             +   K+   A+            +FL    +  L             + A   +++  
Sbjct: 60  LDEKESKFE-KAKAKIQGMLLSGDNVFLDKDRNLTLDTNILGISPNGWEIKASELKYDKT 118

Query: 133 NHTLYISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              L  ++P   K ++  + +        +    I   D V+I +  F + A+ A   NS
Sbjct: 119 TQELISTKPMYAKNEEKGIEVLANKFKTTISMDNITLEDGVVIKNKLFSILADKANYNNS 178

Query: 192 SRSAVFAGQVSV 203
           S+     G + +
Sbjct: 179 SKIITLEGNIRL 190



 Score = 42.0 bits (97), Expect = 0.051,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 25/96 (26%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L  +  V   
Sbjct: 293 DIINIYGKIK---GGNPVYSVLADKGEYNVNDKKIRIFGNVDITSTKGEKLVLDNVVYSS 349

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
                +     +  T  +  L A +      ++   
Sbjct: 350 ATKEADMYGNKIKYTSPENNLEAEYIHYNTVTKEVT 385



 Score = 38.5 bits (88), Expect = 0.57,   Method: Composition-based stats.
 Identities = 14/98 (14%), Positives = 28/98 (28%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +       G   + A      +    + +++   +K   +             V     +
Sbjct: 785 LTIDDGPKGSTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKEMAD 844

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V I   + V +AN    +  +R     G V V  
Sbjct: 845 VYDKVKIVTKESVTTANEGHYDMVNRKIRAKGNVHVDY 882



 Score = 38.5 bits (88), Expect = 0.64,   Method: Composition-based stats.
 Identities = 11/89 (12%), Positives = 28/89 (31%), Gaps = 1/89 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +Y ++ L   +   N    +L ++   K     +   D      +  +  IN    +
Sbjct: 243 FDLKYDEVGLRGKNIVLNETTQSLKVTDDVKFTY-QDYVFDVSYIEKEPNSDIINIYGKI 301

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQV 201
              +  + + A+      + +     G V
Sbjct: 302 KGGNPVYSVLADKGEYNVNDKKIRIFGNV 330


>gi|229497061|ref|ZP_04390765.1| conserved hypothetical protein [Porphyromonas endodontalis ATCC
           35406]
 gi|229315986|gb|EEN81915.1| conserved hypothetical protein [Porphyromonas endodontalis ATCC
           35406]
          Length = 199

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/174 (10%), Positives = 38/174 (21%), Gaps = 2/174 (1%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA- 87
           +         +           +   K    L     M      +      + +Y +VA 
Sbjct: 15  WVLSVLAFLFLPLLYGCGGDGTTQVVKHEFSLDSIYSMYTDSVDVLISDSGKTQYRMVAL 74

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           E            +F + F         +     +   +A + +            +   
Sbjct: 75  EWYIYEKRERPCWVFPKGFYAE-KFDDKKNKLAQVKCDTAYYYMNEELWNFIGHVLVVNL 133

Query: 148 DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
              R        D     + S D V I      L  +      + +   F   V
Sbjct: 134 SGERFTTRHLYWDKNQGKVFSQDTVRIEGLGRSLMGSHFEASQNFQQYTFYNNV 187


>gi|188532475|ref|YP_001906272.1| hypothetical protein ETA_03180 [Erwinia tasmaniensis Et1/99]
 gi|188027517|emb|CAO95364.1| Possible exported protein YrbK [Erwinia tasmaniensis Et1/99]
          Length = 191

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/193 (11%), Positives = 66/193 (34%), Gaps = 17/193 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSS---WIRISTFSKSSIDLLDFEPMIMKKFILSDYS 77
            +  +++        + ++GW L  +       ++       + D    ++     +   
Sbjct: 2   SKTRRWMTLILAAIAIVLIGWNLTGNDGGQDTATSGENEPTYMSDNSHTLIYSP--TGV- 58

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
              + Y LV+++A   + +   + +  +  LT     ++     + A  A+    +  LY
Sbjct: 59  ---ISYKLVSDKAT--YYATDAVSWFDNPVLT-TYDENKVPSWSVRADKAKL-TNDRMLY 111

Query: 138 ISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
           +    ++          R+  + A +++    + S D V +    F  +    R    ++
Sbjct: 112 LYGHVQVDSLTQDAQLERIKTDNAQVNLTTQDVTSEDRVTLYGRSFNSTGMKMRGNLRNK 171

Query: 194 SAVFAGQVSVVVN 206
           +A    +V     
Sbjct: 172 TAELIEKVKTSYE 184


>gi|292486807|ref|YP_003529677.1| LPS export porin complex, LptC subunit [Erwinia amylovora CFBP1430]
 gi|292900795|ref|YP_003540164.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291200643|emb|CBJ47775.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291552224|emb|CBA19261.1| LPS export porin complex, LptC subunit [Erwinia amylovora CFBP1430]
          Length = 189

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 56/184 (30%), Gaps = 9/184 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLV 86
           + +       I    +  +         +          +        YS      Y LV
Sbjct: 5   RRWITLILAVIAIVLIGWNLTDSDNGKGAVTSNDTEPTYMSDNSRTLVYSPTGSISYKLV 64

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +++A   + +   + +  +  +T     S+     + A  AR    +  LY+    ++  
Sbjct: 65  SDKAT--YYATDAVSWFDNPVMT-TYDDSKAASWTVRADKARL-TNDRMLYLYGHVQVDS 120

Query: 147 KDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                   R+  + A +++    + S D V +    F  +    R    +++A    +V 
Sbjct: 121 LTQDAQLERIKTDNAQVNLTTQDVTSEDRVNLYGRSFNSTGMKMRGNLRNKTAELIEKVK 180

Query: 203 VVVN 206
               
Sbjct: 181 TSYE 184


>gi|259907014|ref|YP_002647370.1| hypothetical protein EpC_03330 [Erwinia pyrifoliae Ep1/96]
 gi|224962636|emb|CAX54091.1| Possible exported protein YrbK [Erwinia pyrifoliae Ep1/96]
 gi|283476809|emb|CAY72647.1| LPS export porin complex, LptC subunit [Erwinia pyrifoliae DSM
           12163]
          Length = 189

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 57/184 (30%), Gaps = 9/184 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLV 86
           + +      TI    +  +         +          +        YS      Y LV
Sbjct: 5   RRWITLILATIAIVLIGWNLTDSDNSEGAVTSNDTEPTYMSDNSRTLVYSPTGAMSYKLV 64

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +++A   + +   + +  +  +T     ++     + A  AR    +  LY+    ++  
Sbjct: 65  SDKAT--YYATDAVSWFDNPVMT-TYDDNKTPSWTVRADKARL-TNDRMLYLYGHVQVDS 120

Query: 147 KDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                   R+  + A +++    + S D V +    F  +    R    +++A    +V 
Sbjct: 121 LTQDAQLERIKTDNAQVNLTTQDVTSEDRVNLYGRSFNSTGMKMRGNLRNKTAELIEKVK 180

Query: 203 VVVN 206
               
Sbjct: 181 TSYE 184


>gi|163742523|ref|ZP_02149909.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
 gi|161384108|gb|EDQ08491.1| hypothetical protein RG210_06539 [Phaeobacter gallaeciensis 2.10]
          Length = 165

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 46/129 (35%), Gaps = 1/129 (0%)

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
               + AE    +   G          +    + S    + ++            L  S 
Sbjct: 37  QPVEVTAETLDVNQADGSARFIGDVVIIQGVMRLSANDVLVIYKQDETGKTGVERLEASG 96

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
              +    +   + + A   + + T+  +  V+++ S   L++N   ++ ++ +A  +G+
Sbjct: 97  NVILVNGPDA-AEADKAEYTIDSGTVVMTGNVLLSQSTGTLTSNRLVVDLTTGTASLSGR 155

Query: 201 VSVVVNPGV 209
           V  ++N G 
Sbjct: 156 VKTILNGGS 164


>gi|251791370|ref|YP_003006091.1| hypothetical protein Dd1591_3812 [Dickeya zeae Ech1591]
 gi|247539991|gb|ACT08612.1| protein of unknown function DUF1239 [Dickeya zeae Ech1591]
          Length = 189

 Score = 50.9 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 47/129 (36%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y LVAE+A+    + + + +      T+           + A  A+    +  LY+   
Sbjct: 60  SYKLVAEKAE--HYNAEQVSWFTQPVATMF-NEQAIATWSVRADRAKL-TKDRMLYLYGH 115

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++    N     R+  + A +++    + S D V +   +F  +    R    S++A  
Sbjct: 116 VEVNSLTNDSQLERIKTDNAQINLVTQDVTSDDEVTLYGVNFTSNGLKMRGNLRSKTAEL 175

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 176 IDKVKSYYE 184


>gi|163738081|ref|ZP_02145497.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
 gi|161388697|gb|EDQ13050.1| hypothetical protein RGBS107_06704 [Phaeobacter gallaeciensis
           BS107]
          Length = 165

 Score = 50.5 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 46/129 (35%), Gaps = 1/129 (0%)

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
               + AE    +   G          +    + S    + ++            L  S 
Sbjct: 37  QPVEVTAETLDVNQADGSARFIGDVVIIQGVMRLSANDVLVIYKQDETGKTGVERLEASG 96

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
              +    +   + + A   + + T+  +  V+++ S   L++N   ++ ++ +A  +G+
Sbjct: 97  NVILVNGPDA-AEADKAEYTIDSGTVVMTGNVLLSQSTGTLTSNRLVVDLTTGTASLSGR 155

Query: 201 VSVVVNPGV 209
           V  ++N G 
Sbjct: 156 VKTILNGGS 164


>gi|312170875|emb|CBX79134.1| LPS export porin complex, LptC subunit [Erwinia amylovora ATCC
           BAA-2158]
          Length = 189

 Score = 50.5 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/184 (12%), Positives = 56/184 (30%), Gaps = 9/184 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLV 86
           + +       I    +  +         +          +        YS      Y LV
Sbjct: 5   RRWITLILAVIAIVLIGWNLTDSDNGKGAVTSNDTEPTYMSDNSRTLVYSPTGAISYKLV 64

Query: 87  AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +++A   + +   + +  +  +T     S+     + A  AR    +  LY+    ++  
Sbjct: 65  SDKAT--YYATDAVSWFDNPVMT-TYDDSKAASWTVRADKARL-TNDRMLYLYGHVQVDS 120

Query: 147 KDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                   R+  + A +++    + S D V +    F  +    R    +++A    +V 
Sbjct: 121 LTQDAQLERIKTDNAQVNLTTQDVTSEDRVNLYGRSFNSTGMKMRGNLRNKTAELIEKVK 180

Query: 203 VVVN 206
               
Sbjct: 181 TSYE 184


>gi|312897534|ref|ZP_07756954.1| OstA-like protein [Megasphaera micronuciformis F0359]
 gi|310621386|gb|EFQ04926.1| OstA-like protein [Megasphaera micronuciformis F0359]
          Length = 242

 Score = 50.5 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 27/86 (31%), Gaps = 2/86 (2%)

Query: 120 MYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDF 179
           + + A   +++             +    N  +   TA+ ++K    +    V +   D 
Sbjct: 33  ISVTADQLQYDGKTQVATAKGNVVIVRD-NATMTGATAMYNLKTAEADLDGGVTVEQPDM 91

Query: 180 VLSANFARIENSSRSAVFAGQVSVVV 205
            ++A      N +      G V  + 
Sbjct: 92  HVTAQKLHSTNKNYVVA-TGDVRGIY 116


>gi|271498865|ref|YP_003331890.1| hypothetical protein Dd586_0288 [Dickeya dadantii Ech586]
 gi|270342420|gb|ACZ75185.1| protein of unknown function DUF1239 [Dickeya dadantii Ech586]
          Length = 189

 Score = 50.5 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 47/129 (36%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y LVAE+A+    + + + +      T+           + A  A+    +  LY+   
Sbjct: 60  SYRLVAEKAE--HYNTEQVSWFTQPVATMF-NEQAIATWSVRADRAKL-TKDRMLYLYGH 115

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++    +     R+  + A +++    + S D V +  + F  +    R    S++A  
Sbjct: 116 VEVTSLTDDSQLKRIKTDNAQINLVTQDVTSDDEVTLYGASFTSNGLKMRGNLRSKTAEL 175

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 176 IDKVKSYYE 184


>gi|254435071|ref|ZP_05048578.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
 gi|207088182|gb|EDZ65454.1| conserved hypothetical protein [Nitrosococcus oceani AFC27]
          Length = 139

 Score = 50.5 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/116 (10%), Positives = 31/116 (26%), Gaps = 8/116 (6%)

Query: 97  GKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV------KDNL 150
               I +   +     Q        + A     N     + +     ++         N+
Sbjct: 21  DNDTIEITAPDAVFYQQ--ATARWKVVAERGLTNSQGDEIDLLGEVIIRQLGADSKTSNM 78

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           ++  +   +  +     +  PV + +S     +  AR+           QV    +
Sbjct: 79  KILTQNVRVKPRIKYAETQQPVTLLNSFGKTHSIGARVYLKDGRIELLSQVRGNYD 134


>gi|332305022|ref|YP_004432873.1| hypothetical protein Glaag_0642 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172351|gb|AEE21605.1| protein of unknown function DUF1239 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 187

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 42/114 (36%), Gaps = 6/114 (5%)

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDF 154
           G    +  + T+  +        + A        ++ + +    +++ +D       +  
Sbjct: 75  GFTLFKQPQYTIFVESQT-TPWQVSAKDGTL-YEDNRIQLENNVEIRNQDEQGFARTIRT 132

Query: 155 ETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           +   +++ + T+ S  PV I    +V+++N  +   +++       V  +  P 
Sbjct: 133 DFIEINLIDKTMESDQPVKIFGQHYVINSNGFKANLTTQQYELLDHVQTIYQPQ 186


>gi|254303690|ref|ZP_04971048.1| hypothetical protein FNP_1349 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323882|gb|EDK89132.1| hypothetical protein FNP_1349 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 901

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 45/132 (34%), Gaps = 5/132 (3%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQ---DFELTVPTQRSEYGDMYLFAHSARFNLA 132
             +   K+   A+            +FL    +  L             + A   ++N  
Sbjct: 60  IDEKESKFE-KAKAKIQGMLLSGDNVFLDKDRNLTLDTNILGISPNGWEIKASELKYNKT 118

Query: 133 NHTLYISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              L  ++P   K ++  + +        +    I   D V+I +  F + A+ A   N+
Sbjct: 119 TQELISTKPMYAKNEEKGVEVLANKFKTTITMDNITLEDGVVIKNKLFSILADKANYNNA 178

Query: 192 SRSAVFAGQVSV 203
           +++ V  G + +
Sbjct: 179 NKTIVLEGNIRL 190



 Score = 43.9 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 9/96 (9%), Positives = 26/96 (27%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L  +  V   
Sbjct: 293 DIINIYGKIK---GGNPVYSILADKGEYNVNDKKIKIFGNVDITSTKGEKLILDNFVYSS 349

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T  D  L A +      ++   
Sbjct: 350 ETKEADMYGNKIKYTSPDNNLEAEYIHYNTVTKEVT 385



 Score = 40.5 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 35/119 (29%), Gaps = 4/119 (3%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRS---EYGDMYLFAHSARFNLANHTLYISQPF 142
            A +     +     ++    E  +        +Y D+ L   +   N    +L ++   
Sbjct: 213 SANKTDKEMSGTFSKVYFNLDERNLYATDGFDLKYDDVGLKGKNIVLNETTQSLKVTDDV 272

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
           K     +   D      +  +  IN    +   +  + + A+      + +     G V
Sbjct: 273 KFTY-QDYVFDVNYIEKEPNSDIINIYGKIKGGNPVYSILADKGEYNVNDKKIKIFGNV 330



 Score = 38.5 bits (88), Expect = 0.68,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 29/98 (29%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +       G+  + A      +    + +++   +K   +             V     +
Sbjct: 785 LTIDDGPKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTREMAD 844

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V I   D V +AN    +  +R     G V V  
Sbjct: 845 VYDRVKIVTKDSVTTANEGHYDIVNRKIRAKGNVHVDY 882


>gi|332531200|ref|ZP_08407113.1| hypothetical protein HGR_14609 [Hylemonella gracilis ATCC 19624]
 gi|332039307|gb|EGI75720.1| hypothetical protein HGR_14609 [Hylemonella gracilis ATCC 19624]
          Length = 229

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/179 (10%), Positives = 58/179 (32%), Gaps = 14/179 (7%)

Query: 40  GWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGK 98
           G + L     + +  +   ++       MK+F +  + ++   K  +  ++      +  
Sbjct: 31  GTYWLMRSSSLFSSPRVEKEVRRDPDYEMKRFSVKTFDQEGRLKSEIYGDQGWHYPYN-- 88

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM----------KVKD 148
            ++ +   ++        Y  +   A  A        + +     +          +   
Sbjct: 89  DMLEISSVQMRSYNIERGYFTV-ATATRAITTSKATEVELIGKAHVLRPAVVDKQGRALP 147

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
           ++    E     ++   + S+ PV++ H +  + A      N  +     G+V  ++ P
Sbjct: 148 SVSFKSEYLHAFLEEERVLSNVPVVLMHGESRIEAQSLNFTNYDQVIELRGRVRGILLP 206


>gi|124268991|ref|YP_001022995.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
 gi|124261766|gb|ABM96760.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
          Length = 233

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 54/201 (26%), Gaps = 21/201 (10%)

Query: 12  LQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLL--DFEPMIMK 69
              ++   H      L++  P   +  +                +             M+
Sbjct: 31  PWTARALDH-----LLRY-LPVLLMGALAALSWWLVKNTPVPGDTKAAQALRHEPDYTMR 84

Query: 70  KFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL-FAHSAR 128
            F +  Y+      S +       +      I ++   L       E G + L  A  A 
Sbjct: 85  GFSVVSYTPSGALRSRLEGDVMQHYP-DTDTIEVEGVRLR---AVDETGRVTLGSAQRAL 140

Query: 129 FNLANHTLYISQPFKMKVKDN--------LRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            N     + ++   ++  +          L +  E   L  +   + S  PV +      
Sbjct: 141 SNGDATQVRLTGGARVIREPGPGEGPSARLEIRGEFLELFTETERVRSHLPVTLFTGRGE 200

Query: 181 LSANFARIENSSRSAVFAGQV 201
           + A      +  R    +G+V
Sbjct: 201 MRAGSLDYSHLDRIGQLSGRV 221


>gi|109896893|ref|YP_660148.1| hypothetical protein Patl_0565 [Pseudoalteromonas atlantica T6c]
 gi|109699174|gb|ABG39094.1| protein of unknown function DUF1239 [Pseudoalteromonas atlantica
           T6c]
          Length = 187

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/98 (12%), Positives = 38/98 (38%), Gaps = 5/98 (5%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSD 170
           S+     + A        ++ + +    +++ +D       +  +   +++ + T+ S  
Sbjct: 90  SQTAPWQVSAKDGTL-YEDNRIQLENNVEIRNQDEQGFARSIRTDFIEINLIDKTMVSDQ 148

Query: 171 PVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           PV I    +V+++N  +   +++       V  +  P 
Sbjct: 149 PVKIFGQHYVINSNGFKANLTTQQYELLDHVQTIYQPQ 186


>gi|237741669|ref|ZP_04572150.1| S-layer protein [Fusobacterium sp. 4_1_13]
 gi|294785720|ref|ZP_06751008.1| S-layer protein [Fusobacterium sp. 3_1_27]
 gi|229429317|gb|EEO39529.1| S-layer protein [Fusobacterium sp. 4_1_13]
 gi|294487434|gb|EFG34796.1| S-layer protein [Fusobacterium sp. 3_1_27]
          Length = 901

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/190 (11%), Positives = 53/190 (27%), Gaps = 17/190 (8%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS--------DYSKD 79
           K     A   I       ++            +++    + +                + 
Sbjct: 4   KKIIYIALGVIAVVLGYFNYFGSDKEVGDIKKIIETVNAVYESDDYHVEAEKEIDYIDEK 63

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMY-----LFAHSARFNLANH 134
             K+   A+            +FL   +       +    +      + A   +FN    
Sbjct: 64  ESKFE-KAKATIQGMILSGDNVFLD--KARNLALDTNIIGISPNGWKINASELKFNRETQ 120

Query: 135 TLYISQPFK-MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
            L  ++P   +  +  + +        +    I   D V+I +  F + A+ A   +S++
Sbjct: 121 ELISTKPMYAINEEKGVEILGNKFKTTISMDNITLEDGVVIKNKLFSILADKANYNSSTK 180

Query: 194 SAVFAGQVSV 203
                G + +
Sbjct: 181 IITLEGNIRL 190



 Score = 42.4 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 28/96 (29%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +    + +L+ +  V   
Sbjct: 293 DIINIYGQIK---GGNPVYSVLADKGEYNVNDKKIRIFGNVDITSTKDEKLNLDNFVYSS 349

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T  +  L A +      ++   
Sbjct: 350 ETKEADMYGNKIKYTSPENNLEAEYIHYNTVTKEVT 385



 Score = 40.1 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 30/98 (30%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 785 LTIDDGEKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 844

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V I   D V +AN    +  +R     G V V  
Sbjct: 845 VYDRVKIVTKDSVTTANEGHYDMVNRKIRAKGNVHVDY 882



 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/89 (12%), Positives = 28/89 (31%), Gaps = 1/89 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +Y ++ L   +   N    +L ++   K     +   D      +  +  IN    +
Sbjct: 243 FDLKYDEVGLKGKNIVLNETTQSLKVTDDVKFTY-QDYVFDVSYIEKEPNSDIINIYGQI 301

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQV 201
              +  + + A+      + +     G V
Sbjct: 302 KGGNPVYSVLADKGEYNVNDKKIRIFGNV 330


>gi|227821474|ref|YP_002825444.1| putative organic solvent tolerance protein OstA [Sinorhizobium
           fredii NGR234]
 gi|227340473|gb|ACP24691.1| putative organic solvent tolerance protein OstA [Sinorhizobium
           fredii NGR234]
          Length = 782

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 7/78 (8%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + L A+   +N     + +    +++     ++       + K+  I ++  V +   
Sbjct: 53  AKLLLTANELVYNRDTEIVTVRGNVQIEY-GGYKMVARQVDYNQKSGRILATGEVQLIEP 111

Query: 178 DFVLS-ANFARIENSSRS 194
              +  A+   + +   +
Sbjct: 112 GGNVVYADKMDVTDDFGN 129



 Score = 35.5 bits (80), Expect = 5.8,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 20/62 (32%), Gaps = 1/62 (1%)

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
              L L     V +     +     V I +  + + A        S   +  G+V + + 
Sbjct: 52  DAKLLLTANELVYNRDTEIVTVRGNVQIEYGGYKMVARQVDYNQKSGRILATGEVQL-IE 110

Query: 207 PG 208
           PG
Sbjct: 111 PG 112


>gi|123966180|ref|YP_001011261.1| SMC domain-containing protein [Prochlorococcus marinus str. MIT
           9515]
 gi|123200546|gb|ABM72154.1| possible SMC domain N terminal domain [Prochlorococcus marinus str.
           MIT 9515]
          Length = 208

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/176 (14%), Positives = 60/176 (34%), Gaps = 12/176 (6%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN 95
           + ++   ++          K +   ++   M +       +S +  K  L  E   + ++
Sbjct: 7   LFLITTIIIGGCKTRDIEDKITNQSINSLNMNI-------FSNEGNKL-LSIESPYSRYD 58

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLD 153
             K  + L +  + +        +  + +  ++ +  N  L +S    +K   K   +L 
Sbjct: 59  REKNTLNLNETTINLFQNNE--SEYIINSDKSKLSNNNTLLELSGNVSVKTLLKQEDKLY 116

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGV 209
             +   D+KN        V+  +    LS+N A +   ++   F   V    N   
Sbjct: 117 SNSFKWDIKNSEFLLIGNVLFQNDSITLSSNKAILNKKNKIIEFYNPVKYKFNNSN 172


>gi|153869738|ref|ZP_01999272.1| protein containing DUF1239 [Beggiatoa sp. PS]
 gi|152073794|gb|EDN70726.1| protein containing DUF1239 [Beggiatoa sp. PS]
          Length = 185

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/182 (10%), Positives = 51/182 (28%), Gaps = 13/182 (7%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAE 88
           +F    + I   +L+ S       S+     +      +  F  +   +    K  L A+
Sbjct: 8   WFILIVLAIATTWLVQSLEEDLLVSEDMASHV--ADYTLNDFESTSMDEHGQLKNRLTAK 65

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                 N+      L   ++       +     + A +   +   + +++     ++   
Sbjct: 66  TMTHYPNANAN---LTAPDMVFYK--EKRPIWTVRAENGEVSPDGNQIWLLGNTILQRHP 120

Query: 149 NL-----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
                  ++      + V      ++ P  I H++    +   RI   +        V  
Sbjct: 121 ETQQQPLKMISRDVFVQVNTEYAETAAPSTIYHNNGETKSVGMRIFMPTEQIELLSTVRG 180

Query: 204 VV 205
             
Sbjct: 181 HY 182


>gi|255262551|ref|ZP_05341893.1| lipopolysaccharide transport periplasmic protein LptA
           [Thalassiobium sp. R2A62]
 gi|255104886|gb|EET47560.1| lipopolysaccharide transport periplasmic protein LptA
           [Thalassiobium sp. R2A62]
          Length = 161

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 47/132 (35%), Gaps = 14/132 (10%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT-----L 136
              + A+      +SG+ +                 GD+ L A + +   ++       L
Sbjct: 37  PVEISADNLNIDQDSGRAVFSGNVVIGQ--------GDLRLAAGTVQVTYSDEQGKISAL 88

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             S       +   + +  +AV D+    +  S  V++T     L+A+   I  S+ +A 
Sbjct: 89  NASGGVTFVTESE-QAEAASAVYDLDGEQLTLSGNVLLTQGASALTADKMTINLSTGNAR 147

Query: 197 FAGQVSVVVNPG 208
             G+V  V   G
Sbjct: 148 MEGRVRTVFEQG 159


>gi|190891134|ref|YP_001977676.1| organic solvent tolerance protein [Rhizobium etli CIAT 652]
 gi|190696413|gb|ACE90498.1| organic solvent tolerance protein [Rhizobium etli CIAT 652]
          Length = 776

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 9/91 (9%), Positives = 29/91 (31%), Gaps = 2/91 (2%)

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
               E  +  +  E   + L A+   +N     +      ++      ++  +    + K
Sbjct: 36  ASTPEQNIQNKIPEGAKLLLSANELVYNRDADLVSAVGGVQINY-GGYKMVAQKVEYNQK 94

Query: 163 NITINSSDPVIITHSDFV-LSANFARIENSS 192
              + +   V +   D   + A+   + ++ 
Sbjct: 95  TGRMMAIGNVEMVSPDGNRIYADNLDVTDNF 125


>gi|110677769|ref|YP_680776.1| hypothetical protein RD1_0370 [Roseobacter denitrificans OCh 114]
 gi|109453885|gb|ABG30090.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 163

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/134 (14%), Positives = 46/134 (34%), Gaps = 8/134 (5%)

Query: 77  SKDRVKYSLVAERAKTSFNSGKGII--FLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
               +   + A+      N+G  +    +   +  +         +Y     A       
Sbjct: 34  DNSGLPVEVTADSLAVDQNAGTALFTDNVIVIQGEMRLSADNVLVVYDTTAQAI-----D 88

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
            +  +    +    +   + E A  +V + TI  S  V++      +SA+   ++ S  +
Sbjct: 89  RIEATGNVVLISGQDA-AESERADYNVDDGTIVMSGSVLVAQGPSAISADTMTVQISDGT 147

Query: 195 AVFAGQVSVVVNPG 208
           A  +G+V  V+  G
Sbjct: 148 AQMSGRVKTVLQTG 161


>gi|294783333|ref|ZP_06748657.1| S-layer protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480211|gb|EFG27988.1| S-layer protein [Fusobacterium sp. 1_1_41FAA]
          Length = 903

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/188 (11%), Positives = 54/188 (28%), Gaps = 13/188 (6%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS--------DYSKD 79
           K         +       ++      +     L++    + +   L            + 
Sbjct: 4   KKIAYIGAGIVALVLGYFNYFGSDKETGDIRKLIETINAVYENDDLRIEAEKEIDYIDEK 63

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQ---DFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
             K+   A+             FL    +  L             + A   ++N     L
Sbjct: 64  ESKFE-KAKAFIQGMLLSGDNAFLDKDRNLTLDSNILGKSANGWEIKASQLKYNKETQVL 122

Query: 137 YISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
             ++P   K ++  + +        +    I   D V+I +  F + A+ A   N +++ 
Sbjct: 123 ESTKPMYAKNEEKGIEVLGNKFKTTISMDNITLEDGVVIKNKLFSIVADKANYNNEAKTI 182

Query: 196 VFAGQVSV 203
              G +++
Sbjct: 183 TLEGNIAL 190



 Score = 40.5 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/99 (14%), Positives = 30/99 (30%), Gaps = 2/99 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +       G+  + A      +    + +++   +K   +    +        V     +
Sbjct: 784 LTIDDGPKGNTLVKADDVTGYIDQELIKLNKNVYVKNVNEKKEEVVLTADRGAVTKKMAD 843

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             D V +   D V +AN    +  +R     G V V   
Sbjct: 844 VYDRVKVVTKDSVTTANEGHYDMENRKIRAKGNVHVEYQ 882



 Score = 40.5 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 10/93 (10%), Positives = 26/93 (27%), Gaps = 4/93 (4%)

Query: 105 DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNI 164
           +    +        +  + A  A +N+ +    I     +       L  +T V      
Sbjct: 295 NVYGQIK---GGNPEYSVLADKAEYNINDKKFKILGNVVVTSTKGENLKADTFVYSSVTK 351

Query: 165 TINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
             +     ++ T     L A +    + ++   
Sbjct: 352 EADIYGNKILYTSPTNNLEAEYIHYNSETKEVT 384



 Score = 39.7 bits (91), Expect = 0.26,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 32/92 (34%), Gaps = 1/92 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +YG++ L       N  + +  ++   K     +   D      +  + TIN    +
Sbjct: 242 FDMKYGEVGLKGRDIVLNETDQSFKVTGDVKFTY-QDYVFDVNYIEKEANSDTINVYGQI 300

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              + ++ + A+ A    + +     G V V 
Sbjct: 301 KGGNPEYSVLADKAEYNINDKKFKILGNVVVT 332


>gi|254281579|ref|ZP_04956547.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
 gi|219677782|gb|EED34131.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
          Length = 179

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/188 (9%), Positives = 51/188 (27%), Gaps = 19/188 (10%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK-----DRVK 82
           K F   + + I    +  +        +   + ++       +       +     D   
Sbjct: 3   KRFSTLSAI-IGIGLIWLTIESTEITWEKQPEPVNPP----TESYFEGLDQWRFGVDGTP 57

Query: 83  YSLVAERAKTSFNSGK--GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
                ++   +  S      +  +          ++     + A      + +  L +  
Sbjct: 58  ----EQQVVITSGSRPVGRPVRFKGLS--FLGSDNKGRYWDIRAGRGVHKIIDDELRLFD 111

Query: 141 PFKMK-VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
             +++       L     +L+  N    ++ PV +     V +A    I+    +A F  
Sbjct: 112 GVEIRVPGGGAVLTTPKLMLEPGNQKAYNNSPVELVTETSVTTARGLEIDLYETTAKFLA 171

Query: 200 QVSVVVNP 207
            V  +   
Sbjct: 172 NVETIYEG 179


>gi|257465176|ref|ZP_05629547.1| hypothetical protein AM202_01605 [Actinobacillus minor 202]
 gi|257450836|gb|EEV24879.1| hypothetical protein AM202_01605 [Actinobacillus minor 202]
          Length = 206

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/197 (10%), Positives = 54/197 (27%), Gaps = 19/197 (9%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSL 85
            L F   F    + GW++       +   +                  +        + +
Sbjct: 4   RLNFILLFIAAVLGGWYISQQEPENAALGQLIKKDGT--------PDYTGNRMSTSVFDI 55

Query: 86  V------AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
                  AE  +             +  + +  + +      L A  A        L + 
Sbjct: 56  QGKPQYYAEADEIKHYENSERTEFFNPFVNLFDKVTALKQWKLSADHAEI-TKEKILNLV 114

Query: 140 QPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              K++         +++ +  ++D+    I++   V  T   F  +    +     + A
Sbjct: 115 GNVKLQALDPTSRLQKIETDKLMVDLNTQDISTESVVKSTGLGFTTTGTGLKGNLKQQVA 174

Query: 196 VFAGQVSVVVNPGVLQK 212
                V   + P V+++
Sbjct: 175 TLLKDVKSYIEPTVIKE 191


>gi|237730119|ref|ZP_04560600.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908725|gb|EEH94643.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 191

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L       ++   +       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAVLVMIGINLADKDDTTQVVVNNNEPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYHLIAQHVE--YYSEQAVSWFTQPVLTTFDKD-KVPTWTIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSDDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|300718610|ref|YP_003743413.1| hypothetical protein EbC_40350 [Erwinia billingiae Eb661]
 gi|299064446|emb|CAX61566.1| Conserved hypothetical protein [Erwinia billingiae Eb661]
          Length = 191

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 54/150 (36%), Gaps = 16/150 (10%)

Query: 69  KKFILSDYSKD--------RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
           +    +  S +         + Y LV+++    + S + + + ++  +T     ++    
Sbjct: 39  QNPTYTSQSSNTVVYNPQGGLNYKLVSDKVT--YFSTEAVSWFENPVMT-TYDENKIPTW 95

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITH 176
            + A  A+    +  LY+    ++          R+  + A++++    + S D V +  
Sbjct: 96  SIRADKAKL-TNDRMLYLYGHVEVNSLTQDAQLERIKTDNAIVNLVTQDVTSDDQVTLYG 154

Query: 177 SDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           S F  +    R     ++A    +V     
Sbjct: 155 SSFNSTGMKMRGNLRKKTAELIEKVKTSYE 184


>gi|320538916|ref|ZP_08038592.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320031076|gb|EFW13079.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 192

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 48/129 (37%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            + LVAE     + +   + +     +T+  + +      + A  A+    N  LY+   
Sbjct: 60  SFKLVAEDV--KYYTTGELSWFTQPVMTLFDKDA-LATWSVRADRAKL-TKNRILYLYGH 115

Query: 142 FKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          ++  + A +D+    ++S + V +  ++F  +    R    +++A  
Sbjct: 116 VEVDSLTATSQLEKIKTDNAQVDLITQDVSSDEEVTLYGTNFTSNGMKMRGNLRAKTAEL 175

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 176 IDKVKTNYE 184


>gi|126732865|ref|ZP_01748656.1| hypothetical protein SSE37_18342 [Sagittula stellata E-37]
 gi|126706641|gb|EBA05715.1| hypothetical protein SSE37_18342 [Sagittula stellata E-37]
          Length = 164

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/134 (10%), Positives = 44/134 (32%), Gaps = 4/134 (2%)

Query: 75  DYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
                     + A+    +   G  +       +    + +    + +++ +        
Sbjct: 29  GGQDTSAPVEVTADSLSVNQADGTALYSGNVVIVQGEMRLAAPRVLVIYSDT---RSEIT 85

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
            +  +    M   +    + E A  ++ +  I  S  V++T  +  +++    +     +
Sbjct: 86  RMEATGGVVMVRGEEA-AEGERADYNIDDGQIVLSGNVLVTQGESAMTSERMVVNLDDGT 144

Query: 195 AVFAGQVSVVVNPG 208
           A  +G+V  V+  G
Sbjct: 145 AQMSGRVKTVLQQG 158


>gi|254486869|ref|ZP_05100074.1| lipopolysaccharide transport periplasmic protein LptA [Roseobacter
           sp. GAI101]
 gi|214043738|gb|EEB84376.1| lipopolysaccharide transport periplasmic protein LptA [Roseobacter
           sp. GAI101]
          Length = 164

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 42/132 (31%), Gaps = 14/132 (10%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH-----TL 136
              + A+       +G  I                 G+M L A                L
Sbjct: 39  PVEVTADNLSVDQATGTAIFTGNVVIGQ--------GEMRLSAARVLVVYRADAEGIARL 90

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             +    +    +   + + A  D+ + TI  +  V++      LS++   +  S  +A 
Sbjct: 91  EATGGVTLVSGADA-AESQRADYDIDSGTIVMTGNVLLAQGRNALSSDKMSVNLSDGTAQ 149

Query: 197 FAGQVSVVVNPG 208
            +G+V   + PG
Sbjct: 150 MSGRVKTTLQPG 161


>gi|150395987|ref|YP_001326454.1| organic solvent tolerance protein [Sinorhizobium medicae WSM419]
 gi|150027502|gb|ABR59619.1| Organic solvent tolerance protein [Sinorhizobium medicae WSM419]
          Length = 781

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 7/78 (8%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + L A+   +N     + +    +++     ++       D K+  I ++  + +   
Sbjct: 53  AKLLLTANELVYNRDTEKVTVRGNVQIEY-GGYKMVARQVDYDQKSGRILATGDIQLIEP 111

Query: 178 DFVLS-ANFARIENSSRS 194
              +  A+   + +   +
Sbjct: 112 GGNIVYADRMDVTDDFGN 129


>gi|307317710|ref|ZP_07597148.1| Organic solvent tolerance protein [Sinorhizobium meliloti AK83]
 gi|306896472|gb|EFN27220.1| Organic solvent tolerance protein [Sinorhizobium meliloti AK83]
          Length = 781

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 7/78 (8%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + L A+   +N     + +    +++     ++       D K+  I ++  + +   
Sbjct: 53  AKLLLTANELVYNRDTEKVTVRGNVQIEY-GGYKMVARQVDYDQKSGRILATGDIQLIEP 111

Query: 178 DFVLS-ANFARIENSSRS 194
              +  A+   + +   +
Sbjct: 112 GGNIVYADRMDVTDDFGN 129


>gi|300023219|ref|YP_003755830.1| organic solvent tolerance protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525040|gb|ADJ23509.1| Organic solvent tolerance protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 825

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 35/109 (32%), Gaps = 6/109 (5%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            AE A    ++             V TQ  +   M L      ++ A + +      ++ 
Sbjct: 46  SAEAASKQPSTFGK----ASIFGKVNTQVDKTQPMRLQGDQLIYDKAGNRVIARGNVEIY 101

Query: 146 VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV-LSANFARIENSSR 193
             DN  L  +  V D    T+ +   V +       + A+   + +  R
Sbjct: 102 YNDN-ILTADEVVYDQGGGTLTAVGNVTLKEPQGNVIRADRYTLTDDFR 149



 Score = 39.7 bits (91), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/171 (8%), Positives = 38/171 (22%), Gaps = 13/171 (7%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS----KDRVKYSLVAER 89
           A         +      +     S +    +P    K  +               L  ++
Sbjct: 23  AAGFARALSCVLGAALFTIHFGGSAEAASKQPSTFGKASIFGKVNTQVDKTQPMRLQGDQ 82

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
                   + I       + +    +      L A    ++    TL       +K    
Sbjct: 83  LIYDKAGNRVIARG---NVEIYYNDNI-----LTADEVVYDQGGGTLTAVGNVTLKEPQG 134

Query: 150 LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
             +  +   L             +++     ++A+ A +        F   
Sbjct: 135 NVIRADRYTLTDDFRDGFVQSLSVVSQDQSTITADRA-VRRGGNVNEFENG 184



 Score = 35.8 bits (81), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/64 (15%), Positives = 26/64 (40%)

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
             ++     +RL  +  + D     + +   V I ++D +L+A+    +    +    G 
Sbjct: 67  NTQVDKTQPMRLQGDQLIYDKAGNRVIARGNVEIYYNDNILTADEVVYDQGGGTLTAVGN 126

Query: 201 VSVV 204
           V++ 
Sbjct: 127 VTLK 130


>gi|15964905|ref|NP_385258.1| hypothetical protein SMc00582 [Sinorhizobium meliloti 1021]
 gi|15074084|emb|CAC45731.1| Hypothetical protein SMc00582 [Sinorhizobium meliloti 1021]
          Length = 781

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 7/78 (8%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + L A+   +N     + +    +++     ++       D K+  I ++  + +   
Sbjct: 53  AKLLLTANELVYNRDTEKVTVRGNVQIEY-GGYKMVARQVDYDQKSGRILATGDIQLIEP 111

Query: 178 DFVLS-ANFARIENSSRS 194
              +  A+   + +   +
Sbjct: 112 GGNIVYADRMDVTDDFGN 129


>gi|307300975|ref|ZP_07580744.1| Organic solvent tolerance protein [Sinorhizobium meliloti BL225C]
 gi|306903930|gb|EFN34516.1| Organic solvent tolerance protein [Sinorhizobium meliloti BL225C]
          Length = 781

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 7/78 (8%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + L A+   +N     + +    +++     ++       D K+  I ++  + +   
Sbjct: 53  AKLLLTANELVYNRDTEKVTVRGNVQIEY-GGYKMVARQVDYDQKSGRILATGDIQLIEP 111

Query: 178 DFVLS-ANFARIENSSRS 194
              +  A+   + +   +
Sbjct: 112 GGNIVYADRMDVTDDFGN 129


>gi|329118333|ref|ZP_08247042.1| hypothetical protein HMPREF9123_0470 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465557|gb|EGF11833.1| hypothetical protein HMPREF9123_0470 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 193

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 55/174 (31%), Gaps = 12/174 (6%)

Query: 43  LLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY-SLVAERAKTSFNSGKGII 101
                I   T  +++++  +     M+    S + +       L AE A     S +  +
Sbjct: 24  AWLDRISTVTVEEAALNPNE-PQYAMEGISGSRFDRQGALQDRLDAEAAWQFPQSKE--V 80

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL-----RLDFET 156
             +   L V  Q  +   +   +  AR++  +  +   +   +  +        RL  ++
Sbjct: 81  VFRRPLLQVYAQGEKAYQV--GSEEARYDTGSRKILFEKQVVLDKEAAAGKPAGRLATDS 138

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS-VVVNPGV 209
             +D  + T  +   V   +     +A     + +        +V   V  P  
Sbjct: 139 LSVDTVSKTAAAPGFVRFDYGQSHGTAEGMTYDYNQGLLRLPSRVKATVYEPKN 192


>gi|284049009|ref|YP_003399348.1| OstA family protein [Acidaminococcus fermentans DSM 20731]
 gi|283953230|gb|ADB48033.1| OstA family protein [Acidaminococcus fermentans DSM 20731]
          Length = 285

 Score = 48.6 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/98 (11%), Positives = 29/98 (29%), Gaps = 1/98 (1%)

Query: 117 YGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITH 176
           +    +     +++  +         K++  D      E A  + K      +  V+   
Sbjct: 24  WAASSISGDQVQYDFKSGQAAAVGNVKIRHDDG-TASAEEADYNTKTGEGKLTGSVVADQ 82

Query: 177 SDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
            D  L+++   I    +     G   +      L+  +
Sbjct: 83  KDAHLTSSELIIRKKGKFLSAIGNAVLRKADKTLRAAQ 120



 Score = 43.9 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 44/142 (30%), Gaps = 12/142 (8%)

Query: 80  RVKYSLVAER----AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
                  A++    A+  ++S             +           + + + ++N+    
Sbjct: 105 GNAVLRKADKTLRAAQVDYDSDAQFAETIGSWAQLTMDDGS----SIDSANMKYNMGTGV 160

Query: 136 LYISQPFKMKVKD-NLRLDFETAVLDVK--NITINSSDPVIITHSDFVLSANFARIENSS 192
                  ++     NL    + A+ + K  + TI        T +D  +S +   I  + 
Sbjct: 161 ANADGNVRLISPPRNLTARADRAIYNTKEADGTIRLIGHATATQNDDTVSGDTLTITGAG 220

Query: 193 RSAVF-AGQVSVVVNPGVLQKK 213
                  G V +VV P   Q +
Sbjct: 221 GKVAMGEGNVKMVVLPQSTQPQ 242



 Score = 36.2 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 39/132 (29%), Gaps = 11/132 (8%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            AE A  +  +G+G +             ++  D +L +           L       ++
Sbjct: 59  SAEEADYNTKTGEGKLTGSVV--------ADQKDAHLTSSELIIRKKGKFLSAIGNAVLR 110

Query: 146 VKDNLRLDFETAVLDVKNITINSSD-PVIITHSDFV-LSANFARIENSSRSAVFAGQVSV 203
            K +  L       D       +      +T  D   + +   +    +  A   G V +
Sbjct: 111 -KADKTLRAAQVDYDSDAQFAETIGSWAQLTMDDGSSIDSANMKYNMGTGVANADGNVRL 169

Query: 204 VVNPGVLQKKEN 215
           +  P  L  + +
Sbjct: 170 ISPPRNLTARAD 181


>gi|170723421|ref|YP_001751109.1| hypothetical protein PputW619_4260 [Pseudomonas putida W619]
 gi|169761424|gb|ACA74740.1| protein of unknown function DUF1239 [Pseudomonas putida W619]
          Length = 190

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 9/182 (4%), Positives = 36/182 (19%), Gaps = 9/182 (4%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAE 88
                   +      +           +                  +  D   +Y + A+
Sbjct: 11  LLAVIAAMLAAIGYWNVSPESFLDKPVAPVDESAIDYYAINAHSVQFLPDGKLQYEMTAD 70

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK- 147
           + +        +  +   +L +          ++ +  A  N     + +    ++    
Sbjct: 71  KVE--HLKATEVTLVTTPDLHMYR--GTEYPWHIQSVRAEVNPDGTEVELIDKVRVARTD 126

Query: 148 ---DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
                  +      +  +     +   V I  +    +    +             V   
Sbjct: 127 EKQRETIITSSRMTVFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGRMDLLSNVRGQ 186

Query: 205 VN 206
             
Sbjct: 187 YE 188


>gi|309390184|gb|ADO78064.1| OstA family protein [Halanaerobium praevalens DSM 2228]
          Length = 215

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 11/124 (8%), Positives = 31/124 (25%), Gaps = 7/124 (5%)

Query: 89  RAKTSFNSGKGIIFLQDFEL-TVPTQRSEYGDMY----LFA-HSARFNLANHTLYISQPF 142
            A+         + L++     +     +   +Y    + A     +   N  +   +  
Sbjct: 19  SAQAERELTGDQLDLKESSAGQIVVATGQVELIYDQLRITAEDEGIYRRFNGEVEFRKNV 78

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
           +                ++K   ++      I   +  L A+      +       G   
Sbjct: 79  EFFY-QEYEGQAVELTGNLKTEILHLKKDAQIKGPNSYLEADKIDFYQAEDRIEVKGSAY 137

Query: 203 VVVN 206
           +  N
Sbjct: 138 LEYN 141



 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/137 (13%), Positives = 39/137 (28%), Gaps = 15/137 (10%)

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
           +     L         N    I+ L+  +  +    S     YL A    F  A   + +
Sbjct: 86  EGQAVELT-------GNLKTEILHLKK-DAQIKGPNS-----YLEADKIDFYQAEDRIEV 132

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
                ++   +     +     ++   I  +  V    +    +A  A I   +      
Sbjct: 133 KGSAYLEYN-DFWAKADQITYYLEREMIYLTGNVEGERNGESFTAQKAEINQQTEEVQLQ 191

Query: 199 GQVSVVVNPGVLQKKEN 215
           GQ  + + P   Q   +
Sbjct: 192 GQAQITL-PKNEQADSD 207


>gi|241203947|ref|YP_002975043.1| organic solvent tolerance protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857837|gb|ACS55504.1| Organic solvent tolerance protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 776

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 10/91 (10%), Positives = 30/91 (32%), Gaps = 2/91 (2%)

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
               E  + T+  E   + L A+   +N     +      ++      ++  +    + K
Sbjct: 37  ASAPEQNIETKIPEGAKLLLSANELVYNRDADLVSAVGGVQINY-GGYKMVAQKVEYNQK 95

Query: 163 NITINSSDPVIITHSDFV-LSANFARIENSS 192
              + +   V +   D   + A+   + ++ 
Sbjct: 96  TGRMMALGNVELVSPDGNRIYADNLDVTDNF 126


>gi|240949436|ref|ZP_04753777.1| hypothetical protein AM305_10846 [Actinobacillus minor NM305]
 gi|240296185|gb|EER46841.1| hypothetical protein AM305_10846 [Actinobacillus minor NM305]
          Length = 206

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 54/198 (27%), Gaps = 21/198 (10%)

Query: 26  FLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSD-------YSK 78
            L F   F    + GW++            + +  L  +         +        +  
Sbjct: 4   RLNFILLFIAAVLGGWYI-----SQQEPENAELGQLIKKNGT---PDYTGDRMSTSVFDI 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
                   AE  +             +  + +  + +      L A  A        L +
Sbjct: 56  QGKP-QYYAEADEIKHYENSERTEFFNPFVNLFDKVTALKQWKLSADHAEI-TKEKILNL 113

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               K++         +++ +   +D+    I++   V  T   F  +    +     + 
Sbjct: 114 VGNVKLQALDPTSRLQKIETDKLTIDLNTQDISTESVVKSTGLGFTTTGTGLKGNLKQQV 173

Query: 195 AVFAGQVSVVVNPGVLQK 212
           A     V   + P V+++
Sbjct: 174 ATLLKDVKSYIEPTVIKE 191


>gi|254432152|ref|ZP_05045855.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197626605|gb|EDY39164.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 384

 Score = 48.6 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 63/211 (29%), Gaps = 28/211 (13%)

Query: 9   KILLQRSKYR-QH--VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEP 65
           + L + S    ++   R +   +         + G             + + + L D E 
Sbjct: 48  RTLWELSSPETRYDLSRRVAQAR--------DLRGVLYSQGKPLYRFTAANGVVLNDGEV 99

Query: 66  MIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
           + ++        ++      + A R +           ++     V TQ     D+ L +
Sbjct: 100 VQLEGPTRVQRLEEGDKPLVITALRVR----WYPARKLMELDRAPVATQD----DLRLTS 151

Query: 125 HSARFNLANHTLYISQPFKMKVKDNL--RLDFETAVLDVKNITINSSDPVIITH-----S 177
              RF + +  L +     +    +   RL+         +  +    PV          
Sbjct: 152 QRVRFLIGDDRLELQGEPTLVRSGDEPLRLELSRVDWWPGSGALQGRGPVRGQRAVPDRP 211

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
              L+A        +R+    G V VV +PG
Sbjct: 212 AQRLTAPSLTANTRNRTIDLRGPVRVV-DPG 241


>gi|270263244|ref|ZP_06191514.1| possible exported protein [Serratia odorifera 4Rx13]
 gi|270042932|gb|EFA16026.1| possible exported protein [Serratia odorifera 4Rx13]
          Length = 192

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 47/129 (36%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y LVAE     + +   + +     +T+  + +      + A  A+    +  LY+   
Sbjct: 60  SYKLVAEDV--KYYTADELSWFTQPVMTLFDENA-VATWSVRADRAKL-TKDRMLYLYGH 115

Query: 142 FKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          ++  + A +++    + S D V +  ++F  +    R    +++A  
Sbjct: 116 VEVNSLTTTSQLEKIKTDNAQVNLVTQDVASDDEVTLYGTNFTSNGMKMRGNLRAKTAEL 175

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 176 IDKVKTNYE 184


>gi|163733023|ref|ZP_02140467.1| hypothetical protein RLO149_10195 [Roseobacter litoralis Och 149]
 gi|161393558|gb|EDQ17883.1| hypothetical protein RLO149_10195 [Roseobacter litoralis Och 149]
          Length = 163

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/133 (15%), Positives = 46/133 (34%), Gaps = 8/133 (6%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGII--FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
              +   + A+      N+G  +    +   +  +         +Y     A        
Sbjct: 35  NSGLPVEVTADSLAVDQNAGTALFTDNVIVIQGEMRLSADNVLVIYDTTAQAI-----DR 89

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
           +  +    +    +   + E A  +V + TI  S  V++      +SA+   ++ S  +A
Sbjct: 90  IEATGNVVLISGQDA-AESERADYNVDDGTIVMSGSVLVAQGPSAISADTMTVQISDGTA 148

Query: 196 VFAGQVSVVVNPG 208
             +G+V  V+  G
Sbjct: 149 QMSGRVKTVLQTG 161


>gi|307129066|ref|YP_003881082.1| hypothetical protein Dda3937_00685 [Dickeya dadantii 3937]
 gi|306526595|gb|ADM96525.1| conserved protein [Dickeya dadantii 3937]
          Length = 189

 Score = 48.6 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 50/160 (31%), Gaps = 13/160 (8%)

Query: 52  TFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTV 110
                + D        +       Y       Y LVAE+A+    +   + +      T+
Sbjct: 33  PTEVQNNDPAYTMQQNITVV----YDPTGKLSYKLVAEKAE--HYNADQVSWFTQPVATM 86

Query: 111 PTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITI 166
                      + A  A+    +  LY+    ++    N     R+  + A +++    +
Sbjct: 87  F-NEQTVATWSVRADRAKL-TKDRMLYLYGHVEVNSLTNDSQLERIKTDNAQINLVTQDV 144

Query: 167 NSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            S D V +   +F  +    R    S++A    +V     
Sbjct: 145 TSDDEVTLYGVNFTSNGLKMRGNLRSKTAELIDKVKSYYE 184


>gi|317494038|ref|ZP_07952454.1| hypothetical protein HMPREF0864_03223 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917811|gb|EFV39154.1| hypothetical protein HMPREF0864_03223 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 192

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 47/163 (28%), Gaps = 16/163 (9%)

Query: 56  SSIDLLDFEPMIMKKFILSD-------YSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFE 107
            +        +  ++            Y       Y LVAE  +          +     
Sbjct: 26  ENDSDTSQVAVNNQEPTYRSQHTLTVVYDPTGKLSYKLVAEDVQHFSEDKTS--WFTHPV 83

Query: 108 LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK----VKDNLRLDFETAVLDVKN 163
           LT   Q        + A  A+    +  LY+    ++          R+  + A +++  
Sbjct: 84  LTTYDQD-TLPTWSIRADKAKL-TDDRMLYLYGNVEVNSLTTTSQLERITTDNAQVNLVT 141

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             ++S D V +  S+F       R     ++A    +V     
Sbjct: 142 QDVSSDDEVTLYGSNFTSHGLKMRGNMREKTARLIDKVKTYYE 184


>gi|84500655|ref|ZP_00998904.1| hypothetical protein OB2597_11871 [Oceanicola batsensis HTCC2597]
 gi|84391608|gb|EAQ03940.1| hypothetical protein OB2597_11871 [Oceanicola batsensis HTCC2597]
          Length = 162

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

Query: 117 YGDMYLFAHSA--RFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITINSSDPV 172
             +M L A      ++     + + +              + + A  D+   TI     V
Sbjct: 65  QAEMRLAAPRVLVTYDEEGERIRLLEATGGVTLVSGEDAAEAQRADYDIDAGTIVMEGDV 124

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           ++   +  L++    ++  S +A  +G+V  ++NPG
Sbjct: 125 LLVQGESTLASQAMTVDLESGTAQMSGRVRTLLNPG 160


>gi|260886289|ref|ZP_05897552.1| hypothetical protein SELSPUOL_00109 [Selenomonas sputigena ATCC
           35185]
 gi|330839728|ref|YP_004414308.1| protein of unknown function DUF1239 [Selenomonas sputigena ATCC
           35185]
 gi|260864008|gb|EEX78508.1| hypothetical protein SELSPUOL_00109 [Selenomonas sputigena ATCC
           35185]
 gi|329747492|gb|AEC00849.1| protein of unknown function DUF1239 [Selenomonas sputigena ATCC
           35185]
          Length = 186

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/146 (14%), Positives = 48/146 (32%), Gaps = 13/146 (8%)

Query: 73  LSDYS----KDRVK-YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA 127
               +    KD    + L AE  +   +        ++ E     +     ++ L A  A
Sbjct: 42  YEGNTLSLEKDGRTVWQLTAESIEADADGK--AAEARNIEGVFHEEGG--RELKLTAPHA 97

Query: 128 RFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD--FVLSANF 185
            +++ +  L I    +++  D +RL     V   +  T+ +    ++T  +    +SA  
Sbjct: 98  HYDMTSKDLAIDGGVRIETSDGIRLMSREVVWSSEKETLAAVGDALLTQEEEKLRVSAER 157

Query: 186 ARIENSSRSAVFAG--QVSVVVNPGV 209
               +       +G       +  G 
Sbjct: 158 IESSDGFAKFTASGKDGKKARIEKGS 183


>gi|121602732|ref|YP_988821.1| organic solvent tolerance protein [Bartonella bacilliformis KC583]
 gi|120614909|gb|ABM45510.1| organic solvent tolerance protein [Bartonella bacilliformis KC583]
          Length = 791

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 10/95 (10%), Positives = 30/95 (31%), Gaps = 3/95 (3%)

Query: 101 IFLQDFELTVPTQ-RSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVL 159
           +  Q+          +    + L A    +N   +T+      +++     ++  ++   
Sbjct: 33  VRAQNPAPFFHNNTENSKNPLLLSADELIYNHDINTVSAQGNVQIEYD-GNKVTAQSVTY 91

Query: 160 DVKNITINSSDPVIITHSDFV-LSANFARIENSSR 193
           + K   I +   V I   +   + +N   +     
Sbjct: 92  NQKTGRIIAQGNVEIIQKNGNKIYSNQIDMTEDFG 126



 Score = 37.4 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 7/53 (13%), Positives = 20/53 (37%)

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           L  +  + +    T+++   V I +    ++A        +   +  G V ++
Sbjct: 55  LSADELIYNHDINTVSAQGNVQIEYDGNKVTAQSVTYNQKTGRIIAQGNVEII 107



 Score = 35.8 bits (81), Expect = 4.1,   Method: Composition-based stats.
 Identities = 9/145 (6%), Positives = 37/145 (25%), Gaps = 18/145 (12%)

Query: 28  KFFFP-FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKD-RVKYSL 85
           K      + + +         + ++                       + +++ +    L
Sbjct: 4   KIILKKLSILALKSVISFILILSLALSCSVRA--------QNPAPFFHNNTENSKNPLLL 55

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A+     +N     +  Q   + +    ++     + A S  +N     +      ++ 
Sbjct: 56  SADELI--YNHDINTVSAQG-NVQIEYDGNK-----VTAQSVTYNQKTGRIIAQGNVEII 107

Query: 146 VKDNLRLDFETAVLDVKNITINSSD 170
            K+  ++      +         + 
Sbjct: 108 QKNGNKIYSNQIDMTEDFGEGFINS 132


>gi|319779022|ref|YP_004129935.1| hypothetical protein TEQUI_0854 [Taylorella equigenitalis MCE9]
 gi|317109046|gb|ADU91792.1| putative exported protein [Taylorella equigenitalis MCE9]
          Length = 208

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/190 (10%), Positives = 58/190 (30%), Gaps = 10/190 (5%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKY-SLVA 87
             F    + ++  +  S + + S    +++   +        F +    +       L  
Sbjct: 9   LAFGLLILLVIATWWASEYAKKSITVDTAVVKKNKPDAWTGNFKMITSDEKGNAINRLKG 68

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV- 146
            R             + +    +  Q  +       A  A+       + +     +   
Sbjct: 69  TR--IDHFPQGDFYIIDNPN--LIGQNIDTPRTIGTATKAQVLENGDLIILDGNAVVNRP 124

Query: 147 ----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
               + N++++ +   +  K   I +   V++ H + +L     + +N++          
Sbjct: 125 ATDKQPNIKIESDKLEIHTKTGIIETKTEVVVHHGESILKGVGMKFDNNTGLLNVMNNSG 184

Query: 203 VVVNPGVLQK 212
           V ++P  L K
Sbjct: 185 VEISPDDLNK 194


>gi|212711083|ref|ZP_03319211.1| hypothetical protein PROVALCAL_02152 [Providencia alcalifaciens DSM
           30120]
 gi|212686251|gb|EEB45779.1| hypothetical protein PROVALCAL_02152 [Providencia alcalifaciens DSM
           30120]
          Length = 197

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 51/176 (28%), Gaps = 12/176 (6%)

Query: 45  SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFL 103
            S    S    + I+                Y+      Y L A +      +   I + 
Sbjct: 24  FSVYDDSKPLATEINDGKPNYQTDDSVTFV-YNPAGDLAYKLAATKV--DNYTDGKITWF 80

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN----LRLDFETAVL 159
            +  LT     +      + +  AR       LY+    ++          R+  + AV+
Sbjct: 81  TNPVLT-TYNDAGTPTWTVKSIKARL-TKERVLYLYSDVQVDSLTPEPQIQRITTDNAVV 138

Query: 160 DVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN--PGVLQKK 213
           ++    ++S D V I       +    +    +R+A     V       P   Q +
Sbjct: 139 NLVTQDVSSDDKVTIIGHGLNSTGLKMKGNLRTRTAELIEDVKTHYELQPKEQQNE 194


>gi|222085451|ref|YP_002543981.1| organic solvent tolerance protein OstA [Agrobacterium radiobacter
           K84]
 gi|221722899|gb|ACM26055.1| organic solvent tolerance protein OstA [Agrobacterium radiobacter
           K84]
          Length = 780

 Score = 48.2 bits (113), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 8/105 (7%), Positives = 30/105 (28%), Gaps = 9/105 (8%)

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITI 166
              V     +   + L ++   +N  N  +  +   ++      ++  +    + K+  +
Sbjct: 35  TAPVKVNVPDGSKLILSSNELVYNKDNQIVTATGAVQINY-GGYKMVAQKVEYNQKSGRM 93

Query: 167 NSSDPVIITHSDFV-LSANFARIENSSR-------SAVFAGQVSV 203
            +   V +   D   +  +   + +S                  +
Sbjct: 94  TAIGNVELISPDGNRMYGDKMDVTDSFSDGFVNALRIEMPDNTRM 138


>gi|83941913|ref|ZP_00954375.1| hypothetical protein EE36_06753 [Sulfitobacter sp. EE-36]
 gi|83847733|gb|EAP85608.1| hypothetical protein EE36_06753 [Sulfitobacter sp. EE-36]
          Length = 164

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 43/132 (32%), Gaps = 4/132 (3%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
              +   + A+        G  +            + S    + ++   A        L 
Sbjct: 35  DTGLPVEVTADNLSVDQGDGSAVFTGNVLIGQGEMRLSAARVLVVYRAEA---EGIARLE 91

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +    +        + E A  D+   TI  S  V++T     LS++   ++ S  +A  
Sbjct: 92  ATGGVTLV-SGKDAAESERADYDIDTGTIVMSGNVLLTQGRNALSSDTMSVKLSDGTAQM 150

Query: 198 AGQVSVVVNPGV 209
           +G+V  ++  G 
Sbjct: 151 SGRVKTILQTGS 162


>gi|284008688|emb|CBA75345.1| lipopolysaccharide export system protein LptC [Arsenophonus
           nasoniae]
          Length = 196

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 62/200 (31%), Gaps = 14/200 (7%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            +F  +L        + ++GW    +    +     ++             +   Y    
Sbjct: 2   SKFNFWLNIILTLIVLALIGW----NLADFNQSKAPAMIENSQPNYQTANAVTHVYDPMG 57

Query: 81  V-KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              Y L+ +   T   S   I +  +  LT            + A+ A+   +++ LY+ 
Sbjct: 58  KLAYKLITDE--THHFSSSKISWFINPVLT-TYDTKSIPTWAIRANKAKL-TSDNMLYLY 113

Query: 140 QPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              ++       D  ++  E A++++    ++S++ V +            R    + +A
Sbjct: 114 GNVQVNSLNPTSDLQQILTENAIVNLITQDVSSNNKVTLIGIGLRSVGMEMRGNMRTHTA 173

Query: 196 VFAGQVSVVVN-PGVLQKKE 214
                V      P      E
Sbjct: 174 ELIEDVKTYYEIPNKQPAPE 193


>gi|209548669|ref|YP_002280586.1| organic solvent tolerance protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534425|gb|ACI54360.1| Organic solvent tolerance protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 780

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 8/85 (9%), Positives = 27/85 (31%), Gaps = 2/85 (2%)

Query: 109 TVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINS 168
            +     E   + L A+   +N     +      ++      ++  +    + K   + +
Sbjct: 42  DIGKNIPEGAKLLLSANELVYNRDADLVSAVGGVQINYA-GYKMVAQKVEYNQKTGRMMA 100

Query: 169 SDPVIITHSDFV-LSANFARIENSS 192
              V +   D   + A+   + ++ 
Sbjct: 101 LGNVELVSPDGNRIYADNLDVTDNF 125


>gi|116251333|ref|YP_767171.1| outer membrane protein involved in envelope biosynthesis [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255981|emb|CAK07062.1| putative outer membrane protein involved in envelope biosynthesis
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 775

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 8/85 (9%), Positives = 27/85 (31%), Gaps = 2/85 (2%)

Query: 109 TVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINS 168
            +     E   + L A+   +N     +      ++      ++  +    + K   + +
Sbjct: 42  DIGKNIPEGAKLLLSANELVYNRDADLVSAVGGVQINY-GGYKMVAQKVEYNQKTGRMMA 100

Query: 169 SDPVIITHSDFV-LSANFARIENSS 192
              V +   D   + A+   + ++ 
Sbjct: 101 LGNVELVSPDGNRIYADNLDVTDNF 125


>gi|86357090|ref|YP_468982.1| putative organic solvent tolerance protein OstA [Rhizobium etli CFN
           42]
 gi|86281192|gb|ABC90255.1| putative organic solvent tolerance protein OstA [Rhizobium etli CFN
           42]
          Length = 776

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/91 (9%), Positives = 29/91 (31%), Gaps = 2/91 (2%)

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
               E  +  +  E   + L A+   +N     +      ++      ++  +    + K
Sbjct: 36  ASAPEQNIQNKIPESAKLLLSANELVYNRDADLVSAVGGVQINY-GGYKMVAQKVEYNQK 94

Query: 163 NITINSSDPVIITHSDFV-LSANFARIENSS 192
              + +   V +   D   + A+   + ++ 
Sbjct: 95  TGRMMAMGNVELVSPDGNRIYADNLDVTDNF 125


>gi|291279433|ref|YP_003496268.1| hypothetical protein DEFDS_1042 [Deferribacter desulfuricans SSM1]
 gi|290754135|dbj|BAI80512.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 151

 Score = 48.2 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 9/90 (10%), Positives = 25/90 (27%), Gaps = 5/90 (5%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT----INSSDPVI 173
            ++ + +    +++                 N  +  +   + + N      I  +  V 
Sbjct: 22  NNVQITSKELSYDVNKKLSIFKGDVNAFYD-NTTIKSDLMYVYLDNDNKPVKIVCNGNVQ 80

Query: 174 ITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           I   +    +N A  +         G V +
Sbjct: 81  IVKDNMTSISNNAIFDLKKDVLTLEGNVKI 110


>gi|186680638|ref|YP_001863834.1| hypothetical protein Npun_R0090 [Nostoc punctiforme PCC 73102]
 gi|186463090|gb|ACC78891.1| protein of unknown function DUF1239 [Nostoc punctiforme PCC 73102]
          Length = 401

 Score = 48.2 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 44/156 (28%), Gaps = 11/156 (7%)

Query: 51  STFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS-LVAERAKTSFNSGKGIIFLQDFELT 109
           S  S      L F  + +++       +       + A++A   +   K I   +     
Sbjct: 53  SAASSKQDSNLTFFDVTLEQA-----DEVGRPIWKVRAKQA--KYTKEKQIGQAESPYGE 105

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINS 168
           +           + A  A        L++          + + L         K   +  
Sbjct: 106 LYQ--DGKIVYQIKADVADIEQDGKQLFLKGKIFATDPSNGIVLQGNELEWRPKEDLLIV 163

Query: 169 SDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
            + +  TH      A   R++   +   F+G+V   
Sbjct: 164 RNKINGTHKQLQAVAQEVRVKTREQRMEFSGKVVAN 199



 Score = 43.5 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 10/88 (11%), Positives = 26/88 (29%), Gaps = 2/88 (2%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
               ++ + A+     +   T+Y++       +    L   T    + N  + +   V+ 
Sbjct: 296 QRVENLTVTANQGEMKIPQKTVYLTGNVNAIGQRRQSLQSSTLTWYLDNKLVEAQGNVVY 355

Query: 175 T--HSDFVLSANFARIENSSRSAVFAGQ 200
                    +   A     + + V  G 
Sbjct: 356 RQVDPPLNFTGETAVGNLQTENIVVKGG 383


>gi|262038161|ref|ZP_06011558.1| hypothetical protein HMPREF0554_0457 [Leptotrichia goodfellowii
           F0264]
 gi|261747809|gb|EEY35251.1| hypothetical protein HMPREF0554_0457 [Leptotrichia goodfellowii
           F0264]
          Length = 724

 Score = 47.8 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/186 (11%), Positives = 47/186 (25%), Gaps = 20/186 (10%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIM--KKFILSDYSKDRVKYSLVAERAK 91
             + ++  + L S        K     ++     M  K               + A+   
Sbjct: 8   GVLIVIAGYFLYSVF----LKKIDTSPVEKMKQEMNAKNVTYKLKDDA----IIKADE-- 57

Query: 92  TSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KDNL 150
                  GII  +   + +  +      M + A  A  N     + +    + +   +  
Sbjct: 58  QIGTQTDGIIKFKGVVIDLLKKD-----MLISAKEAEVNTKTSDITLKNTVEGRTKDNKW 112

Query: 151 RLDFETAVLDVKNITINSSDPVIITH--SDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
            +  E      +   I S     I +      L A+  +           G V       
Sbjct: 113 NIFTEHVDYKKEGDLIISDTRTKIINNEDKTELQADKVQTTVKFEEITGTGNVVYKKEGK 172

Query: 209 VLQKKE 214
            L+  +
Sbjct: 173 ELKADK 178



 Score = 40.5 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 29/86 (33%), Gaps = 1/86 (1%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L A   ++N  N         K K  +   +     V  ++   ++++  V   + D  +
Sbjct: 174 LKADKIKYNDVNKQAEAEGNVKYK-DEKSDIAANRGVYFIEKKQVDATGNVDYRNKDLNV 232

Query: 182 SANFARIENSSRSAVFAGQVSVVVNP 207
            AN    +   + A   G  +    P
Sbjct: 233 KANHVFYDEIKQIANADGNGTFSYFP 258



 Score = 36.2 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/162 (11%), Positives = 42/162 (25%), Gaps = 9/162 (5%)

Query: 40  GWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKG 99
           G  +      +   +K +        + +K   +   +KD              +     
Sbjct: 71  GVVIDLLKKDMLISAKEAEVNTKTSDITLKN-TVEGRTKDNKWNIFTE---HVDYKKEGD 126

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVL 159
           +I + D    +     +     L A   +  +    +  +     K K+   L  +    
Sbjct: 127 LI-ISDTRTKIINNEDKTE---LQADKVQTTVKFEEITGTGNVVYK-KEGKELKADKIKY 181

Query: 160 DVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
           +  N    +   V        ++AN        +     G V
Sbjct: 182 NDVNKQAEAEGNVKYKDEKSDIAANRGVYFIEKKQVDATGNV 223


>gi|283836254|ref|ZP_06355995.1| putative inner membrane protein [Citrobacter youngae ATCC 29220]
 gi|291067618|gb|EFE05727.1| putative inner membrane protein [Citrobacter youngae ATCC 29220]
          Length = 191

 Score = 47.8 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSS--WIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L       ++   +       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAVLVMIGINLADKDETTQVVVNNNEPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYHLIAQNVE--YYSEQAVSWFTQPVLTTFDKD-KVPTWSIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSDDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|238793708|ref|ZP_04637330.1| hypothetical protein yinte0001_850 [Yersinia intermedia ATCC 29909]
 gi|238726949|gb|EEQ18481.1| hypothetical protein yinte0001_850 [Yersinia intermedia ATCC 29909]
          Length = 176

 Score = 47.8 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 56/176 (31%), Gaps = 9/176 (5%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSF 94
             I    +  +    +     ++   +      +  +   ++      Y LVAE      
Sbjct: 2   ALIALVLIGWNMSGFNQPDTQTVADDNEPSSQSQHTVTVVFNPVGQLNYKLVAEDV--QN 59

Query: 95  NSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV----KDNL 150
            S + + +     +T+  + +      + A  A+    +  LY+    ++          
Sbjct: 60  FSTQELTWFTKPVMTLFAENA-VATWTVRADRAKL-TNDKMLYLYGHVEVDSLTPDAQLQ 117

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           ++  + A +++    ++S D V +    F  +    R     ++A    +V     
Sbjct: 118 KIKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELIEKVKTSYE 173


>gi|258645771|ref|ZP_05733240.1| conserved hypothetical protein [Dialister invisus DSM 15470]
 gi|260403142|gb|EEW96689.1| conserved hypothetical protein [Dialister invisus DSM 15470]
          Length = 282

 Score = 47.8 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 6/70 (8%), Positives = 20/70 (28%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           + A    ++    T+  +    +   +   +  +      +N +      V       V+
Sbjct: 24  ITADILTYDGKAKTVTATGNVVIHANEGAVVTGKKGQYYFENRSAWLDGGVEYQKDQTVM 83

Query: 182 SANFARIENS 191
           +A    +   
Sbjct: 84  TAEKMYLYED 93



 Score = 37.8 bits (86), Expect = 1.0,   Method: Composition-based stats.
 Identities = 10/129 (7%), Positives = 30/129 (23%), Gaps = 3/129 (2%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
            +       + A          KG  + ++    +        D  +      +   + T
Sbjct: 38  VTATGN-VVIHANEGA-VVTGKKGQYYFENRSAWLDGGVEYQKDQTVMTAEKMYLYEDKT 95

Query: 136 LYISQPFKMKVKDNLR-LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
                   +  +   R +  +  + + +           +   D ++ A           
Sbjct: 96  TRGVGGVYIHDEAEKRTMKGDDIMYNPETGFGKIQGNGYLESVDGIIEAPLIEGNMKQVK 155

Query: 195 AVFAGQVSV 203
               G V +
Sbjct: 156 IEATGGVHL 164


>gi|86136832|ref|ZP_01055410.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
 gi|85826156|gb|EAQ46353.1| hypothetical protein MED193_14197 [Roseobacter sp. MED193]
          Length = 168

 Score = 47.8 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 44/130 (33%), Gaps = 5/130 (3%)

Query: 82  KYSLV--AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
              +   A     +  S +    +   +  +         +Y    + +   A   L  +
Sbjct: 38  PVEVTSDALSVNQADGSAEFTGSVLIVQGVMKLSADRVLVIYKTDDTGK--RAIDRLEAT 95

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
               +    +   + + A   +   TI  +  V++  S   L++    +  ++ +A  AG
Sbjct: 96  GSVLLVSGPDA-AEAQRADYTIDEGTIVLTGDVLLNQSAGTLASQRMVVNLTTGTASMAG 154

Query: 200 QVSVVVNPGV 209
           +V  ++NP  
Sbjct: 155 RVKTILNPSS 164


>gi|297183459|gb|ADI19590.1| hypothetical protein [uncultured SAR11 cluster bacterium
           HF0770_37D02]
          Length = 136

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 39/125 (31%), Gaps = 8/125 (6%)

Query: 18  RQHVRFIQFLKFFFPFATVTIVGWF----LLSSWIRISTFSKSSIDLLDFEPMIM-KKFI 72
            +  R I  L        + +  +F    ++ +        K  I   + + + M +   
Sbjct: 1   MKRSRKIVQLSLISIGLFLILATYFLYPKIIENKFIKEETIKDKIVKTEDDNINMFENVE 60

Query: 73  LSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLA 132
                       + AE+A         IIFL +  +T+     +   + + +    +N  
Sbjct: 61  YKGVYNIDRPIVVTAEKAL-VITEKPEIIFLTNMRVTLLLDDEKI--IIITSDKGSYNKI 117

Query: 133 NHTLY 137
            +  +
Sbjct: 118 TYDCF 122


>gi|304413068|ref|ZP_07394541.1| hypothetical protein REG_0042 [Candidatus Regiella insecticola
           LSR1]
 gi|304283911|gb|EFL92304.1| hypothetical protein REG_0042 [Candidatus Regiella insecticola
           LSR1]
          Length = 196

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 58/173 (33%), Gaps = 14/173 (8%)

Query: 45  SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQ 104
            S            +L  ++       + +     ++ Y L+AE  K   NS      L 
Sbjct: 24  FSGFNQQVIQPVDHNLPTYQSQQTVTAVYA--LDGKLHYRLMAEEVKNYTNSSVNNTALD 81

Query: 105 DFELTVPTQ-------RSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN----LRLD 153
              +T  T+        +  G   + A  A+       LY+    ++          ++ 
Sbjct: 82  HSTVTWFTKPVMTLFDENAVGSWEIKADQAKL-TDGKMLYLYGHVEVNNLTAISQLQKIT 140

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            + A +++ N  I+S+D V +    F ++    R    +++   + +V     
Sbjct: 141 TDNAEVNLINQNISSNDDVNLYGVGFTVNGMKMRGNLRNQTVELSEKVKTHYE 193


>gi|257462577|ref|ZP_05626987.1| S-layer protein [Fusobacterium sp. D12]
 gi|317060229|ref|ZP_07924714.1| predicted protein [Fusobacterium sp. D12]
 gi|313685905|gb|EFS22740.1| predicted protein [Fusobacterium sp. D12]
          Length = 797

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 29/97 (29%), Gaps = 3/97 (3%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
           +   R E   +YL A       A              +++  L  +    D     +N  
Sbjct: 703 LSEYRGEKARVYL-AKEQNQYRAKKLEVFEDAV--FTQEDKTLKGKRGQYDFDTNLVNFY 759

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             V  +  D  + ++       ++ A   G V +  +
Sbjct: 760 GDVFFSSKDGSIRSDEMIYNTQTKKAKAKGNVKMNYS 796



 Score = 40.9 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 44/127 (34%), Gaps = 12/127 (9%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            +   +++  +RA     SG            +   +       + +  A +  A   + 
Sbjct: 493 SETQNFNITGDRAVFDQKSG----------AVMGNVKGNLQGTMITSSKAIYKTAEKMVE 542

Query: 138 ISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
           + +P + +    NL    ++    V+       D V +   +  +++++A      + A 
Sbjct: 543 LPEPIQYRNSQENLHGSMKSGKYFVEAHQFQGKDFVALRAGE-KVTSDYAEYFTEEKRAE 601

Query: 197 FAGQVSV 203
             G+V +
Sbjct: 602 LTGKVRM 608



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/132 (12%), Positives = 41/132 (31%), Gaps = 16/132 (12%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A  +     +G+ +I        +  Q  EY       + A +++    + +     + 
Sbjct: 259 KATLSAMDKKAGEELIHFVGP---IRAQNEEYSCSM---NRAVYDIVKKEITMIGNIDIV 312

Query: 146 VKDNLRLDFETAVLDVKNITINSSD---PVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
            K   RL  + AV       +N       V    +   + A   + +  +          
Sbjct: 313 SKKGDRLKADRAVYHEAEKILNVYGDGNKVNYDGNGHHIEAEEFQYDVRTGDIR------ 366

Query: 203 VVVNPGVLQKKE 214
            V++P   + ++
Sbjct: 367 -VLSPYRYRNQK 377



 Score = 38.5 bits (88), Expect = 0.57,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 30/87 (34%), Gaps = 4/87 (4%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHS 177
           L    A ++ ++  + +S   ++          R  F     DV+     ++ P  IT++
Sbjct: 168 LRGEKAEYDDSSKKILLSGNVELYNSKKDGKEFRGKFGDMSYDVEAGRGETNLPFEITYN 227

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVV 204
           +  L A          +      V++ 
Sbjct: 228 ETQLEAEKLVFYPEENAFHLEQNVNLT 254


>gi|330993927|ref|ZP_08317857.1| LPS-assembly protein lptD [Gluconacetobacter sp. SXCC-1]
 gi|329758873|gb|EGG75387.1| LPS-assembly protein lptD [Gluconacetobacter sp. SXCC-1]
          Length = 800

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/188 (9%), Positives = 42/188 (22%), Gaps = 16/188 (8%)

Query: 7   RNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPM 66
           R+    +     +    ++ L          + G          +  + +        P+
Sbjct: 3   RSVPFPRAPHPSRPTAVLRRLPRGMLLGATMLAGMIGGLGGWTSTAHADAEGAPRRRMPI 62

Query: 67  IMKK------FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120
              K         S    +    +  A+       +G           T       + + 
Sbjct: 63  QAPKSQPQAPASFSGTVSNTDPMTFQADHVAYDSRNG---------IATWTGNVQVWQND 113

Query: 121 YL-FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDF 179
            +  A    ++             M   D   L  + A L         +        + 
Sbjct: 114 QIMRADKIVYDRNTGIASARGNVAMVEPDGTVLFTDYAELSNGMRDGIMTRLYAQMADNA 173

Query: 180 VLSANFAR 187
            ++AN  R
Sbjct: 174 RMAANGMR 181



 Score = 35.1 bits (79), Expect = 6.1,   Method: Composition-based stats.
 Identities = 10/69 (14%), Positives = 24/69 (34%), Gaps = 2/69 (2%)

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              S          +    +    D +N     +  V +  +D ++ A+    + ++  A
Sbjct: 73  ASFSGTVSNTDP--MTFQADHVAYDSRNGIATWTGNVQVWQNDQIMRADKIVYDRNTGIA 130

Query: 196 VFAGQVSVV 204
              G V++V
Sbjct: 131 SARGNVAMV 139


>gi|325292485|ref|YP_004278349.1| organic solvent tolerance protein [Agrobacterium sp. H13-3]
 gi|325060338|gb|ADY64029.1| organic solvent tolerance protein [Agrobacterium sp. H13-3]
          Length = 793

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 6/88 (6%), Positives = 26/88 (29%), Gaps = 2/88 (2%)

Query: 108 LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITIN 167
             +     +   + L A+   +N  +  +      +M      R+  +    + +   + 
Sbjct: 37  GLLAPGSQDDSKLLLTANELTYNRDSQRVIAKGVVRMHYS-GYRMVAQQVEYNQQTGRVI 95

Query: 168 SSDPVIITHSDFV-LSANFARIENSSRS 194
           +   + +       + A+   + +    
Sbjct: 96  AHGNIELIEPGGNKIYADEMDVTDDFGQ 123



 Score = 38.2 bits (87), Expect = 0.83,   Method: Composition-based stats.
 Identities = 7/94 (7%), Positives = 23/94 (24%), Gaps = 1/94 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + A    +N     +      ++      ++  +   +         +  + +   D  
Sbjct: 79  RMVAQQVEYNQQTGRVIAHGNIELIEPGGNKIYADEMDVTDDFGQGFVN-ALRVETPDNT 137

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
             A  +         V    V     P   + ++
Sbjct: 138 RIAGESAERLEGDRMVLNNGVYTACLPCAERPEK 171


>gi|154246775|ref|YP_001417733.1| organic solvent tolerance protein [Xanthobacter autotrophicus Py2]
 gi|154160860|gb|ABS68076.1| Organic solvent tolerance protein [Xanthobacter autotrophicus Py2]
          Length = 842

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             M + A    ++    T+      ++       L+    VLD K  T+ +   V +   
Sbjct: 76  QKMLVTADQLEYDYQKETVSAVGTVQIYYD-GSTLEANRVVLDRKANTLFAQGNVRLKDK 134

Query: 178 DFVL-SANFARIENSSRS 194
           D  + +A+   +    + 
Sbjct: 135 DGKIVTADNLELTQDFKQ 152


>gi|298377275|ref|ZP_06987228.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
 gi|298265689|gb|EFI07349.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 42/165 (25%), Gaps = 12/165 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE---- 88
           F  V ++  F  S             D      M               +Y L A+    
Sbjct: 19  FVVVVMLLLFSASCSKEHKEVVDVEFDPDKTYTMKATDVSSLISDSGITRYRLKAKEWQI 78

Query: 89  --RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
             +A          I+++ F+           +  + A +A +        +    +++ 
Sbjct: 79  YGKAAEPHWYFPEGIYVEKFDTLF------QTEASIKADTAYYYDKKGLWELIGNVEVES 132

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
                 +      D K   + S   + I   D +++         
Sbjct: 133 LQGEHFETSQLFWDQKQEKVYSDKFMRIEQEDKIITGIGFESNQD 177


>gi|158425947|ref|YP_001527239.1| putative organic solvent tolerance protein-like precursor
           [Azorhizobium caulinodans ORS 571]
 gi|158332836|dbj|BAF90321.1| putative organic solvent tolerance protein-like precursor
           [Azorhizobium caulinodans ORS 571]
          Length = 825

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/82 (10%), Positives = 25/82 (30%), Gaps = 2/82 (2%)

Query: 111 PTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSD 170
             +      M + A    ++  N T+      +M       ++ +    + K   + +  
Sbjct: 57  TPKTDPNAKMLVTADQLVYDYKNDTVSAVGNVQMYYD-GSSVEAKRVTYNRKTNKVIAEG 115

Query: 171 PVIITHSDFVL-SANFARIENS 191
            V +   D  + +A    +   
Sbjct: 116 NVRLKQKDGKIVTAENLELSQD 137



 Score = 38.9 bits (89), Expect = 0.52,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 27/78 (34%), Gaps = 2/78 (2%)

Query: 140 QPFKMKVKDNLRL--DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
                K   N ++    +  V D KN T+++   V + +    + A        +   + 
Sbjct: 54  GVATPKTDPNAKMLVTADQLVYDYKNDTVSAVGNVQMYYDGSSVEAKRVTYNRKTNKVIA 113

Query: 198 AGQVSVVVNPGVLQKKEN 215
            G V +    G +   EN
Sbjct: 114 EGNVRLKQKDGKIVTAEN 131



 Score = 36.6 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/131 (12%), Positives = 37/131 (28%), Gaps = 9/131 (6%)

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +    K  + A++    + +   +  + + ++             + A    +N   + +
Sbjct: 60  TDPNAKMLVTADQLVYDYKNDT-VSAVGNVQMYYDGSS-------VEAKRVTYNRKTNKV 111

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
                 ++K KD   +  E   L         +   + T      +A  A         V
Sbjct: 112 IAEGNVRLKQKDGKIVTAENLELSQDYSEGFINSLRVDTPDKTHFAATRAD-RAEGNITV 170

Query: 197 FAGQVSVVVNP 207
           F   V     P
Sbjct: 171 FQNGVYTACEP 181


>gi|262341376|ref|YP_003284231.1| hypothetical protein BLBBGE_624 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272713|gb|ACY40621.1| hypothetical protein BLBBGE_624 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 550

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 30/84 (35%), Gaps = 1/84 (1%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           + A   + N  N  +++      +      L  + A+   KN  +     V +   +  +
Sbjct: 22  IHADLIQKNDHNDAIFLIGNIHFEY-QKYHLFCDKAIYYKKNNRLYGYGNVQLKSKENKI 80

Query: 182 SANFARIENSSRSAVFAGQVSVVV 205
            +    IE++      +G V + +
Sbjct: 81  ISKKIYIEDNFSHFKLSGGVILFI 104


>gi|321225260|gb|EFX50319.1| 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
          Length = 379

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/200 (13%), Positives = 69/200 (34%), Gaps = 19/200 (9%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L        +   S       +    ++         +
Sbjct: 190 SKTRRWVIILLSLAILVLIGINLADKDDPAAVMVNSNDPTYKSEHTDTVVYSP------E 243

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 244 GALSYRLIAQHVE--YFSDQAVSWFTQPVLTTFDKD-KVPTWSIKADKAKL-TNDRMLYL 299

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S+D V +  + F  S    R    S++
Sbjct: 300 YGHVEVNALVPDAQLRRITTDNAQINLVTQDVTSNDLVTLYGTTFNSSGLKMRGNLRSKN 359

Query: 195 AVFAGQVSVVVNPGVLQKKE 214
           A    +V        +Q K+
Sbjct: 360 AELIEKVRTSYE---IQNKQ 376


>gi|262384402|ref|ZP_06077537.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|301308672|ref|ZP_07214624.1| conserved hypothetical protein [Bacteroides sp. 20_3]
 gi|262294105|gb|EEY82038.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|300833196|gb|EFK63814.1| conserved hypothetical protein [Bacteroides sp. 20_3]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 42/165 (25%), Gaps = 12/165 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE---- 88
           F  V ++  F  S             D      M               +Y L A+    
Sbjct: 19  FVVVVMLLLFSASCSKEHKEVVDVEFDPDKTYTMKATDVSSLISDSGITRYRLKAKEWQI 78

Query: 89  --RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
             +A          I+++ F+           +  + A +A +        +    +++ 
Sbjct: 79  YGKAAEPHWYFPEGIYVEKFDTLF------QTEASIKADTAYYYDKKGLWELIGNVEVES 132

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
                 +      D K   + S   + I   D +++         
Sbjct: 133 LQGEHFETSQLFWDQKQEKVYSDKFMRIEQEDKIITGIGFESNQD 177


>gi|83855389|ref|ZP_00948919.1| hypothetical protein NAS141_11676 [Sulfitobacter sp. NAS-14.1]
 gi|83843232|gb|EAP82399.1| hypothetical protein NAS141_11676 [Sulfitobacter sp. NAS-14.1]
          Length = 164

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 42/137 (30%), Gaps = 14/137 (10%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH--- 134
              +   + A+        G  +                 G+M L A             
Sbjct: 35  DTGLPVEVTADNLSVDQGDGSAVFTGNVLIGQ--------GEMRLSAARVLVVYRADAEG 86

Query: 135 --TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
              L  +    +        + E A  D+   TI  S  V++T     LS++   ++ S 
Sbjct: 87  IARLEATGGVTLV-SGKDAAESERADYDIDTGTIVMSGNVLLTQGRNALSSDTMSVKLSD 145

Query: 193 RSAVFAGQVSVVVNPGV 209
            +A  +G+V  ++  G 
Sbjct: 146 GTAQMSGRVKTILQTGS 162


>gi|227824357|ref|ZP_03989189.1| OstA family protein [Acidaminococcus sp. D21]
 gi|226904856|gb|EEH90774.1| OstA family protein [Acidaminococcus sp. D21]
          Length = 265

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/94 (10%), Positives = 27/94 (28%), Gaps = 1/94 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +      ++  +         +++     R     A  + K    +    V+    D  
Sbjct: 10  SVSGDKVEYDFKSGQAVAEGNVEIRHDKG-RATARKAEYNTKTGEGSLEGSVVADQEDAH 68

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           L++    I+N        G   +      L+ ++
Sbjct: 69  LTSASLIIKNKGDYLSAIGNAVLKKADKTLRAEQ 102



 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 40/134 (29%), Gaps = 10/134 (7%)

Query: 84  SLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
           +L AE+      +             +           L A S  +N+  +  +     +
Sbjct: 97  TLRAEQVNYDSAAKYAETVGS--WAQLTMDDGS----SLDAASLTYNMETNKAFADGNVR 150

Query: 144 MKVKDNL---RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA-VFAG 199
           +         R D     L+  + TI+ +     T     +S +   I  +        G
Sbjct: 151 LISPPRDLTARADSAEYDLNESDGTIHLNGHATATQEGNTVSGDTLTIRGAGGKIAQGDG 210

Query: 200 QVSVVVNPGVLQKK 213
            V +V+ P   ++ 
Sbjct: 211 DVRMVIIPRKKEEA 224



 Score = 37.4 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 41/132 (31%), Gaps = 11/132 (8%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A +A+ +  +G+G +             ++  D +L + S         L       +K
Sbjct: 41  TARKAEYNTKTGEGSLEGSVV--------ADQEDAHLTSASLIIKNKGDYLSAIGNAVLK 92

Query: 146 VKDNLRLDFETAVLDVKNITINSSD-PVIITHSDFV-LSANFARIENSSRSAVFAGQVSV 203
            K +  L  E    D       +      +T  D   L A        +  A   G V +
Sbjct: 93  -KADKTLRAEQVNYDSAAKYAETVGSWAQLTMDDGSSLDAASLTYNMETNKAFADGNVRL 151

Query: 204 VVNPGVLQKKEN 215
           +  P  L  + +
Sbjct: 152 ISPPRDLTARAD 163


>gi|160872300|ref|ZP_02062432.1| hypothetical protein RICGR_1407 [Rickettsiella grylli]
 gi|159121099|gb|EDP46437.1| hypothetical protein RICGR_1407 [Rickettsiella grylli]
          Length = 188

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 40/118 (33%), Gaps = 8/118 (6%)

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL-----RLD 153
             I L     T   +        L A   R    N  L++     ++ K++       L 
Sbjct: 74  NTILLTAPLFTFYLKN--KASWQLSARYGRL-KENDRLHLWNNVTLEQKNSNNKIISTLK 130

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
             T  + +K    ++S PV IT  + V+ A       ++++     QV     P   +
Sbjct: 131 TSTLDIHIKEKIADTSAPVRITRMNQVIHAVGLHANFNTKTIRLLSQVKSQFMPEKSK 188


>gi|150006850|ref|YP_001301593.1| hypothetical protein BDI_0182 [Parabacteroides distasonis ATCC
           8503]
 gi|149935274|gb|ABR41971.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 42/165 (25%), Gaps = 12/165 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE---- 88
           F  V ++  F  S             D      M               +Y L A+    
Sbjct: 19  FVVVVMLLLFSASCSKEHKEVVDVEFDPDKTYTMKATDVSSLISDSGITRYRLKAKEWQI 78

Query: 89  --RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
             +A          I+++ F+           +  + A +A +        +    +++ 
Sbjct: 79  YGKAAEPHWYFPEGIYVEKFDTLF------QTEASIKADTAYYYDKKGLWELIGNVEVES 132

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
                 +      D K   + S   + I   D +++         
Sbjct: 133 LQGEHFETSQLFWDQKQEKVYSDKFMRIEQEDKIITGIGFESNQD 177


>gi|269469199|gb|EEZ80735.1| hypothetical protein Sup05_0141 [uncultured SUP05 cluster
           bacterium]
          Length = 297

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/88 (10%), Positives = 30/88 (34%), Gaps = 2/88 (2%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLD--VKNITINSSDPVIITHSD 178
            +++     ++    L +S   K+      +++ +  V+D         + + +      
Sbjct: 210 TIYSTGMDLDMQEKILQLSGKVKILQNSGTKINTQDLVVDQSNDGDVYRTEEKIHYQSKL 269

Query: 179 FVLSANFARIENSSRSAVFAGQVSVVVN 206
             ++A     +  ++     G V+ V  
Sbjct: 270 ANINAVGMHYDAKNKKVKLTGGVAGVYE 297



 Score = 42.4 bits (98), Expect = 0.038,   Method: Composition-based stats.
 Identities = 17/176 (9%), Positives = 50/176 (28%), Gaps = 30/176 (17%)

Query: 68  MKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGIIFLQDFELT----VPTQRSEYGDM-- 120
           +    ++ Y +   K Y L +ERA   +     I F     +     +  +      +  
Sbjct: 72  LLNPEVTTYDEQGKKDYVLTSERA--DYLDSGEISFKGKVNVHSSSGITHKMKTKELLVG 129

Query: 121 -------------------YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
                               + +        +  + ++    +K     ++  +   +D 
Sbjct: 130 TKTDDLVSNKKVTYLGENAKIVSQGMHMQTRDDKMKLTGKTVIKQDSGQKILTKNLNIDQ 189

Query: 162 KNIT--INSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
            N      S         +  + +    ++   +    +G+V ++ N G     ++
Sbjct: 190 SNGQKHYYSKHNTTYLAKEDTIYSTGMDLDMQEKILQLSGKVKILQNSGTKINTQD 245


>gi|15888446|ref|NP_354127.1| organic solvent tolerance protein [Agrobacterium tumefaciens str.
           C58]
 gi|15156138|gb|AAK86912.1| organic solvent tolerance protein [Agrobacterium tumefaciens str.
           C58]
          Length = 793

 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 6/89 (6%), Positives = 28/89 (31%), Gaps = 2/89 (2%)

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITI 166
           +  + +   +   + L A+   +N  +  +      +M      R+  +    + +   +
Sbjct: 36  DGLLASASQDDSKLLLTANELTYNRDSQRVIAKGVVRMNYS-GYRMVAQQVEYNQQTGRV 94

Query: 167 NSSDPVIITHSDFV-LSANFARIENSSRS 194
            +   + +       + A+   + +    
Sbjct: 95  IAHGNIELIEPGGNKIYADEMDVTDDFGQ 123



 Score = 35.8 bits (81), Expect = 3.6,   Method: Composition-based stats.
 Identities = 8/94 (8%), Positives = 27/94 (28%), Gaps = 1/94 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + A    +N     +      ++      ++  +   +         +   + T  +  
Sbjct: 79  RMVAQQVEYNQQTGRVIAHGNIELIEPGGNKIYADEMDVTDDFGQGFVNALRVETTDNTR 138

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           ++   A    +S + V    V     P   + ++
Sbjct: 139 IAGESAE-RLNSDTMVLNNGVYTACLPCAERPEK 171


>gi|124006426|ref|ZP_01691260.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123988083|gb|EAY27754.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 536

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/150 (12%), Positives = 46/150 (30%), Gaps = 9/150 (6%)

Query: 63  FEPMIMKKFI-LSDYSKDRVKYSLVAERAKTSFNSGK-------GIIFLQDFELTVPTQR 114
            EP+ +     L   ++   ++ ++ ++                  I     +     + 
Sbjct: 44  EEPLEIINAKWLKGKTEGGQEFRILKDKVVIRHKGNTLYCDSAIQNITKNTVQAIGNARM 103

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
                  + + +  ++        S    +  K    L  E    DV +   +      I
Sbjct: 104 LGSDGTTVNSRTMFYDGNKKVANASGNVVLVDKKG-TLTTEVLDYDVVSQVAHYYTGGKI 162

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVV 204
             S+ +L++     + +S+ A F   V +V
Sbjct: 163 VDSENILTSKEGTYDTNSKVAFFKNDVHLV 192


>gi|242241052|ref|YP_002989233.1| hypothetical protein Dd703_3654 [Dickeya dadantii Ech703]
 gi|242133109|gb|ACS87411.1| protein of unknown function DUF1239 [Dickeya dadantii Ech703]
          Length = 189

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 44/129 (34%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y LVAE A+    +            T+  +        + +  A     +  LY+   
Sbjct: 60  SYKLVAESAE--HYNADQSSRFTLPVATMFNELG-VATWSVRSDRATL-TKDRMLYLYGH 115

Query: 142 FKMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          R+  + A +++    ++S D V +  ++F  +    R    S++A  
Sbjct: 116 VEVNSLTTDSQLERIKTDNAQVNLITQDVSSDDEVTLYGTNFTSNGLKMRGNLRSKTAEL 175

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 176 IDKVKSYYE 184


>gi|255016119|ref|ZP_05288245.1| hypothetical protein B2_19623 [Bacteroides sp. 2_1_7]
          Length = 209

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 42/165 (25%), Gaps = 12/165 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE---- 88
           F  V ++  F  S             D      M               +Y L A+    
Sbjct: 7   FVVVVMLLLFSASCSKEHKEVVDVEFDPDKTYTMKATDVSSLISDSGITRYRLKAKEWQI 66

Query: 89  --RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
             +A          I+++ F+           +  + A +A +        +    +++ 
Sbjct: 67  YGKAAEPHWYFPEGIYVEKFDTLF------QTEASIKADTAYYYDKKGLWELIGNVEVES 120

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
                 +      D K   + S   + I   D +++         
Sbjct: 121 LQGEHFETSQLFWDQKQEKVYSDKFMRIEQEDKIITGIGFESNQD 165


>gi|260891462|ref|ZP_05902725.1| hypothetical protein GCWU000323_02673 [Leptotrichia hofstadii
           F0254]
 gi|260858845|gb|EEX73345.1| hypothetical protein GCWU000323_02673 [Leptotrichia hofstadii
           F0254]
          Length = 782

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 44/129 (34%), Gaps = 7/129 (5%)

Query: 74  SDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN 133
           + Y+  + K +L A++           I + D E  V  +  +     L A   R++  N
Sbjct: 164 ASYNNKKDKKTLTADKITYH-----DPIKVSDAEGNVVYKEEQTKR-ELRADRMRYDDIN 217

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
                     +      +L        +K+  I+    ++ T  + V+SA+ A      +
Sbjct: 218 KIGTALGNV-IYTDPENKLTGYKVDYYMKDERIDGQGNIVYTGKNSVISADTASYFIKKK 276

Query: 194 SAVFAGQVS 202
                G V 
Sbjct: 277 QVDGRGHVK 285



 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 15/120 (12%), Positives = 35/120 (29%), Gaps = 7/120 (5%)

Query: 102 FLQDFELTVPTQRS-EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLD 160
            +      +       Y D+ L +     +   + +       +  K+N ++      +D
Sbjct: 474 NMSITRSEIKENVHMTYKDITLDSQYNEMDSGRNLILARDKVMVDFKNNTKMTANYLYMD 533

Query: 161 VKNITINSSDPVIITHS-----DFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
           +      + + V I  +         SA+ A I    +     G V V          ++
Sbjct: 534 MNKQEGYARNNVKIVSTLPQFRAINTSADKATIYLKDKKIKLNGNV-VTYQGKTQISSKS 592



 Score = 37.0 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 28/87 (32%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L  +   + + +  +       +    N  +  +TA   +K   ++    V  T    +
Sbjct: 234 KLTGYKVDYYMKDERIDGQGNI-VYTGKNSVISADTASYFIKKKQVDGRGHVKYTSPTLI 292

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
           ++ +    +  +R     G  +    P
Sbjct: 293 VTGDHVFYDEIARILNGDGNGTYNYLP 319


>gi|269121341|ref|YP_003309518.1| OstA family protein [Sebaldella termitidis ATCC 33386]
 gi|268615219|gb|ACZ09587.1| OstA family protein [Sebaldella termitidis ATCC 33386]
          Length = 742

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 8/85 (9%), Positives = 25/85 (29%), Gaps = 1/85 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + A  A +      +  +        +   L   +A+ ++    + +   V    +   
Sbjct: 174 RITADKAVYYTEQKKVDANGSVHY-TGEGNELKANSAIYELLTEILTADGNVYYKDAGSE 232

Query: 181 LSANFARIENSSRSAVFAGQVSVVV 205
           ++A  A  +   +    +G      
Sbjct: 233 ITAGHAIYDIKGQMVNASGSGRFKY 257



 Score = 37.8 bits (86), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 37/102 (36%), Gaps = 5/102 (4%)

Query: 107 ELTVPTQ-RSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT 165
              + T     Y D+ + +  +  +   + +      ++  +++ ++      +D+    
Sbjct: 418 RGEIKTNVNVRYKDLNMLSQYSEIDAGKNVVLSRDDVRLTFRESTQMTANYFYIDLNTEK 477

Query: 166 INSSDPVIITHSDF----VLSANFARIENSSRSAVFAGQVSV 203
             +   V I ++       +S + A I+N +R     G V  
Sbjct: 478 GYAQTNVKIINNIGGGKVDISTDKAIIDNKTRQLELLGNVVT 519


>gi|253583468|ref|ZP_04860666.1| S-layer protein [Fusobacterium varium ATCC 27725]
 gi|251834040|gb|EES62603.1| S-layer protein [Fusobacterium varium ATCC 27725]
          Length = 895

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 37/102 (36%), Gaps = 4/102 (3%)

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVK 162
              +    ++ GD  + + +A  ++      +     ++ K+       +  E  ++  K
Sbjct: 790 NTKLTVTDAKNGDTIVTSDTAEIDINRDIATLVGNVYIENKNPEQGITIITAEKGIIRQK 849

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              ++    V I + + ++ A+      +++     G V + 
Sbjct: 850 TGILDLMGNVKIENKESIIEADEGTYNTNTKKIKAKGHVFIN 891



 Score = 42.4 bits (98), Expect = 0.045,   Method: Composition-based stats.
 Identities = 10/100 (10%), Positives = 25/100 (25%), Gaps = 3/100 (3%)

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
            +            G        A +++    L      K+       L  +  V +   
Sbjct: 270 SNIVKFFGKITGSNGIYSFSGKEAVYDINTGELTFYGDVKITSTKGEELTADKIVYNNNT 329

Query: 164 ITINSSD---PVIITHSDFVLSANFARIENSSRSAVFAGQ 200
             I +       +   ++  L +   R  N ++      +
Sbjct: 330 KFITAYGEKKDAVYISNNGELRSKEFRYNNETKELFADKK 369



 Score = 39.7 bits (91), Expect = 0.29,   Method: Composition-based stats.
 Identities = 9/95 (9%), Positives = 30/95 (31%), Gaps = 1/95 (1%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
                  Y    L A +  +      L +++   ++     ++  +    +  +  +   
Sbjct: 218 WEPYDVTYSGAKLSAGNLWYQDTTEALLVTKNVIIETN-GYKIYVDKIQREANSNIVKFF 276

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             +  ++  +  S   A  + ++    F G V + 
Sbjct: 277 GKITGSNGIYSFSGKEAVYDINTGELTFYGDVKIT 311



 Score = 36.6 bits (83), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 43/124 (34%), Gaps = 7/124 (5%)

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRS---EYGDMYLFAHSARFNLANHTLYISQP 141
           + AE A+                  +  + +   E   + L     R++ A+  + +S  
Sbjct: 127 VSAENAEKKVKVSGKNFVTDSKMSYIELKDNVVLENEKIKLKGDIGRYSDASKIVTLSGN 186

Query: 142 FKMKVKDNLRL----DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
             +   D        +F      V +  + + +P  +T+S   LSA     ++++ + + 
Sbjct: 187 ITIDGTDRENAEISGNFLNLKYSVDDKILEAWEPYDVTYSGAKLSAGNLWYQDTTEALLV 246

Query: 198 AGQV 201
              V
Sbjct: 247 TKNV 250



 Score = 35.5 bits (80), Expect = 4.7,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 42/143 (29%), Gaps = 7/143 (4%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFE---LTVPTQRSEYGDMYLFAHSARFNLA 132
              +   +   A+            +F+       L                 +AR++  
Sbjct: 59  VDDNETNFE-KAKALVKDMVISGDNVFIDKVRNLALKNNILGVSPNGWKFNTEAARYDKL 117

Query: 133 NHTLYISQPFKM-KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              +           +  +++  +  V D K   I   D V++ +    L  +  R  ++
Sbjct: 118 KDEITSDVGVSAENAEKKVKVSGKNFVTDSKMSYIELKDNVVLENEKIKLKGDIGRYSDA 177

Query: 192 SRSAVFAGQVSVVVNPGVLQKKE 214
           S+    +G +   ++    +  E
Sbjct: 178 SKIVTLSGNI--TIDGTDRENAE 198


>gi|330837527|ref|YP_004412168.1| hypothetical protein Spico_1584 [Spirochaeta coccoides DSM 17374]
 gi|329749430|gb|AEC02786.1| hypothetical protein Spico_1584 [Spirochaeta coccoides DSM 17374]
          Length = 211

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 36/133 (27%), Gaps = 9/133 (6%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                  + A       N     I L   + +V  +      +   A   R+      L 
Sbjct: 85  DAGKGIEMSAGTITYDRNES---ILLSREQTSVEDKEKG---ITAQAGWVRYQQEEGILT 138

Query: 138 ISQPFKMKVKDNLRL---DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
                 +    +  +     ET      + T+      ++T  +    A   R+   +  
Sbjct: 139 FQDNVNLTRTTDDGIMVCTAETVTYVRSSGTVMLDGGAVVTWKNDTYRATTIRVNLDTDE 198

Query: 195 AVFAGQVSVVVNP 207
              +G++   +N 
Sbjct: 199 ITMSGEIRGTING 211


>gi|148652633|ref|YP_001279726.1| hypothetical protein PsycPRwf_0824 [Psychrobacter sp. PRwf-1]
 gi|148571717|gb|ABQ93776.1| protein of unknown function DUF1239 [Psychrobacter sp. PRwf-1]
          Length = 195

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 62/192 (32%), Gaps = 14/192 (7%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            F    ++ +  + +     +    S  ++   + E        +        +YSL A+
Sbjct: 4   RFLFILSLLVAVFAVWFYRNQGELDSIINLSTTNIEYEATDILAVQTNDDGVAEYSLAAD 63

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
                  + + +  L+  +L      +    + + A  A        + ++       + 
Sbjct: 64  TLT--HYADQNLDKLEAMKLNWRPSPN--RSVLINADEAVMYHEQSKVVMTNNVLFSSQT 119

Query: 149 N---------LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                     ++L     + D++   + S+ P+ +T       ++    + ++    FA 
Sbjct: 120 AANNLDNKPPMKLVASELIGDLEQKRVYSNTPIKVTQGQNSFESSRFLADVNTGDYEFA- 178

Query: 200 QVSVVVNPGVLQ 211
           QV+V   P   +
Sbjct: 179 QVAVTFMPPARK 190


>gi|256842539|ref|ZP_05548041.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256735895|gb|EEU49227.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 232

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 42/165 (25%), Gaps = 12/165 (7%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE---- 88
           F  V ++  F  S             D      M               +Y L A+    
Sbjct: 30  FVVVVMLLLFSASCSKEHKEVVDVEFDPDKTYTMKATDVSSLISDSGITRYRLKAKEWQI 89

Query: 89  --RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
             +A          I+++ F+           +  + A +A +        +    +++ 
Sbjct: 90  YGKAAEPHWYFPEGIYVEKFDTLF------QTEASIKADTAYYYDKKGLWELIGNVEVES 143

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
                 +      D K   + S   + I   D +++         
Sbjct: 144 LQGEHFETSQLFWDQKQEKVYSDKFMRIEQEDKIITGIGFESNQD 188


>gi|254436871|ref|ZP_05050365.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           307]
 gi|198252317|gb|EDY76631.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           307]
          Length = 161

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 41/132 (31%), Gaps = 8/132 (6%)

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDF--ELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                + A+       +G  I        +  +    +    +Y  A           L 
Sbjct: 35  NAPVEITADSLSIDQATGTAIFIGNVVFGQGDLRLNAARVQVIYSDASG-----DISRLS 89

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            S             +  TA  ++   T+  +  V++T     +S++  R+  S  SA  
Sbjct: 90  ASGGVTFVTAT-EAAEALTADYNLDTGTLELAGDVLLTQGASAISSDTMRVNLSDGSAQM 148

Query: 198 AGQVSVVVNPGV 209
            G+V  + N G 
Sbjct: 149 YGRVRTIFNQGN 160


>gi|257466743|ref|ZP_05631054.1| S-layer protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917892|ref|ZP_07914132.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691767|gb|EFS28602.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 797

 Score = 47.0 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 29/97 (29%), Gaps = 3/97 (3%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
           +   R E   +YL     ++      +        +     +L  +    D     +N  
Sbjct: 703 LSEYRGEKARVYLKKEQNQYRAKKLEV-FEDAVFSQED--KKLRGKRGQYDFDTSLVNFY 759

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             V  T  D  + ++       ++ A   G V +  N
Sbjct: 760 GDVSFTSKDGNIRSDEMIYNTETKKAKAKGNVELHYN 796



 Score = 40.5 bits (93), Expect = 0.16,   Method: Composition-based stats.
 Identities = 11/113 (9%), Positives = 32/113 (28%), Gaps = 9/113 (7%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A        +G+  I            R +  +     + A ++     + ++    + 
Sbjct: 259 NANLLAIDKKAGEDFITFVGPI------RGQNEEYTYSMNRAVYDTVKKEITMTGNIDIL 312

Query: 146 VKDNLRLDFETAVLDVKNITINSS---DPVIITHSDFVLSANFARIENSSRSA 195
                R+  + A+   K   ++     + V    S   + A   + +  +   
Sbjct: 313 SGKGERIRADRAIYHEKEKLLDVYSDGNKVTYDGSGHHIEATSFQYDAKTGDV 365



 Score = 39.3 bits (90), Expect = 0.39,   Method: Composition-based stats.
 Identities = 12/87 (13%), Positives = 30/87 (34%), Gaps = 4/87 (4%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFE--TAVLDVKNITINSSDPVIITHS 177
           L    A ++ +   + +S   ++    KD      +    + DV+     ++ P  I + 
Sbjct: 168 LRGEKAEYDDSTKKILLSGNIELYNPQKDGKEFRGKFGNMIYDVEKGRGETNLPFEIIYK 227

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVV 204
           + +L+A          +      V + 
Sbjct: 228 ETILNAEKMDFHPEENAFHLEQNVKIT 254


>gi|114769795|ref|ZP_01447405.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|114549500|gb|EAU52382.1| hypothetical protein OM2255_09511 [alpha proteobacterium HTCC2255]
 gi|161170291|gb|ABX59261.1| uncharacterized protein conserved in bacteria [uncultured marine
           bacterium EB000_55B11]
 gi|297183819|gb|ADI19942.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 160

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 45/142 (31%), Gaps = 15/142 (10%)

Query: 73  LSDYSKD-RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL 131
           LS  + D  +   + A     + +S   I     +           G + L A       
Sbjct: 28  LSGANHDINLPVEITANNLSINQSSNSAIFEGTAYVGQ--------GSLRLSADKIVVRY 79

Query: 132 ANHT-----LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
              T     +  +    +        + E+A+  + +  ++ S  V++      +S N+ 
Sbjct: 80  NQDTGKVTSVEATGKV-VFTNGEDIAEAESAIYKIDSGLLSMSGNVLLVQGKSTISGNYL 138

Query: 187 RIENSSRSAVFAGQVSVVVNPG 208
            ++     A  +G V   + P 
Sbjct: 139 DMDILKNIANLSGNVKTTLAPN 160


>gi|83950824|ref|ZP_00959557.1| hypothetical protein ISM_06980 [Roseovarius nubinhibens ISM]
 gi|83838723|gb|EAP78019.1| hypothetical protein ISM_06980 [Roseovarius nubinhibens ISM]
          Length = 139

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 43/135 (31%), Gaps = 18/135 (13%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
              + AE        G  I                 GDM L A   + +       I + 
Sbjct: 13  PVEVTAETLSVDQKDGTAIFTGDVLIAQ--------GDMRLSAPWVKVHYQEGQSEIEK- 63

Query: 142 FKMKVKDNLRLDF-------ETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
             ++ K+ + L         + A  +V    I     V++      ++ +   ++  + +
Sbjct: 64  --LEAKEGVTLVSGADAAEAQQADYNVSTGIITMDGDVLLVQGASAITGDQMFVDTVAGT 121

Query: 195 AVFAGQVSVVVNPGV 209
           A  AG+V  V+ P  
Sbjct: 122 ARMAGRVKTVLQPQS 136


>gi|254455435|ref|ZP_05068864.1| Organic solvent tolerance protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082437|gb|EDZ59863.1| Organic solvent tolerance protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 1014

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 9/83 (10%), Positives = 25/83 (30%), Gaps = 1/83 (1%)

Query: 120 MYLFAHSARFNLANHTLYISQPFKM-KVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
           + + A +  +N   + +      K+    +N  +  + A          +       +  
Sbjct: 118 IVIDADNFEYNKIKNIINAYGNVKIDNHDENYLIYTDEATYQKNKDVFTTKGKSKAINEG 177

Query: 179 FVLSANFARIENSSRSAVFAGQV 201
            ++ A+      S+      G V
Sbjct: 178 IIIDADNFEYNKSNNVINANGNV 200



 Score = 43.2 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 14/129 (10%), Positives = 37/129 (28%), Gaps = 9/129 (6%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT 135
                  Y +  + A    N             T    ++    + + A +  +N +N+ 
Sbjct: 142 IDNHDENYLIYTDEATYQKNKD--------VFTTKGKSKAINEGIIIDADNFEYNKSNNV 193

Query: 136 LYISQPFKMKVK-DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           +  +    +  K +N  +  + A          +       + D V++ +         +
Sbjct: 194 INANGNVAIDNKVENYLIYADDATYLKNEQLFLTKGHSKAINEDIVINGDNFEYNRIDNT 253

Query: 195 AVFAGQVSV 203
               G V +
Sbjct: 254 INAEGNVKI 262



 Score = 42.4 bits (98), Expect = 0.040,   Method: Composition-based stats.
 Identities = 8/83 (9%), Positives = 25/83 (30%), Gaps = 1/83 (1%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
           + A +  ++   + L      ++  +  N+ +  +       N    ++       +  V
Sbjct: 60  IKAKNFEYDKIKNILIAFGNVEIIDEKENIIIKSQKITYLKNNEFFFTNGKSKAISTGIV 119

Query: 181 LSANFARIENSSRSAVFAGQVSV 203
           + A+              G V +
Sbjct: 120 IDADNFEYNKIKNIINAYGNVKI 142


>gi|114798835|ref|YP_758937.1| OstA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114739009|gb|ABI77134.1| OstA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 178

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 44/159 (27%), Gaps = 18/159 (11%)

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKT-------------SFNSGKGIIFLQDFELTVP 111
            ++M     +  S D     + +ER ++                 G   +      +   
Sbjct: 14  GLLMGAPAFAQISSDGGPIYINSERTESLERERKVLLVGNVDIRQGTARLRADTVTIQFA 73

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q+ E         +  F     ++             L+   +    ++   TI  +  
Sbjct: 74  PQQGETAAQPAQGVAGSF-GQVESILAEGNVYYVT-PELKAKGDRGNYELATDTIVMTGN 131

Query: 172 VIITHSDFVLSANFARIENSSRSAVFAGQ---VSVVVNP 207
           V +     V       +E ++R     G      +V++P
Sbjct: 132 VALMRDRDVAEGQRLVMEVTNRRTRLEGGGGRTRMVIDP 170


>gi|227538585|ref|ZP_03968634.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|300770130|ref|ZP_07080009.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|227241504|gb|EEI91519.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|300762606|gb|EFK59423.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 200

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/188 (10%), Positives = 51/188 (27%), Gaps = 4/188 (2%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMK-KFILSDYSKD 79
             FI  LK   P + +  +G  LL S            ++   E + +     ++     
Sbjct: 2   TAFISILKHTLPLSIILWLGAILLHSCEPDLKEVDRIANMKKGEAVDISYGVTITYSDSA 61

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
            VK  L +   +   ++     F +  ++       +     + +  A       T    
Sbjct: 62  LVKAVLTSPEMRVHHDTTSNYEFPKGVKIVFYDALGKESQ-QIVSDYAIQREKEKTTTFK 120

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII--THSDFVLSANFARIENSSRSAVF 197
           +   +   D   +  E  + D  + +  +   +          L  +    +   +    
Sbjct: 121 KNVVITRIDGSIIKTEELIYDENSDSFYNHVMITGFFKDGRGNLQGSSFTSDADFKDVRI 180

Query: 198 AGQVSVVV 205
                +  
Sbjct: 181 QNATGLYY 188


>gi|294675673|ref|YP_003576288.1| OstA family protein [Rhodobacter capsulatus SB 1003]
 gi|294474493|gb|ADE83881.1| OstA family protein [Rhodobacter capsulatus SB 1003]
          Length = 161

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 47/186 (25%), Gaps = 33/186 (17%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
            F P      +     ++  +   F     D                         + A+
Sbjct: 2   RFLPALAGLTLALGFGAALAQEVAFPGLRTDPDAQV-------------------EVTAD 42

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHT-----LYISQPFK 143
                   G  +       +         G M L A                L+ S    
Sbjct: 43  SLSVHQADGSAVFTGNVLIVQ--------GPMRLKAEKVEVEYGADRSRIAKLHASGGVT 94

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           +        +   AV +V    +  +  V++T    VLS     I+  + +    G+V  
Sbjct: 95  LV-SGKDAAEAREAVYEVAAGAVELTGDVLLTQGPNVLSGQHMTIDLKTGTGRMDGRVRT 153

Query: 204 VVNPGV 209
           ++ PG 
Sbjct: 154 ILQPGE 159


>gi|256419553|ref|YP_003120206.1| hypothetical protein Cpin_0507 [Chitinophaga pinensis DSM 2588]
 gi|256034461|gb|ACU58005.1| protein of unknown function DUF1239 [Chitinophaga pinensis DSM
           2588]
          Length = 184

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 30/99 (30%), Gaps = 7/99 (7%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
           +    +   +  L A   ++   +  +++     +  K   RLD E    D K     S+
Sbjct: 81  LFYNDTLGVESTLTARYGKYFENDANVFLKDHVVVINKKGERLDCEELNWDSKQQKFLSN 140

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
            PV I+     L                      +++P 
Sbjct: 141 KPVRISTVTDTLYGTGLESNQDFSDY-------TILHPS 172


>gi|238785095|ref|ZP_04629090.1| hypothetical protein yberc0001_160 [Yersinia bercovieri ATCC 43970]
 gi|238713987|gb|EEQ06004.1| hypothetical protein yberc0001_160 [Yersinia bercovieri ATCC 43970]
          Length = 174

 Score = 46.6 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/175 (10%), Positives = 55/175 (31%), Gaps = 9/175 (5%)

Query: 37  TIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFN 95
            I    +  +    +     ++   +      +      ++      Y L+AE  +   +
Sbjct: 1   MIALALIGWNMSGFNQQDTQTVADNNEPSSQSQHTTTVVFNPVGQLSYKLIAEDVQNFSS 60

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV----KDNLR 151
             + + +     +T+    +      + A  A+    +  LY+    ++          +
Sbjct: 61  --QQLTWFTKPVMTMF-GDNAVATWTVRADRAKL-TDDKMLYLYGHVEVDSLTPDAQLKK 116

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +  + A +++    ++S D V +    F  +    R     ++A    +V     
Sbjct: 117 IKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELIEKVKTSYE 171


>gi|296104912|ref|YP_003615058.1| lipopolysaccharide export system protein LptC [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295059371|gb|ADF64109.1| lipopolysaccharide export system protein LptC [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 191

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 62/192 (32%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSS--WIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++        + ++G  L            +       D    ++         +
Sbjct: 2   SKTRRWVIILLSLVALILIGVNLADRDDTQTEVINNNDPTYKSDHSDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S  GI +     +T   +  +     + +  A+    +  LY+
Sbjct: 56  GALNYRLIAQHVE--YFSDDGISWFTQPVMTTFDKD-KVPTWSIKSDRAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          ++  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALTADSQLRKITTDNAQINLVTQDVTSQDLVTLYGTTFNSSGLRMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|313207104|ref|YP_004046281.1| osta family protein [Riemerella anatipestifer DSM 15868]
 gi|312446420|gb|ADQ82775.1| OstA family protein [Riemerella anatipestifer DSM 15868]
 gi|315022499|gb|EFT35526.1| hypothetical protein RAYM_04841 [Riemerella anatipestifer RA-YM]
 gi|325335458|gb|ADZ11732.1| OstA family protein [Riemerella anatipestifer RA-GD]
          Length = 583

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/88 (12%), Positives = 25/88 (28%), Gaps = 1/88 (1%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L A    F   ++ +       +   +  R+  +    D K     +   V++T     +
Sbjct: 85  LKADKVVFYQNDNFVKAIGNVVLTTAEGNRITSQEMEYDSKTQRGIARKNVVLTDPQQTI 144

Query: 182 SANFARIENSSRSAVFAGQVSVVVNPGV 209
                  +    +A F      + N   
Sbjct: 145 KTETLYYDRLPNTAYFNSGG-TIYNGKN 171



 Score = 40.1 bits (92), Expect = 0.20,   Method: Composition-based stats.
 Identities = 12/111 (10%), Positives = 39/111 (35%), Gaps = 3/111 (2%)

Query: 105 DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNI 164
           + + TV     +   ++  +   R +L           + +      L  +  V    + 
Sbjct: 39  NTKGTVAGNEEKLKHIHSDSLVRRPDLYEGNPVFIGNVEFQH-QGSVLKADKVVFYQNDN 97

Query: 165 TINSSDPVIITHSDFV-LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
            + +   V++T ++   +++     ++ ++  +    V +  +P    K E
Sbjct: 98  FVKAIGNVVLTTAEGNRITSQEMEYDSKTQRGIARKNVVLT-DPQQTIKTE 147



 Score = 40.1 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 28/84 (33%), Gaps = 1/84 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +   +  ++   +T Y +            +  +    ++   TI+ S  V I +  + 
Sbjct: 143 TIKTETLYYDRLPNTAYFNSG-GTIYNGKNTIWTQVGTYNINTQTIDVSGNVSIDNDKYR 201

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           +  +       +  A F G   V+
Sbjct: 202 VEGSKIIQNQKTNIAEFLGATKVI 225



 Score = 38.9 bits (89), Expect = 0.42,   Method: Composition-based stats.
 Identities = 11/133 (8%), Positives = 35/133 (26%), Gaps = 9/133 (6%)

Query: 70  KFILSDYSK-DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
             +     +       L A++    + +   +  + +  LT            + +    
Sbjct: 69  NPVFIGNVEFQHQGSVLKADKVV-FYQNDNFVKAIGNVVLTTAEGN------RITSQEME 121

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
           ++         +   +       +  ET   D    T   +    I +    +       
Sbjct: 122 YDSKTQRGIARKNVVL-TDPQQTIKTETLYYDRLPNTAYFNSGGTIYNGKNTIWTQVGTY 180

Query: 189 ENSSRSAVFAGQV 201
             ++++   +G V
Sbjct: 181 NINTQTIDVSGNV 193


>gi|295132516|ref|YP_003583192.1| hypothetical protein ZPR_0641 [Zunongwangia profunda SM-A87]
 gi|294980531|gb|ADF50996.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 169

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 8/92 (8%), Positives = 20/92 (21%), Gaps = 1/92 (1%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
           +     +     + A           + +     +   D+ RL+ +    D     + + 
Sbjct: 67  IEFFDEDDQKSTVTADYGIVYDGTGLVDLRGNVVIFTADSTRLEGDQLYWDQNQSWVFTD 126

Query: 170 DPVIITHSDFVL-SANFARIENSSRSAVFAGQ 200
               I   D             +     F   
Sbjct: 127 RENQIKFPDGSFNEGMGFDSNQNFDKFNFRTN 158


>gi|311277828|ref|YP_003940059.1| hypothetical protein Entcl_0497 [Enterobacter cloacae SCF1]
 gi|308747023|gb|ADO46775.1| protein of unknown function DUF1239 [Enterobacter cloacae SCF1]
          Length = 191

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 67/192 (34%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++        + ++G+  ++    +     S       +    ++         +
Sbjct: 2   SKTRRWVIILLSLVALVLIGYNFVNKDDAVHPIANSNDPTYKSEHTDTLVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+AE  +  + S   + + +   LT     ++     + A  A+    +  LY+
Sbjct: 56  GALNYRLIAEHVE--YFSDDAVSWFEHPLLT-TYDVNKVATWSIKADRAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          ++  + A++++    ++S D V +  + F  S    R    S++
Sbjct: 112 YGHVEINALTPDSQLRKITTDNAMVNLITQDVSSDDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|149190590|ref|ZP_01868859.1| hypothetical protein VSAK1_01954 [Vibrio shilonii AK1]
 gi|148835588|gb|EDL52556.1| hypothetical protein VSAK1_01954 [Vibrio shilonii AK1]
          Length = 187

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 48/181 (26%), Gaps = 18/181 (9%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN 95
           + I+              S   I         ++    S  +   + YS    R+ T  +
Sbjct: 11  LAIISIGCAVYLYTKDESSTIQIVPD------IELPAFSGINVHNISYSDTGIRSYTINS 64

Query: 96  ------SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--- 146
                 + KG    +   L++        +  + A  A  +  +  L +      +    
Sbjct: 65  VHLEHFAQKGNTIFESPVLSIY-ANGTTKEWEISADKAILD-KDEVLTLYDNVLAQNLLP 122

Query: 147 -KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                 L  +   + + N    S   VI+    F       +   +   A    +V+   
Sbjct: 123 ESGFDTLSTQKMSIKLTNRDFWSDTKVIMLGPQFETRGEAMKGNFADNIAEVYNKVNSRY 182

Query: 206 N 206
            
Sbjct: 183 E 183


>gi|313892388|ref|ZP_07825980.1| OstA-like protein [Dialister microaerophilus UPII 345-E]
 gi|313119247|gb|EFR42447.1| OstA-like protein [Dialister microaerophilus UPII 345-E]
          Length = 234

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/107 (14%), Positives = 29/107 (27%), Gaps = 2/107 (1%)

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAV 158
            I  L    +             + A    ++    T+  +    +       +   +  
Sbjct: 3   NIYKLITVIIFTFLSVGSVFAADITADELVYDSQTKTVSATGNVVIN-DGESTITGASGK 61

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
            D  + T   S  V  T +   LS     I  S ++    G V +  
Sbjct: 62  YDFNDKTAILSGGVNYTKNQDTLSCETLYIY-SDKTINGKGNVELDF 107



 Score = 37.0 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/182 (6%), Positives = 40/182 (21%), Gaps = 16/182 (8%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN--- 95
           +   ++ +++ + +   + I   +             Y       S              
Sbjct: 7   LITVIIFTFLSVGSVFAADITADELV-----------YDSQTKTVSATGNVVINDGESTI 55

Query: 96  -SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDF 154
               G     D    +    +   +    +    +  ++ T+      ++  K       
Sbjct: 56  TGASGKYDFNDKTAILSGGVNYTKNQDTLSCETLYIYSDKTINGKGNVELDFKSENIFLS 115

Query: 155 -ETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
            +    +        +        D ++ A              +G V +      +   
Sbjct: 116 GDEISYNQNTGIGQINGNGYFKSQDGIIRAPQIEGHLKDVLITASGGVEITAYTQNVHAT 175

Query: 214 EN 215
            N
Sbjct: 176 GN 177


>gi|297566503|ref|YP_003685475.1| OstA family protein [Meiothermus silvanus DSM 9946]
 gi|296850952|gb|ADH63967.1| OstA family protein [Meiothermus silvanus DSM 9946]
          Length = 296

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/128 (8%), Positives = 36/128 (28%), Gaps = 7/128 (5%)

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSA--RFNLANH 134
            K+     + A +     ++        +  L    Q  +   +Y         FN    
Sbjct: 130 DKEGDPVEVTANKMTFDVDTDISTSEG-NVSLKNGRQEGKSDTVYYEEKRGLAVFNDKEQ 188

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
            +   +    +   +L +  +      ++  + ++  V +   +   +      ++ +  
Sbjct: 189 VVLTRR----RTDGDLVIRAKEVRSLTEDKRLIATGGVTLVDGNITTTGASLSYDDKTGI 244

Query: 195 AVFAGQVS 202
           A   G   
Sbjct: 245 AFITGNAR 252



 Score = 40.9 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 43/128 (33%), Gaps = 8/128 (6%)

Query: 84  SLVAERAKTSFNSGKGIIFLQDF-ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
            + A   +  ++   G   L+   ++    +  E   + + A+   F++           
Sbjct: 99  RMTATGPRLVYSEKTGQGVLEGPAKMRQEPKDKEGDPVEVTANKMTFDVDTDISTSEGNV 158

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDP--VII----THSDFVLSANFARIENSSRSAV 196
            +K         +T   + K      +D   V++    T  D V+ A   R     +  +
Sbjct: 159 SLK-NGRQEGKSDTVYYEEKRGLAVFNDKEQVVLTRRRTDGDLVIRAKEVRSLTEDKRLI 217

Query: 197 FAGQVSVV 204
             G V++V
Sbjct: 218 ATGGVTLV 225


>gi|33863016|ref|NP_894576.1| hypothetical protein PMT0744 [Prochlorococcus marinus str. MIT
           9313]
 gi|33634933|emb|CAE20919.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 394

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 55/198 (27%), Gaps = 20/198 (10%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVAE 88
             P   +  +   +     + S   +         P + K   L     D    + L + 
Sbjct: 5   LLPLRHLGSLLLIITMVGCQESPSPQKK----SSVPFVFKSLELRHKQADGSRDWDLNSP 60

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A+  +  G  ++  ++ E  +           + A +A       T+ +    K++   
Sbjct: 61  LAR--YELGSRVVRARNPEGVLYK--GNKPSFEVSAQAATVLNDGETVLLEGNVKVQQLK 116

Query: 149 NLR--LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV--- 203
             +  +  +      K   +          +   +SA     +  ++  VF G       
Sbjct: 117 GEKVLITGDRLRWTPKESKMVIEQRPQALDNLSRISAKTVLFQQLTQEIVFKGPTKFERW 176

Query: 204 ------VVNPGVLQKKEN 215
                    P ++ +  N
Sbjct: 177 KKQRNYNYEPSIVIRGHN 194


>gi|170765632|ref|ZP_02900443.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170124778|gb|EDS93709.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 191

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMTEKDDIAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|167753141|ref|ZP_02425268.1| hypothetical protein ALIPUT_01412 [Alistipes putredinis DSM 17216]
 gi|167659455|gb|EDS03585.1| hypothetical protein ALIPUT_01412 [Alistipes putredinis DSM 17216]
          Length = 242

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/187 (13%), Positives = 54/187 (28%), Gaps = 18/187 (9%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLL---DFEPMIMKKFILSDYSKDRV-KYSLVAE 88
            A +      LL S  + S   + + + L     E + M        +++    Y   A 
Sbjct: 11  VALLIAGSAILLYSCDKESVAEEPNDEALMTEYSEHLTMTN------TENGRKSYVFTAP 64

Query: 89  RAK-TSFNSGKGIIFLQDFELTVPTQRSEYG-DMYLFAHSARFNLANHTLYISQPFKMKV 146
             +  S        F +  ++    + S    D  L A+ A                +K 
Sbjct: 65  LVEGYSLAKEPYQEFRKGVDIVTYQKDSTGAVDATLTANYAIHYGNRKLWEAKGNVVVKK 124

Query: 147 KDNLRLDFETAVLDVKNITIN--SSDPVIITHSDFVLSANFARIENSSRSAVF---AGQV 201
            +   L  +    + K   I       ++    +  +       ++  +   F    G++
Sbjct: 125 SNGQELYTQQLFWNEKTRRIWSNVDSKIVEESGNSYIV-EGFESDDQLKDWKFRRIKGRM 183

Query: 202 SVVVNPG 208
            V + P 
Sbjct: 184 WVNIEPT 190


>gi|325955679|ref|YP_004239339.1| OstA family protein [Weeksella virosa DSM 16922]
 gi|323438297|gb|ADX68761.1| OstA family protein [Weeksella virosa DSM 16922]
          Length = 554

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 39/124 (31%), Gaps = 8/124 (6%)

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + A++ +   +  KG   L    +    + +      L A SA F    +        ++
Sbjct: 36  IAADKLERDPDRFKGNQILTG-NVQFDHKGTI-----LTADSAVFYQKENFFVAWSRVRV 89

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             +    +  +    D       +      T     ++AN      ++  A   G V + 
Sbjct: 90  V-EQEKTISADYMEYDGNTTIAKAKGNARFTDPQNTITANEMDYNRTTEIAYARGDVVM- 147

Query: 205 VNPG 208
           +NP 
Sbjct: 148 INPN 151


>gi|268316163|ref|YP_003289882.1| OstA family protein [Rhodothermus marinus DSM 4252]
 gi|262333697|gb|ACY47494.1| OstA family protein [Rhodothermus marinus DSM 4252]
          Length = 496

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 23/84 (27%), Gaps = 1/84 (1%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
           G + + A    +             ++       L  +  V             V +T  
Sbjct: 119 GTVTVEAPLGWYYTREKRAVFEAGVRLA-DSAAVLTSQRGVYWSDEKRAEFYGNVRLTGE 177

Query: 178 DFVLSANFARIENSSRSAVFAGQV 201
           +  L A+       +  A+  G+V
Sbjct: 178 NRYLEADTVVYFRDTEVALAQGRV 201


>gi|114332260|ref|YP_748482.1| hypothetical protein Neut_2300 [Nitrosomonas eutropha C91]
 gi|114309274|gb|ABI60517.1| protein of unknown function DUF1239 [Nitrosomonas eutropha C91]
          Length = 193

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/125 (12%), Positives = 41/125 (32%), Gaps = 9/125 (7%)

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
             A++      S + I  L+       +   +   + + +  A        +++++   +
Sbjct: 64  FSADKLI--HYSTEDITQLEHVR--FTSIEPDKPLLRVTSDWAELTKDGDDIFLTENVSI 119

Query: 145 K-----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                  KD + +  +   L        +  PV +   + VL+A    + N +   +   
Sbjct: 120 IRGEDLDKDKVTMLTDFLHLIPDTDIAKTDRPVTVIRMNSVLNAVGLFMNNRTGEILMQS 179

Query: 200 QVSVV 204
           +V   
Sbjct: 180 RVKAH 184


>gi|304392007|ref|ZP_07373949.1| organic solvent tolerance protein [Ahrensia sp. R2A130]
 gi|303296236|gb|EFL90594.1| organic solvent tolerance protein [Ahrensia sp. R2A130]
          Length = 799

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/110 (12%), Positives = 31/110 (28%), Gaps = 8/110 (7%)

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           LVA  A     +    +           QR     + L A    ++  N  +      +M
Sbjct: 33  LVAAPALQGIGTTSSAL------AQSLEQRDPNAQLLLKADELIYDNDNEIVTARGNVQM 86

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV-LSANFARIENSSR 193
                  +  +    + +   + +   V I   D   + A+   + +   
Sbjct: 87  DYD-GYNVVADRVSYNQQTRRVKAFGNVEILEPDGNRIFADEIDLTDDFG 135



 Score = 35.8 bits (81), Expect = 3.6,   Method: Composition-based stats.
 Identities = 21/194 (10%), Positives = 51/194 (26%), Gaps = 28/194 (14%)

Query: 22  RFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
           R I          +  +V    L      S+    S++  D    ++             
Sbjct: 18  RRIASAARLL-LLSTALVAAPALQGIGTTSSALAQSLEQRDPNAQLL------------- 63

Query: 82  KYSLVAERAKTSFNSGKGIIFLQ-DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
              L A+      ++   I+  + + ++             + A    +N     +    
Sbjct: 64  ---LKADELIYDNDN--EIVTARGNVQMDYDGYN-------VVADRVSYNQQTRRVKAFG 111

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
             ++   D  R+  +   L         +  + +   D    A  +    + +  VF   
Sbjct: 112 NVEILEPDGNRIFADEIDLTDDFGEGFVN-ALRVETPDNTRFAAESAERFAGQKTVFNHG 170

Query: 201 VSVVVNPGVLQKKE 214
           V     P   +  +
Sbjct: 171 VYTACEPCKERPDK 184


>gi|320661948|gb|EFX29356.1| lipopolysaccharide exporter periplasmic protein [Escherichia coli
           O55:H7 str. USDA 5905]
          Length = 191

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GTLSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|332882654|ref|ZP_08450266.1| hypothetical protein HMPREF9074_06074 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332679454|gb|EGJ52439.1| hypothetical protein HMPREF9074_06074 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 557

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/178 (8%), Positives = 47/178 (26%), Gaps = 15/178 (8%)

Query: 37  TIVGWFLLS---SWIRISTFSKSSIDLLDFEPMIMKKFILSDYS---KDRVKYSLVAERA 90
            ++  F      +  +        I+++      +        +    D  +        
Sbjct: 8   ILLSVFAFWLQEAIAQTEPPKTKRIEIIYGGEFTIDNVKYPGATIFKTDGQRVQFR---- 63

Query: 91  KTSFNSGKGIIFL----QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
                    +  L     +          +   + + +    +     T    Q   ++ 
Sbjct: 64  HQGLEVWCDLAVLYEERNEVIAHGDVVLQQGDTLQMNSQYVAYKGNTKTAVAKQNVVLR- 122

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             N+ L+ +    D        ++   IT  D  L++   +   +++   F   V +V
Sbjct: 123 NGNMTLETQELFFDRNTQEAYYNNFGKITDPDNELTSKTGKYYATTKKNQFTNSVKIV 180


>gi|257452892|ref|ZP_05618191.1| S-layer protein [Fusobacterium sp. 3_1_5R]
 gi|317059434|ref|ZP_07923919.1| predicted protein [Fusobacterium sp. 3_1_5R]
 gi|313685110|gb|EFS21945.1| predicted protein [Fusobacterium sp. 3_1_5R]
          Length = 797

 Score = 46.2 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 29/97 (29%), Gaps = 3/97 (3%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
           +   R E   +YL     ++      +        +     +L  +    D     +N  
Sbjct: 703 LSEYRGEKARVYLKKEQNQYRAKKLEV-FEDAVFSQED--KKLRGKRGQYDFDTSLVNFY 759

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             V  T  D  + ++       ++ A   G V +  N
Sbjct: 760 GDVSFTSKDGNIRSDEMIYNTQTKKAKAKGNVELHYN 796



 Score = 40.5 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 11/113 (9%), Positives = 33/113 (29%), Gaps = 9/113 (7%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
            A        +G+  I            R +  +     + A ++     + ++    + 
Sbjct: 259 NANLLAIDKKAGEDFITFVGPI------RGQNEEYTYSMNRAVYDTVKKEITMTGNIDIL 312

Query: 146 VKDNLRLDFETAVLDVKNITINSS---DPVIITHSDFVLSANFARIENSSRSA 195
            +   R+  + A+   K   ++     + V    S   + A   + +  +   
Sbjct: 313 SRKGERIRADRAIYHEKEKLLDVYSDGNKVTYDGSGHHIEATSFQYDAKTGDV 365



 Score = 38.5 bits (88), Expect = 0.64,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 30/87 (34%), Gaps = 4/87 (4%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFE--TAVLDVKNITINSSDPVIITHS 177
           L    A ++ +   + +S   ++    KD      +    + DV+     +S P  I + 
Sbjct: 168 LRGEKAEYDDSTKKILLSGNIELYNPQKDGKEFRGKFGNMIYDVEKGRGETSLPFEIIYK 227

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVV 204
           + +L+A          +      V + 
Sbjct: 228 ETILNAEKMDFHPEENAFHLEQNVKIT 254


>gi|313145582|ref|ZP_07807775.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134349|gb|EFR51709.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 204

 Score = 45.9 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/175 (12%), Positives = 53/175 (30%), Gaps = 15/175 (8%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKY 83
           + L     F  + ++  F  SS    +     +I   D  P++  + + +  S     +Y
Sbjct: 11  KSLSITIVFGAIVMLLLF--SSCGGRNKAMADAITERDSLPVMDTRGVTTLISDSGVTRY 68

Query: 84  SLVAERAKTSFNSGKGI------IFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            +  E                  I+L+ F+           D  + A +A +   +    
Sbjct: 69  RVNTEEWLIFDKKKPSYWAFEKGIYLEQFDSLFHV------DASIKADTAYYYDRDRLWK 122

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSS 192
           +     +K      +  E    +     + +   V +   D V++      ++  
Sbjct: 123 LIGNVDIKSLKGDHVSTELLYWNEATKKVYTDKFVQMEQPDQVITGYGFESDDRF 177


>gi|300929895|ref|ZP_07145337.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300462181|gb|EFK25674.1| conserved hypothetical protein [Escherichia coli MS 187-1]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKTRRWVIIVLSLAVLVMIGINMAEKDDTAQMVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|331648999|ref|ZP_08350087.1| putative inner membrane protein [Escherichia coli M605]
 gi|330909251|gb|EGH37765.1| uncharacterized protein YrbK clustered with lipopolysaccharide
           transporter [Escherichia coli AA86]
 gi|331042746|gb|EGI14888.1| putative inner membrane protein [Escherichia coli M605]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVIVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|323165160|gb|EFZ50950.1| hypothetical protein SS53G_4625 [Shigella sonnei 53G]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGIDMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|15803739|ref|NP_289773.1| hypothetical protein Z4562 [Escherichia coli O157:H7 EDL933]
 gi|15833332|ref|NP_312105.1| hypothetical protein ECs4078 [Escherichia coli O157:H7 str. Sakai]
 gi|16131089|ref|NP_417666.1| lipopolysaccharide export, IM-tethered periplasmic protein of the
           LptBFGC export complex [Escherichia coli str. K-12
           substr. MG1655]
 gi|24114488|ref|NP_708998.1| hypothetical protein SF3239 [Shigella flexneri 2a str. 301]
 gi|26249785|ref|NP_755825.1| hypothetical protein c3959 [Escherichia coli CFT073]
 gi|30064537|ref|NP_838708.1| hypothetical protein S3457 [Shigella flexneri 2a str. 2457T]
 gi|82778513|ref|YP_404862.1| hypothetical protein SDY_3380 [Shigella dysenteriae Sd197]
 gi|89109962|ref|AP_003742.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|91212624|ref|YP_542610.1| hypothetical protein UTI89_C3635 [Escherichia coli UTI89]
 gi|110807065|ref|YP_690585.1| hypothetical protein SFV_3229 [Shigella flexneri 5 str. 8401]
 gi|117625491|ref|YP_858814.1| hypothetical protein APECO1_3236 [Escherichia coli APEC O1]
 gi|157155458|ref|YP_001464677.1| hypothetical protein EcE24377A_3687 [Escherichia coli E24377A]
 gi|157162683|ref|YP_001460001.1| hypothetical protein EcHS_A3392 [Escherichia coli HS]
 gi|168751605|ref|ZP_02776627.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754181|ref|ZP_02779188.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168763736|ref|ZP_02788743.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769055|ref|ZP_02794062.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777254|ref|ZP_02802261.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781343|ref|ZP_02806350.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168800913|ref|ZP_02825920.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|170018551|ref|YP_001723505.1| hypothetical protein EcolC_0501 [Escherichia coli ATCC 8739]
 gi|170082733|ref|YP_001732053.1| hypothetical protein ECDH10B_3373 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170680880|ref|YP_001745471.1| hypothetical protein EcSMS35_3495 [Escherichia coli SMS-3-5]
 gi|187731164|ref|YP_001881886.1| hypothetical protein SbBS512_E3571 [Shigella boydii CDC 3083-94]
 gi|188493109|ref|ZP_03000379.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|191168621|ref|ZP_03030403.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|193065387|ref|ZP_03046458.1| conserved hypothetical protein [Escherichia coli E22]
 gi|193070332|ref|ZP_03051275.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194429144|ref|ZP_03061674.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194434495|ref|ZP_03066755.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|195940055|ref|ZP_03085437.1| hypothetical protein EscherichcoliO157_27290 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208806328|ref|ZP_03248665.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813337|ref|ZP_03254666.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821044|ref|ZP_03261364.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400931|ref|YP_002272669.1| hypothetical protein ECH74115_4521 [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920674|ref|YP_002294758.1| hypothetical protein ECSE_3483 [Escherichia coli SE11]
 gi|215488515|ref|YP_002330946.1| hypothetical protein E2348C_3478 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217327360|ref|ZP_03443443.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218555769|ref|YP_002388682.1| hypothetical protein ECIAI1_3347 [Escherichia coli IAI1]
 gi|218560269|ref|YP_002393182.1| hypothetical protein ECS88_3582 [Escherichia coli S88]
 gi|218691489|ref|YP_002399701.1| hypothetical protein ECED1_3857 [Escherichia coli ED1a]
 gi|218696904|ref|YP_002404571.1| hypothetical protein EC55989_3617 [Escherichia coli 55989]
 gi|218706819|ref|YP_002414338.1| hypothetical protein ECUMN_3679 [Escherichia coli UMN026]
 gi|227887920|ref|ZP_04005725.1| conserved hypothetical protein [Escherichia coli 83972]
 gi|237706049|ref|ZP_04536530.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|238902301|ref|YP_002928097.1| hypothetical protein BWG_2901 [Escherichia coli BW2952]
 gi|254038364|ref|ZP_04872422.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|254795148|ref|YP_003079985.1| hypothetical protein ECSP_4174 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256018882|ref|ZP_05432747.1| hypothetical protein ShiD9_08193 [Shigella sp. D9]
 gi|256024226|ref|ZP_05438091.1| hypothetical protein E4_12683 [Escherichia sp. 4_1_40B]
 gi|260846012|ref|YP_003223790.1| inner membrane protein [Escherichia coli O103:H2 str. 12009]
 gi|260857326|ref|YP_003231217.1| inner membrane protein [Escherichia coli O26:H11 str. 11368]
 gi|260869950|ref|YP_003236352.1| inner membrane protein [Escherichia coli O111:H- str. 11128]
 gi|291284573|ref|YP_003501391.1| hypothetical protein G2583_3924 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406808|ref|ZP_06650734.1| hypothetical protein ECGG_02118 [Escherichia coli FVEC1412]
 gi|293412570|ref|ZP_06655293.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293416628|ref|ZP_06659267.1| hypothetical protein ECDG_03388 [Escherichia coli B185]
 gi|293449532|ref|ZP_06663953.1| hypothetical protein ECCG_02565 [Escherichia coli B088]
 gi|298382549|ref|ZP_06992146.1| hypothetical protein ECFG_02310 [Escherichia coli FVEC1302]
 gi|300817546|ref|ZP_07097762.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300823835|ref|ZP_07103959.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300897967|ref|ZP_07116343.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300904391|ref|ZP_07122239.1| hypothetical protein HMPREF9536_02470 [Escherichia coli MS 84-1]
 gi|300918961|ref|ZP_07135516.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300926056|ref|ZP_07141878.1| hypothetical protein HMPREF9548_04084 [Escherichia coli MS 182-1]
 gi|300938115|ref|ZP_07152889.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300948854|ref|ZP_07162919.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300955788|ref|ZP_07168130.1| hypothetical protein HMPREF9547_01647 [Escherichia coli MS 175-1]
 gi|300990929|ref|ZP_07179381.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|301022101|ref|ZP_07186027.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|301025899|ref|ZP_07189386.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301047954|ref|ZP_07194999.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|301306745|ref|ZP_07212799.1| hypothetical protein HMPREF9347_05346 [Escherichia coli MS 124-1]
 gi|301326368|ref|ZP_07219732.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301644913|ref|ZP_07244882.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|306816459|ref|ZP_07450591.1| hypothetical protein ECNC101_07574 [Escherichia coli NC101]
 gi|307139885|ref|ZP_07499241.1| hypothetical protein EcolH7_17358 [Escherichia coli H736]
 gi|307313096|ref|ZP_07592722.1| protein of unknown function DUF1239 [Escherichia coli W]
 gi|309785527|ref|ZP_07680158.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309793778|ref|ZP_07688204.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|312968462|ref|ZP_07782671.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312972527|ref|ZP_07786701.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331643897|ref|ZP_08345028.1| putative inner membrane protein [Escherichia coli H736]
 gi|331654803|ref|ZP_08355803.1| putative inner membrane protein [Escherichia coli M718]
 gi|331659486|ref|ZP_08360428.1| putative inner membrane protein [Escherichia coli TA206]
 gi|331670026|ref|ZP_08370871.1| putative inner membrane protein [Escherichia coli TA271]
 gi|331674728|ref|ZP_08375487.1| putative inner membrane protein [Escherichia coli TA280]
 gi|331679278|ref|ZP_08379950.1| putative inner membrane protein [Escherichia coli H591]
 gi|331684846|ref|ZP_08385438.1| putative inner membrane protein [Escherichia coli H299]
 gi|332279970|ref|ZP_08392383.1| conserved hypothetical protein [Shigella sp. D9]
 gi|83288359|sp|P0ADW1|LPTC_ECO57 RecName: Full=Lipopolysaccharide export system protein lptC
 gi|83288360|sp|P0ADW0|LPTC_ECOL6 RecName: Full=Lipopolysaccharide export system protein lptC
 gi|83288361|sp|P0ADV9|LPTC_ECOLI RecName: Full=Lipopolysaccharide export system protein lptC
 gi|83288362|sp|P0ADW2|LPTC_SHIFL RecName: Full=Lipopolysaccharide export system protein lptC
 gi|12517817|gb|AAG58333.1|AE005548_4 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26110213|gb|AAN82399.1|AE016767_159 Hypothetical protein yrbK [Escherichia coli CFT073]
 gi|606138|gb|AAA58001.1| ORF_o191 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789591|gb|AAC76231.1| lipopolysaccharide export, IM-tethered periplasmic protein of the
           LptBFGC export complex [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363551|dbj|BAB37501.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24053673|gb|AAN44705.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30042796|gb|AAP18519.1| hypothetical protein S3457 [Shigella flexneri 2a str. 2457T]
 gi|81242661|gb|ABB63371.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|85675993|dbj|BAE77243.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|91074198|gb|ABE09079.1| hypothetical protein UTI89_C3635 [Escherichia coli UTI89]
 gi|110616613|gb|ABF05280.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115514615|gb|ABJ02690.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157068363|gb|ABV07618.1| conserved hypothetical protein [Escherichia coli HS]
 gi|157077488|gb|ABV17196.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|169753479|gb|ACA76178.1| protein of unknown function DUF1239 [Escherichia coli ATCC 8739]
 gi|169890568|gb|ACB04275.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170518598|gb|ACB16776.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187428156|gb|ACD07430.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|187767472|gb|EDU31316.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014381|gb|EDU52503.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188488308|gb|EDU63411.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|189001026|gb|EDU70012.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358528|gb|EDU76947.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361779|gb|EDU80198.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189366135|gb|EDU84551.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189376814|gb|EDU95230.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|190901315|gb|EDV61082.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|192927028|gb|EDV81651.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192956391|gb|EDV86851.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194412869|gb|EDX29161.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194417274|gb|EDX33383.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|208726129|gb|EDZ75730.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734614|gb|EDZ83301.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741167|gb|EDZ88849.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162331|gb|ACI39764.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209758048|gb|ACI77336.1| hypothetical protein ECs4078 [Escherichia coli]
 gi|209758050|gb|ACI77337.1| hypothetical protein ECs4078 [Escherichia coli]
 gi|209758052|gb|ACI77338.1| hypothetical protein ECs4078 [Escherichia coli]
 gi|209758054|gb|ACI77339.1| hypothetical protein ECs4078 [Escherichia coli]
 gi|209758056|gb|ACI77340.1| hypothetical protein ECs4078 [Escherichia coli]
 gi|209913933|dbj|BAG79007.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266587|emb|CAS11026.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217319727|gb|EEC28152.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218353636|emb|CAU99846.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218362537|emb|CAR00161.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218367038|emb|CAR04809.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218429053|emb|CAR09999.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218433916|emb|CAR14833.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222034916|emb|CAP77659.1| Uncharacterized protein yrbK [Escherichia coli LF82]
 gi|226839988|gb|EEH72009.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226899089|gb|EEH85348.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227835316|gb|EEJ45782.1| conserved hypothetical protein [Escherichia coli 83972]
 gi|238860534|gb|ACR62532.1| conserved protein [Escherichia coli BW2952]
 gi|254594548|gb|ACT73909.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257755975|dbj|BAI27477.1| inner membrane protein [Escherichia coli O26:H11 str. 11368]
 gi|257761159|dbj|BAI32656.1| inner membrane protein [Escherichia coli O103:H2 str. 12009]
 gi|257766306|dbj|BAI37801.1| inner membrane protein [Escherichia coli O111:H- str. 11128]
 gi|260447774|gb|ACX38196.1| protein of unknown function DUF1239 [Escherichia coli DH1]
 gi|281180241|dbj|BAI56571.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281602582|gb|ADA75566.1| hypothetical protein SFxv_3552 [Shigella flexneri 2002017]
 gi|284923221|emb|CBG36315.1| putative organic solvent tolerance protein [Escherichia coli 042]
 gi|290764446|gb|ADD58407.1| hypothetical protein G2583_3924 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291322622|gb|EFE62051.1| hypothetical protein ECCG_02565 [Escherichia coli B088]
 gi|291426814|gb|EFE99846.1| hypothetical protein ECGG_02118 [Escherichia coli FVEC1412]
 gi|291431984|gb|EFF04967.1| hypothetical protein ECDG_03388 [Escherichia coli B185]
 gi|291469341|gb|EFF11832.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294491070|gb|ADE89826.1| conserved hypothetical protein [Escherichia coli IHE3034]
 gi|298277689|gb|EFI19205.1| hypothetical protein ECFG_02310 [Escherichia coli FVEC1302]
 gi|299879921|gb|EFI88132.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300300186|gb|EFJ56571.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300317334|gb|EFJ67118.1| hypothetical protein HMPREF9547_01647 [Escherichia coli MS 175-1]
 gi|300358315|gb|EFJ74185.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300397697|gb|EFJ81235.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300403665|gb|EFJ87203.1| hypothetical protein HMPREF9536_02470 [Escherichia coli MS 84-1]
 gi|300407005|gb|EFJ90543.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|300413903|gb|EFJ97213.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300417914|gb|EFK01225.1| hypothetical protein HMPREF9548_04084 [Escherichia coli MS 182-1]
 gi|300451659|gb|EFK15279.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300456878|gb|EFK20371.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300523603|gb|EFK44672.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300529844|gb|EFK50906.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300838024|gb|EFK65784.1| hypothetical protein HMPREF9347_05346 [Escherichia coli MS 124-1]
 gi|300846932|gb|EFK74692.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301076764|gb|EFK91570.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|305850024|gb|EFM50483.1| hypothetical protein ECNC101_07574 [Escherichia coli NC101]
 gi|306907007|gb|EFN37515.1| protein of unknown function DUF1239 [Escherichia coli W]
 gi|307555292|gb|ADN48067.1| conserved hypothetical protein [Escherichia coli ABU 83972]
 gi|307625202|gb|ADN69506.1| hypothetical protein UM146_00385 [Escherichia coli UM146]
 gi|308122735|gb|EFO59997.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308926647|gb|EFP72123.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309703625|emb|CBJ02965.1| putative organic solvent tolerance protein [Escherichia coli ETEC
           H10407]
 gi|310334904|gb|EFQ01109.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312286680|gb|EFR14591.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312947756|gb|ADR28583.1| hypothetical protein NRG857_15865 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313648558|gb|EFS13000.1| hypothetical protein SF2457T_3022 [Shigella flexneri 2a str. 2457T]
 gi|315062505|gb|ADT76832.1| transporter subunit [Escherichia coli W]
 gi|315137785|dbj|BAJ44944.1| hypothetical protein ECDH1ME8569_3088 [Escherichia coli DH1]
 gi|315257127|gb|EFU37095.1| putative inner membrane protein [Escherichia coli MS 85-1]
 gi|315289002|gb|EFU48400.1| conserved hypothetical protein [Escherichia coli MS 110-3]
 gi|315294859|gb|EFU54198.1| conserved hypothetical protein [Escherichia coli MS 153-1]
 gi|315297935|gb|EFU57205.1| conserved hypothetical protein [Escherichia coli MS 16-3]
 gi|315617282|gb|EFU97891.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320174565|gb|EFW49701.1| hypothetical protein SDB_02907 [Shigella dysenteriae CDC 74-1112]
 gi|320181474|gb|EFW56392.1| hypothetical protein SGB_01344 [Shigella boydii ATCC 9905]
 gi|320189552|gb|EFW64211.1| hypothetical protein ECoD_04559 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194684|gb|EFW69314.1| hypothetical protein EcoM_03126 [Escherichia coli WV_060327]
 gi|320202113|gb|EFW76688.1| hypothetical protein ECoL_00741 [Escherichia coli EC4100B]
 gi|320645567|gb|EFX14576.1| lipopolysaccharide exporter periplasmic protein [Escherichia coli
           O157:H- str. 493-89]
 gi|320650877|gb|EFX19334.1| lipopolysaccharide exporter periplasmic protein [Escherichia coli
           O157:H- str. H 2687]
 gi|320656258|gb|EFX24170.1| lipopolysaccharide exporter periplasmic protein [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320666783|gb|EFX33762.1| lipopolysaccharide exporter periplasmic protein [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323154414|gb|EFZ40615.1| hypothetical protein ECEPECA14_3718 [Escherichia coli EPECa14]
 gi|323162891|gb|EFZ48726.1| hypothetical protein ECE128010_0853 [Escherichia coli E128010]
 gi|323173541|gb|EFZ59170.1| hypothetical protein ECLT68_1856 [Escherichia coli LT-68]
 gi|323178625|gb|EFZ64201.1| hypothetical protein ECOK1180_2356 [Escherichia coli 1180]
 gi|323183153|gb|EFZ68551.1| hypothetical protein ECOK1357_3570 [Escherichia coli 1357]
 gi|323189180|gb|EFZ74464.1| hypothetical protein ECRN5871_2779 [Escherichia coli RN587/1]
 gi|323376907|gb|ADX49175.1| protein of unknown function DUF1239 [Escherichia coli KO11]
 gi|323936107|gb|EGB32401.1| hypothetical protein ERCG_02565 [Escherichia coli E1520]
 gi|323941701|gb|EGB37880.1| hypothetical protein ERDG_01476 [Escherichia coli E482]
 gi|323946947|gb|EGB42963.1| hypothetical protein EREG_01524 [Escherichia coli H120]
 gi|323951282|gb|EGB47157.1| hypothetical protein ERKG_01925 [Escherichia coli H252]
 gi|323957654|gb|EGB53368.1| hypothetical protein ERLG_00980 [Escherichia coli H263]
 gi|323966379|gb|EGB61813.1| hypothetical protein ERJG_02311 [Escherichia coli M863]
 gi|323979084|gb|EGB74162.1| hypothetical protein ERFG_00077 [Escherichia coli TW10509]
 gi|324008711|gb|EGB77930.1| hypothetical protein HMPREF9532_01562 [Escherichia coli MS 57-2]
 gi|324018349|gb|EGB87568.1| hypothetical protein HMPREF9542_02990 [Escherichia coli MS 117-3]
 gi|324119564|gb|EGC13446.1| hypothetical protein ERBG_00592 [Escherichia coli E1167]
 gi|326337899|gb|EGD61733.1| hypothetical protein ECF_05525 [Escherichia coli O157:H7 str. 1125]
 gi|326347469|gb|EGD71194.1| hypothetical protein ECoA_00780 [Escherichia coli O157:H7 str.
           1044]
 gi|327251290|gb|EGE62979.1| hypothetical protein ECSTEC7V_3830 [Escherichia coli STEC_7v]
 gi|331037368|gb|EGI09592.1| putative inner membrane protein [Escherichia coli H736]
 gi|331048185|gb|EGI20262.1| putative inner membrane protein [Escherichia coli M718]
 gi|331054068|gb|EGI26097.1| putative inner membrane protein [Escherichia coli TA206]
 gi|331062939|gb|EGI34853.1| putative inner membrane protein [Escherichia coli TA271]
 gi|331068167|gb|EGI39563.1| putative inner membrane protein [Escherichia coli TA280]
 gi|331073343|gb|EGI44666.1| putative inner membrane protein [Escherichia coli H591]
 gi|331078461|gb|EGI49667.1| putative inner membrane protein [Escherichia coli H299]
 gi|332102322|gb|EGJ05668.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332345156|gb|AEE58490.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332752358|gb|EGJ82748.1| hypothetical protein SF434370_3433 [Shigella flexneri 4343-70]
 gi|332752884|gb|EGJ83269.1| hypothetical protein SFK671_3845 [Shigella flexneri K-671]
 gi|332754727|gb|EGJ85093.1| hypothetical protein SF274771_3826 [Shigella flexneri 2747-71]
 gi|332765195|gb|EGJ95422.1| lptC [Shigella flexneri 2930-71]
 gi|332998841|gb|EGK18437.1| hypothetical protein SFVA6_4125 [Shigella flexneri VA-6]
 gi|332999278|gb|EGK18864.1| hypothetical protein SFK272_4009 [Shigella flexneri K-272]
 gi|333000036|gb|EGK19619.1| hypothetical protein SFK218_4231 [Shigella flexneri K-218]
 gi|333014551|gb|EGK33898.1| hypothetical protein SFK304_4054 [Shigella flexneri K-304]
 gi|333015002|gb|EGK34346.1| hypothetical protein SFK227_3860 [Shigella flexneri K-227]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|217976353|ref|YP_002360500.1| lipopolysaccharide transport periplasmic protein LptA [Methylocella
           silvestris BL2]
 gi|217501729|gb|ACK49138.1| lipopolysaccharide transport periplasmic protein LptA [Methylocella
           silvestris BL2]
          Length = 207

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 32/82 (39%), Gaps = 1/82 (1%)

Query: 134 HTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSR 193
             +  + P  M  KD +    +  V +     +   D V +T    V   +    + +++
Sbjct: 108 RRMEATGPVTMITKDQVS-TGDRGVYEKAENKLYLYDNVTVTQGTNVTKGDKMTYDLTTK 166

Query: 194 SAVFAGQVSVVVNPGVLQKKEN 215
            A+  G+V  +  P    +K+N
Sbjct: 167 KAIVTGRVKSMFLPETTAQKDN 188


>gi|283788162|ref|YP_003368027.1| organic solvent tolerance protein [Citrobacter rodentium ICC168]
 gi|282951616|emb|CBG91316.1| putative organic solvent tolerance protein [Citrobacter rodentium
           ICC168]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 62/192 (32%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSK--SSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L    +               +    ++         +
Sbjct: 2   SKARRWVIILLSLAVLVLIGINLADKDVTAPVVVNTSDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+       LY+
Sbjct: 56  GALSYRLIAQNVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSIKADKAKL-TDERMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQVNLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AKLIEKVRTSYE 183


>gi|237736817|ref|ZP_04567298.1| S-layer protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420679|gb|EEO35726.1| S-layer protein [Fusobacterium mortiferum ATCC 9817]
          Length = 894

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/170 (11%), Positives = 55/170 (32%), Gaps = 12/170 (7%)

Query: 40  GWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKG 99
           G     S      + K+S         + +  +     K      L ++  +   N    
Sbjct: 731 GVITTFSGEFSRVYFKNSGKYEILRSEVRENAVFIQGDKK-----LKSDYIEIDSN---R 782

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFE 155
            +        +    +  G+  + +  A  ++      +    ++K  ++      +  +
Sbjct: 783 RLVFSKENTELTLVDAVNGETVIKSAVAEVDIDKDMATLIGNVQIKNNNSEYGLTNVTAD 842

Query: 156 TAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             ++  K  T+     V I +++ ++ A+    + +S+    +G V V  
Sbjct: 843 RGIIRQKAGTVELIGHVEIENNESIVQADRGIYDMNSKKIKASGNVYVDY 892



 Score = 40.5 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/109 (12%), Positives = 30/109 (27%), Gaps = 5/109 (4%)

Query: 93  SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRL 152
                 G   +      +      Y           +N  +  L I    K       ++
Sbjct: 263 DRVDKAGNSNILKIAGKIKGSDGTY---SFEGDKGEYNTESKVLTILGNIKGSSTKGEKI 319

Query: 153 DFETAVLDV--KNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
             +  V D   K +T++    V  + +D  L        + ++    +G
Sbjct: 320 AGDRLVYDTNSKLMTLSGDKNVKYSSADGELITKVFNYNSETKEMSTSG 368


>gi|332086226|gb|EGI91384.1| hypothetical protein SB521682_3766 [Shigella boydii 5216-82]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPPYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNASGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|331005054|ref|ZP_08328458.1| hypothetical protein IMCC1989_648 [gamma proteobacterium IMCC1989]
 gi|330421109|gb|EGG95371.1| hypothetical protein IMCC1989_648 [gamma proteobacterium IMCC1989]
          Length = 218

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 10/94 (10%), Positives = 29/94 (30%), Gaps = 6/94 (6%)

Query: 120 MYLFAHSARFNLANHTLYISQPFKMKVKDN------LRLDFETAVLDVKNITINSSDPVI 173
               +  A+    +  + +S    +  + +        ++ E  ++        +  PVI
Sbjct: 124 WRASSEIAKSINNDEEVLLSGNVLLIQQPHSSNEIPTTINSEELLIKPNLQYAETDKPVI 183

Query: 174 ITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
           I  +  V ++    +   + +      V     P
Sbjct: 184 IKDATSVTTSTGLTLSLDTNTVELLSNVRSRYEP 217


>gi|82545563|ref|YP_409510.1| hypothetical protein SBO_3183 [Shigella boydii Sb227]
 gi|81246974|gb|ABB67682.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|320186685|gb|EFW61409.1| hypothetical protein SGF_01134 [Shigella flexneri CDC 796-83]
 gi|332090709|gb|EGI95803.1| hypothetical protein SB359474_3685 [Shigella boydii 3594-74]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVTIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|257454875|ref|ZP_05620126.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257447808|gb|EEV22800.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 190

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 60/192 (31%), Gaps = 17/192 (8%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           K  F    + I+      +         S             K + +  +   V Y L A
Sbjct: 4   KTLFILGLLFIIVSAYFYTQNDARLTQVSLKPTDIDYQAEQIKALQTTETGS-VGYQLTA 62

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-- 145
            +             +   ++ +  +     ++ L A  A+ +       +     +   
Sbjct: 63  AQVT--HYQNANTAVMSKPQIVIRPKNER--EVTLVADQAQLDENKQIAKLIGNVTLTSV 118

Query: 146 ---------VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
                        +++  +  V D+ N T+ +++P+   H +    A     + ++    
Sbjct: 119 PLLTQNTSMSNLPVKMIGKNFVGDLVNNTVMTNEPLTFIHGNNRFDAKQFSGDLATGDYG 178

Query: 197 FAGQVSVVVNPG 208
           F GQVSV++ P 
Sbjct: 179 F-GQVSVMIQPA 189


>gi|254423398|ref|ZP_05037116.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196190887|gb|EDX85851.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 371

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/173 (15%), Positives = 47/173 (27%), Gaps = 25/173 (14%)

Query: 51  STFSKSSIDLLDFEPMIMKKFILSDYSKDRVK-YSLVAERAKTSFNSGKGIIFLQDFELT 109
            T +++    L  + + +++        D    + L AE       +      L+  E  
Sbjct: 9   PTSNEAIDAELSLQAVTLEQP-----DVDGNLLWRLEAESVTYVPET--QRAELRTLEGE 61

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQP-FKMKVKDNLRLDFETAVLDVKNITINS 168
                       + A          TL++       +V DNL L  E          +  
Sbjct: 62  FY--EEGQKVYTVVADEGEVQQNGDTLFLRGNLVATRVADNLTLAGELLKWQPTLGLLQM 119

Query: 169 ------------SDPVIITHSDFVLSANFARIENSSRSAVFAGQV--SVVVNP 207
                         PV ++ S   + A    + N       +G V     V P
Sbjct: 120 GNFEDANLSEETRSPVTVSDSQIQVIAQSLVVNNKEDRVTMSGDVVAKSKVEP 172



 Score = 42.0 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 43/114 (37%), Gaps = 5/114 (4%)

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMY--LFAHSARFNLANHTLYISQPFKMKV-KDNLRL 152
           + + ++  +           +Y  +   L   S    L  + + I Q  +++   + L++
Sbjct: 185 TEQSLVKAEQPLTVERFATGDYKTLTERLVGRSGIAQLDKNIVTIEQSAQLESLAEGLKV 244

Query: 153 DFETAVLDVKNITINSSDPVIITHSDFVLS--ANFARIENSSRSAVFAGQVSVV 204
               AV +V   T+N   PV I      L+  AN A ++ + +     G V   
Sbjct: 245 QSNRAVWNVPAQTVNMDQPVNIAQPARQLTASANRASVDLAEQIIYLIGNVRAN 298


>gi|262066714|ref|ZP_06026326.1| S-layer protein [Fusobacterium periodonticum ATCC 33693]
 gi|291379513|gb|EFE87031.1| S-layer protein [Fusobacterium periodonticum ATCC 33693]
          Length = 903

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/188 (11%), Positives = 52/188 (27%), Gaps = 13/188 (6%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILS--------DYSKD 79
           K         +       ++      +     L++    + +   L            + 
Sbjct: 4   KKIAYIGAGIVALVLGYFNYFGSDKETGDIRKLIETINAVYENDDLRIEAEKEIDYIDEK 63

Query: 80  RVKYSLVAERAKTSFNSGKGIIFLQ---DFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
             K+   A+             FL    +  L             +     ++N     L
Sbjct: 64  ESKFE-KAKAFIQGMFLSGDNAFLDKNKNLTLDSNILGKSANGWEIKGSQLKYNKETQEL 122

Query: 137 YISQPFKMKVKD-NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
              +P   K ++  + +        V    I   D V+I +  F + A+ A   N +++ 
Sbjct: 123 ESIKPMYAKNEEKGIEVLGNKFKTTVSMDNITLEDGVVIKNKLFSIVADKANYNNEAKTI 182

Query: 196 VFAGQVSV 203
              G +++
Sbjct: 183 TLEGNIAL 190



 Score = 41.2 bits (95), Expect = 0.089,   Method: Composition-based stats.
 Identities = 14/99 (14%), Positives = 30/99 (30%), Gaps = 2/99 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +       G+  + A      +    + +++   +K   +    +        V     +
Sbjct: 784 LTIDDGPKGNTLVKADDVTGYIDQELIKLNKNVYVKNVNEKKEEVVLTADRGTVTKQMAD 843

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             D V I   + V +AN    +  +R     G V V   
Sbjct: 844 VYDRVKIVTKESVTTANEGHYDLENRKIRAKGNVHVEYQ 882



 Score = 39.3 bits (90), Expect = 0.32,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 31/92 (33%), Gaps = 1/92 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
              +YG++ L       N  + +  ++   K     +   D      +  +  IN    +
Sbjct: 242 FDMKYGEIGLKGRDIVLNETDQSFKVTGDVKFTY-QDYVFDVVYIEKEANSDIINVYGQI 300

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              + ++ + A+ A    + +     G V V 
Sbjct: 301 KGGNPEYSVLADRAEYNINDKKFKILGNVVVT 332



 Score = 39.3 bits (90), Expect = 0.37,   Method: Composition-based stats.
 Identities = 11/96 (11%), Positives = 28/96 (29%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +        +  + A  A +N+ +    I     +       L  +T V   
Sbjct: 292 DIINVYGQIK---GGNPEYSVLADRAEYNINDKKFKILGNVVVTSTKGENLKADTFVYSS 348

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     ++ T     L A +    + S+   
Sbjct: 349 ETKEADIYGNKILYTSPTNNLEAEYIHYNSVSKEVT 384


>gi|194439182|ref|ZP_03071263.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|253771967|ref|YP_003034798.1| hypothetical protein ECBD_0543 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163141|ref|YP_003046249.1| hypothetical protein ECB_03064 [Escherichia coli B str. REL606]
 gi|194421878|gb|EDX37884.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|242378742|emb|CAQ33532.1| LptC, subunit of LptABCFG ABC transporter [Escherichia coli
           BL21(DE3)]
 gi|253323011|gb|ACT27613.1| protein of unknown function DUF1239 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975042|gb|ACT40713.1| hypothetical protein ECB_03064 [Escherichia coli B str. REL606]
 gi|253979198|gb|ACT44868.1| hypothetical protein ECD_03064 [Escherichia coli BL21(DE3)]
 gi|323961146|gb|EGB56760.1| hypothetical protein ERGG_02416 [Escherichia coli H489]
 gi|323970238|gb|EGB65509.1| hypothetical protein ERHG_03654 [Escherichia coli TA007]
          Length = 191

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQMVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|90408212|ref|ZP_01216379.1| Uncharacterized conserved secreted protein [Psychromonas sp. CNPT3]
 gi|90310658|gb|EAS38776.1| Uncharacterized conserved secreted protein [Psychromonas sp. CNPT3]
          Length = 187

 Score = 45.9 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/183 (10%), Positives = 52/183 (28%), Gaps = 9/183 (4%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           +   PFA + I      S +     +  S +   ++    +        +   + + + A
Sbjct: 4   RHIIPFAALLIAF-LFWSYFKAEPLYKISKVHNPNYTAYNLSSTHFD--TLGDISHKMFA 60

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSE-YGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           ++A T       +       + V  + +       + +        N TL ++   +++ 
Sbjct: 61  DKATTFSEKNNTVFINPRVIVYVRNKDNNQISTWQISSKDGLLEDEN-TLKLTHDVRVEN 119

Query: 147 KDNLR----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
               +    +  E   L +    I+S+  +                   S   +    + 
Sbjct: 120 LSLDQLIQNIATEELTLLLDKKEISSNLFITWDGPQMHQQGVGMWASLLSNEMIVKNNIK 179

Query: 203 VVV 205
            V 
Sbjct: 180 AVY 182


>gi|294668018|ref|ZP_06733157.1| protein of unknown function DUF1239 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292602211|gb|EFF45723.1| protein of unknown function DUF1239 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 190

 Score = 45.5 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 60/192 (31%), Gaps = 17/192 (8%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA 87
           K  F    + I+      +         S             K + +  +   V Y L A
Sbjct: 4   KTLFILGLLFIIVSAYFYAQNDARLTQVSLKPTDIDYQAEQIKALQTTETGS-VGYQLTA 62

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV- 146
            +             +   ++ +  +     ++ L A  A+ +       +     +   
Sbjct: 63  AQVT--HYQNANTAVMSKPQIVIRPKNER--EVTLVADQAQLDENKQIAKLIGNVTLTSV 118

Query: 147 ----------KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
                        +++  +  V D+ N T+ +++P+   H +    A     + ++    
Sbjct: 119 PLLTQNTSMLNLPVKMIGKNFVGDLVNNTVMTNEPLTFIHGNNRFDAKQFSGDLATGDYG 178

Query: 197 FAGQVSVVVNPG 208
           F GQVSV++ P 
Sbjct: 179 F-GQVSVMIQPA 189


>gi|310766226|gb|ADP11176.1| hypothetical protein EJP617_14950 [Erwinia sp. Ejp617]
          Length = 172

 Score = 45.5 bits (106), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 47/129 (36%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y LV+++A   + +   + +  +  +T     ++     + A  AR    +  LY+   
Sbjct: 43  SYKLVSDKAT--YYATDAVSWFDNPVMT-TYDDNKTPSWTVRADKARL-TNDRMLYLYGH 98

Query: 142 FKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          R+  + A +++    + S D V +    F  +    R    +++A  
Sbjct: 99  VQVDSLTQDAQLERIKTDNAQVNLTTQDVTSEDRVNLYGRSFNSTGMKMRGNLRNKTAEL 158

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 159 IEKVKTSYE 167


>gi|238796186|ref|ZP_04639696.1| hypothetical protein ymoll0001_34420 [Yersinia mollaretii ATCC
           43969]
 gi|238719879|gb|EEQ11685.1| hypothetical protein ymoll0001_34420 [Yersinia mollaretii ATCC
           43969]
          Length = 174

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 61/178 (34%), Gaps = 11/178 (6%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT 92
              + ++GW  +S + +  T   +  +    +       + +   +    Y LVAE  + 
Sbjct: 1   MIALALIGW-NMSGFNQQDTPVVADNNEPSSQSQHTVTVVFNPVGQLN--YKLVAEDVQN 57

Query: 93  SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV----KD 148
                + + +     +T+  + +      + A  A+    +  LY+    ++        
Sbjct: 58  FSA--QELTWFTKPVMTLFGENA-VATWTVRADRAKL-TNDKMLYLYGHVEVDSLTPDAQ 113

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
             ++  + A +++    ++S D V +    F  +    R     ++A    +V     
Sbjct: 114 LQKIKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELIEKVKTSYE 171


>gi|83816638|ref|YP_445485.1| hypothetical protein SRU_1361 [Salinibacter ruber DSM 13855]
 gi|83758032|gb|ABC46145.1| hypothetical protein SRU_1361 [Salinibacter ruber DSM 13855]
          Length = 715

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 32/89 (35%), Gaps = 2/89 (2%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A + R++ A    Y     ++     + +  ++A            D V++   D V
Sbjct: 139 TLRADTVRYDRATEVGYARGNVRL-TNGEVNVRADSARYFASEKRSVFPDSVVLVDGDRV 197

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGV 209
           L A      +    A F G+V +   PG 
Sbjct: 198 LRAQRGTYWSDEGRAEFGGRVRLT-EPGT 225



 Score = 38.2 bits (87), Expect = 0.86,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 33/84 (39%), Gaps = 1/84 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L +  AR  L+   L  +    +  +    L  +T   D       +   V +T+ +  
Sbjct: 110 RLRSDYARRYLSRSELLFTDNVVI-YERGDTLRADTVRYDRATEVGYARGNVRLTNGEVN 168

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           + A+ AR   S + +VF   V +V
Sbjct: 169 VRADSARYFASEKRSVFPDSVVLV 192


>gi|33861423|ref|NP_892984.1| SMC domain-containing protein [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33634000|emb|CAE19325.1| possible SMC domain N terminal domain [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
          Length = 162

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 38/96 (39%), Gaps = 2/96 (2%)

Query: 109 TVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITI 166
           T+   +    +  + + +++ +  N  L +     +K   ++  +L   +   ++++   
Sbjct: 24  TINLFKDNNLEYIINSDNSKLSNNNKILELDGNVLVKTIIQEGDKLTANSFTWNIQSSEY 83

Query: 167 NSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
                V   +S   LS+N A ++ ++    F   V 
Sbjct: 84  LLIGNVKFENSLVTLSSNKAILKKNTNIIEFFNPVK 119


>gi|257467998|ref|ZP_05632094.1| S-layer protein [Fusobacterium ulcerans ATCC 49185]
 gi|317062284|ref|ZP_07926769.1| predicted protein [Fusobacterium ulcerans ATCC 49185]
 gi|313687960|gb|EFS24795.1| predicted protein [Fusobacterium ulcerans ATCC 49185]
          Length = 895

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 38/102 (37%), Gaps = 4/102 (3%)

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVK 162
              +    ++ G+  + + +A  ++      +     ++ K+       +  E  ++  K
Sbjct: 790 NTKLTVTDAKNGNTVVTSDTAEIDINKDIATLVGNVYIENKNPEQGITIITAEKGIVRQK 849

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              ++    V I + D ++ A+    + ++R     G V + 
Sbjct: 850 TGILDLMGNVKIENKDSIIEADEGTYDMNTRKVKARGHVFIN 891



 Score = 40.9 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/100 (12%), Positives = 26/100 (26%), Gaps = 3/100 (3%)

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
            +            G        A +++A   L      KM       L  +  V +   
Sbjct: 270 SNIVKFFGKITGSNGVYSFSGKEAVYDIATEELTFYGDVKMTSTKGEELIADKIVYNNAT 329

Query: 164 ITINSSD---PVIITHSDFVLSANFARIENSSRSAVFAGQ 200
             I +       +   ++  L +   R  N ++      +
Sbjct: 330 KFITAYGTNRDAVYISNNGELRSREFRYNNETKEMFADKK 369



 Score = 40.5 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 14/143 (9%), Positives = 42/143 (29%), Gaps = 7/143 (4%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIFLQDFE---LTVPTQRSEYGDMYLFAHSARFNLA 132
              +   +   A+            +F+       L                 +A ++  
Sbjct: 59  VDDNETNFE-KAKALVKDMVLSGDNVFIDKVRNLALKNNILGVSPNGWKFNTEAAHYDKL 117

Query: 133 NHTLYISQPFKMKVKDNL-RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
              +        +  +   ++  +  + D K   I   D V++ +    L  +  R  ++
Sbjct: 118 KDEITSDAGVTAENDEKKVKISGKNFITDSKMSYIELKDNVVLENEKIKLKGDIGRYSDA 177

Query: 192 SRSAVFAGQVSVVVNPGVLQKKE 214
           ++    +G +  V++    Q  +
Sbjct: 178 NKIVTLSGNI--VIDGADEQNAK 198



 Score = 37.8 bits (86), Expect = 0.97,   Method: Composition-based stats.
 Identities = 9/95 (9%), Positives = 29/95 (30%), Gaps = 1/95 (1%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
                  Y    L A +  +        I++   ++     ++  +    +  +  +   
Sbjct: 218 WEPYDVTYNGAELSAGNLWYQDGTEAFLITKNVMIETN-GYKIYVDKIQREANSNIVKFF 276

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             +  ++  +  S   A  + ++    F G V + 
Sbjct: 277 GKITGSNGVYSFSGKEAVYDIATEELTFYGDVKMT 311



 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRL----DFETAVLDVKNITINSSDP 171
           E   + L     R++ AN  + +S    +   D        +F      + +  + + +P
Sbjct: 161 ENEKIKLKGDIGRYSDANKIVTLSGNIVIDGADEQNAKISGNFLNLKYSINDKILEAWEP 220

Query: 172 VIITHSDFVLSANFARIENSSRSAVFAGQV 201
             +T++   LSA     ++ + + +    V
Sbjct: 221 YDVTYNGAELSAGNLWYQDGTEAFLITKNV 250


>gi|74313736|ref|YP_312155.1| hypothetical protein SSON_3347 [Shigella sonnei Ss046]
 gi|73857213|gb|AAZ89920.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 191

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGIDMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPNSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|110643440|ref|YP_671170.1| hypothetical protein ECP_3287 [Escherichia coli 536]
 gi|191174488|ref|ZP_03035988.1| conserved hypothetical protein [Escherichia coli F11]
 gi|300979952|ref|ZP_07174804.1| hypothetical protein HMPREF9553_01494 [Escherichia coli MS 200-1]
 gi|110345032|gb|ABG71269.1| hypothetical protein YrbK [Escherichia coli 536]
 gi|190905243|gb|EDV64882.1| conserved hypothetical protein [Escherichia coli F11]
 gi|300307887|gb|EFJ62407.1| hypothetical protein HMPREF9553_01494 [Escherichia coli MS 200-1]
 gi|324012157|gb|EGB81376.1| hypothetical protein HMPREF9533_03822 [Escherichia coli MS 60-1]
          Length = 191

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 64/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++        + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLGVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    +++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRNKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|294507371|ref|YP_003571429.1| Conserved hypothetical protein, secreted [Salinibacter ruber M8]
 gi|294343699|emb|CBH24477.1| Conserved hypothetical protein, secreted [Salinibacter ruber M8]
          Length = 715

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 32/89 (35%), Gaps = 2/89 (2%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A + R++ A    Y     ++     + +  ++A            D V++   D V
Sbjct: 139 TLRADTVRYDRATEVGYARGNVRL-TNGEVNVRADSARYFASEKRSVFPDSVVLVDGDRV 197

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGV 209
           L A      +    A F G+V +   PG 
Sbjct: 198 LRAQRGTYWSDEGRAEFGGRVRLT-EPGT 225



 Score = 38.2 bits (87), Expect = 0.77,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 42/120 (35%), Gaps = 10/120 (8%)

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + A+              +QD    V  ++       L +  AR  L+   L  +    +
Sbjct: 83  VNADSLIRREK------RVQDLYGDVFVRQDS---TRLRSDYARRYLSRSELLFTDNVVI 133

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             +    L  +T   D       +   V +T+ +  + A+ AR   S + +VF   V +V
Sbjct: 134 -YERGDTLRADTVRYDRATEVGYARGNVRLTNGEVNVRADSARYFASEKRSVFPDSVVLV 192


>gi|161506120|ref|YP_001573232.1| hypothetical protein SARI_04308 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867467|gb|ABX24090.1| hypothetical protein SARI_04308 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 191

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L        +   S       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAILVLIGINLADKDDPAAVVVNSNDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YFSDQAVSWFTQPVLTTFDKD-KVPTWSIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S+D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQINLVTQDVTSNDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|325285712|ref|YP_004261502.1| hypothetical protein Celly_0799 [Cellulophaga lytica DSM 7489]
 gi|324321166|gb|ADY28631.1| protein of unknown function DUF1239 [Cellulophaga lytica DSM 7489]
          Length = 183

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 10/114 (8%), Positives = 27/114 (23%), Gaps = 8/114 (7%)

Query: 90  AKTSFNSGKGIIFLQDFE------LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFK 143
           A  +    +    L   +      L V     +     + A       +   + +     
Sbjct: 54  AVLTAPVREDFNNLTFPKEVFPKGLQVEFFDDKNQKSIITADYGISYSSTKLISLRGNVV 113

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHS--DFVLSANFARIENSSRSA 195
           +   D  +        D  N  I + +     +   + V+       +   +  
Sbjct: 114 IHTHDGKQFKTPQLFYDQVNKWIFTQEKFEFINPEDESVMYGEGFDSDKDLKQV 167


>gi|149912956|ref|ZP_01901490.1| hypothetical protein RAZWK3B_03170 [Roseobacter sp. AzwK-3b]
 gi|149813362|gb|EDM73188.1| hypothetical protein RAZWK3B_03170 [Roseobacter sp. AzwK-3b]
          Length = 167

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 37/109 (33%), Gaps = 15/109 (13%)

Query: 97  GKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFET 156
           G+G + L    + V  ++ + G   L A      ++                    +   
Sbjct: 65  GQGEMRLWAPRVEVIYKQDQSGIESLHATGGVTLVSGEDA---------------AEARE 109

Query: 157 AVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
           A  ++    I     V++      L+++   ++  + +A   G+V  V+
Sbjct: 110 ADYNIDTGMIEMDGEVLLVQGPQTLTSDKMVVDTRAGTAQMTGRVKTVL 158


>gi|298291094|ref|YP_003693033.1| organic solvent tolerance protein [Starkeya novella DSM 506]
 gi|296927605|gb|ADH88414.1| Organic solvent tolerance protein [Starkeya novella DSM 506]
          Length = 826

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 10/80 (12%), Positives = 25/80 (31%), Gaps = 2/80 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M + A    ++   + +      ++       L+    V D  N  + +   
Sbjct: 66  RQNDPNAKMLVTADELVYDNTRNEVIAEGNVQIYYD-GAVLEARRVVYDRANNRLRAEGG 124

Query: 172 VIITHSDFV-LSANFARIEN 190
           V +   D   ++A+   +  
Sbjct: 125 VRLKDKDGTIITADNLDLSQ 144



 Score = 36.2 bits (82), Expect = 2.8,   Method: Composition-based stats.
 Identities = 11/79 (13%), Positives = 25/79 (31%)

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
            +    +      + +  +  V D     + +   V I +   VL A     + ++    
Sbjct: 61  ELLGNRQNDPNAKMLVTADELVYDNTRNEVIAEGNVQIYYDGAVLEARRVVYDRANNRLR 120

Query: 197 FAGQVSVVVNPGVLQKKEN 215
             G V +    G +   +N
Sbjct: 121 AEGGVRLKDKDGTIITADN 139


>gi|315223433|ref|ZP_07865290.1| OstA family protein [Capnocytophaga ochracea F0287]
 gi|314946606|gb|EFS98597.1| OstA family protein [Capnocytophaga ochracea F0287]
          Length = 560

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/173 (8%), Positives = 49/173 (28%), Gaps = 12/173 (6%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS---KDRVKYSLVAERAKTSFN 95
           +  F  + W +        I+++      +        +    D  +            +
Sbjct: 13  LLTFCTNLWAQNDNSKTRRIEIIYGGEFTIDNEKYPGATIFKSDGQRVQFR----HQGLD 68

Query: 96  SGKGIIFL----QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR 151
               +  L     +          +   + + +    +     T    +   ++   N+ 
Sbjct: 69  VWCDLAVLYEEKNEVIAHGNVVLQQGDTLQMNSQYVSYKGNTKTAVARENVLLR-NGNMT 127

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           L+ +    D  +     ++   IT  +  L++   +   +++   F   V +V
Sbjct: 128 LETQELFFDRNSQEAYYNNFGKITDPENELTSKTGKYYVTTKKNQFTNSVKIV 180


>gi|262277386|ref|ZP_06055179.1| hypothetical protein HIMB114_0806 [alpha proteobacterium HIMB114]
 gi|262224489|gb|EEY74948.1| hypothetical protein HIMB114_0806 [alpha proteobacterium HIMB114]
          Length = 778

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 11/94 (11%), Positives = 28/94 (29%)

Query: 111 PTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSD 170
               S   +  + A    F  + + +  +   K       ++     +       I + +
Sbjct: 25  KNTSSSSENFEIMAKKVEFIKSENLVIANGDAKAIHTSGKKILANRILYYKNKNLIKTIE 84

Query: 171 PVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
             + T  D  +SA     +   +    +G V + 
Sbjct: 85  NSLFTDGDINISAKQFFYDTKLKIIKASGNVVLT 118


>gi|256820421|ref|YP_003141700.1| OstA family protein [Capnocytophaga ochracea DSM 7271]
 gi|256582004|gb|ACU93139.1| OstA family protein [Capnocytophaga ochracea DSM 7271]
          Length = 560

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/173 (8%), Positives = 49/173 (28%), Gaps = 12/173 (6%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS---KDRVKYSLVAERAKTSFN 95
           +  F  + W +        I+++      +        +    D  +            +
Sbjct: 13  LLTFCTNLWAQNDNSKTRRIEIIYGGEFTIDNEKYPGATIFKSDGQRVQFR----HQGLD 68

Query: 96  SGKGIIFL----QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR 151
               +  L     +          +   + + +    +     T    +   ++   N+ 
Sbjct: 69  VWCDLAVLYEEKNEVIAHGNVVLQQGDTLQMNSQYVSYKGNTKTAVARENVLLR-NGNMT 127

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           L+ +    D  +     ++   IT  +  L++   +   +++   F   V +V
Sbjct: 128 LETQELFFDRNSQEAYYNNFGKITDPENELTSKTGKYYVTTKKNQFTNSVKIV 180


>gi|319901398|ref|YP_004161126.1| hypothetical protein Bache_1535 [Bacteroides helcogenes P 36-108]
 gi|319416429|gb|ADV43540.1| protein of unknown function DUF1239 [Bacteroides helcogenes P
           36-108]
          Length = 208

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/170 (12%), Positives = 49/170 (28%), Gaps = 4/170 (2%)

Query: 24  IQFLKFFFPFATVTIVGWFLLSSW-IRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-V 81
           + F +       +  +   LL S          ++I   D  P++  + + +  S     
Sbjct: 8   VIFYRHISITIALGAMVMLLLFSACSGRKKELGAAITERDSLPVMDTRGVTTLVSDSGIT 67

Query: 82  KYSLVAER-AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
           +Y +  E        +     F +   L          +  + A +A F        +  
Sbjct: 68  RYRIKTEEWLVFDRKNPPYWAFEKGVYLE-KFDSLFRVEASIKADTAYFYNKEELWKLMG 126

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
              +K     R + E    D +   + S   + I   D +++        
Sbjct: 127 NVDIKNLKGERFNTELLYWDQRKQKVYSDRFIRIEQPDRIITGRGFESNQ 176


>gi|146342593|ref|YP_001207641.1| putative organic solvent tolerance protein (OstA) [Bradyrhizobium
           sp. ORS278]
 gi|146195399|emb|CAL79424.1| putative Organic solvent tolerance protein (OstA) [Bradyrhizobium
           sp. ORS278]
          Length = 824

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/199 (10%), Positives = 49/199 (24%), Gaps = 23/199 (11%)

Query: 8   NKILLQRSKYRQHVRFIQFLKF---FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE 64
           ++   +        R ++ L+          V   G  L ++    S             
Sbjct: 9   DRCFARSRTASTDSRRVRALRRSPAALAVCVVLAAGAVLPATAYAQSFTYNPLPPKPPPP 68

Query: 65  PMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFA 124
            +     +L           + A   +    +   +  + + +L             + A
Sbjct: 69  RVANDNQML-----------VQATTVEYD-ANNSRVAAVGNVQLFYNGSS-------VEA 109

Query: 125 HSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSAN 184
               ++     L+     +M   D      ++  L             + T     ++A 
Sbjct: 110 DRVIYDQKTKRLHAEGNIRMTDADGKITYADSLDLSDDYRDGFVDSLRVETEDQTRMAAT 169

Query: 185 FARIENSSRSAVFAGQVSV 203
            A   +   + VF   V  
Sbjct: 170 RAD-RSKGNTTVFENGVYT 187



 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 9/90 (10%), Positives = 28/90 (31%), Gaps = 3/90 (3%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
                   +A S  +N            ++   + + +   T   D  N  + +   V +
Sbjct: 44  GAVLPATAYAQSFTYNPLPPKPPPP---RVANDNQMLVQATTVEYDANNSRVAAVGNVQL 100

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVV 204
            ++   + A+    +  ++     G + + 
Sbjct: 101 FYNGSSVEADRVIYDQKTKRLHAEGNIRMT 130


>gi|289765896|ref|ZP_06525274.1| S-layer protein [Fusobacterium sp. D11]
 gi|289717451|gb|EFD81463.1| S-layer protein [Fusobacterium sp. D11]
          Length = 657

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 26/96 (27%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L+ +  V   
Sbjct: 49  DIINVYGQIK---GGNPIYSVLADKGEYNINDKKIRIFGNVDITSTKGEKLNLDNFVYSS 105

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T     L A +      ++   
Sbjct: 106 ETKEADMYGNKIKYTSPTNNLEAEYIHYNTVTKEIT 141



 Score = 41.6 bits (96), Expect = 0.075,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 541 LTIDDGEKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 600

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V +   D V++AN    +  +R     G V V  
Sbjct: 601 VYDRVKVVTKDSVITANEGHYDIVNRKIRAKGNVHVDY 638



 Score = 38.2 bits (87), Expect = 0.83,   Method: Composition-based stats.
 Identities = 10/86 (11%), Positives = 26/86 (30%), Gaps = 1/86 (1%)

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT 175
           +Y ++ L       N    +  ++   K     +   D      +  +  IN    +   
Sbjct: 2   KYDEVGLKGKDIVLNETTQSFKVTGDVKFTY-QDYIFDVSYIEKEPNSDIINVYGQIKGG 60

Query: 176 HSDFVLSANFARIENSSRSAVFAGQV 201
           +  + + A+      + +     G V
Sbjct: 61  NPIYSVLADKGEYNINDKKIRIFGNV 86


>gi|237744279|ref|ZP_04574760.1| S-layer protein [Fusobacterium sp. 7_1]
 gi|229431508|gb|EEO41720.1| S-layer protein [Fusobacterium sp. 7_1]
          Length = 657

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 26/96 (27%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L+ +  V   
Sbjct: 49  DIINVYGQIK---GGNPIYSVLADKGEYNINDKKIRIFGNVDITSTKGEKLNLDNFVYSS 105

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T     L A +      ++   
Sbjct: 106 ETKEADMYGNKIKYTSPTNNLEAEYIHYNTVTKEIT 141



 Score = 41.6 bits (96), Expect = 0.075,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 31/98 (31%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 541 LTIDDGEKGNTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 600

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V +   D V++AN    +  +R     G V V  
Sbjct: 601 VYDRVKVVTKDSVITANEGHYDIVNRKIRAKGNVHVDY 638



 Score = 38.2 bits (87), Expect = 0.83,   Method: Composition-based stats.
 Identities = 10/86 (11%), Positives = 26/86 (30%), Gaps = 1/86 (1%)

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT 175
           +Y ++ L       N    +  ++   K     +   D      +  +  IN    +   
Sbjct: 2   KYDEVGLKGKDIVLNETTQSFKVTGDVKFTY-QDYIFDVSYIEKEPNSDIINVYGQIKGG 60

Query: 176 HSDFVLSANFARIENSSRSAVFAGQV 201
           +  + + A+      + +     G V
Sbjct: 61  NPIYSVLADKGEYNINDKKIRIFGNV 86


>gi|157148770|ref|YP_001456089.1| hypothetical protein CKO_04602 [Citrobacter koseri ATCC BAA-895]
 gi|157085975|gb|ABV15653.1| hypothetical protein CKO_04602 [Citrobacter koseri ATCC BAA-895]
          Length = 191

 Score = 45.5 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L       ++   +       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAVLVLIGINLADKDDPAQVVVNTSDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALNYRLIAQHVE--YYSEQALSWFTQPVLTTFDKD-KVPTWSIKADKAKL-TEDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALAPDAQLRRITTDNATINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|332519010|ref|ZP_08395477.1| protein of unknown function DUF1239 [Lacinutrix algicola 5H-3-7-4]
 gi|332044858|gb|EGI81051.1| protein of unknown function DUF1239 [Lacinutrix algicola 5H-3-7-4]
          Length = 184

 Score = 45.5 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 10/93 (10%), Positives = 27/93 (29%), Gaps = 2/93 (2%)

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN 163
           +  +L +  + +      + A  A        + +     +   D   L  E    D   
Sbjct: 82  EGVKLHIYDENNHKN--TIVADYAILYSETDVIDLQGNVLISTFDKDTLYAEQLYFDQNK 139

Query: 164 ITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             + ++ PV      ++   +    + +   A 
Sbjct: 140 EWLFTNSPVTYKSDGYITHGSGFDSDRNFTKAE 172


>gi|317046699|ref|YP_004114347.1| hypothetical protein Pat9b_0465 [Pantoea sp. At-9b]
 gi|316948316|gb|ADU67791.1| protein of unknown function DUF1239 [Pantoea sp. At-9b]
          Length = 192

 Score = 45.5 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/155 (11%), Positives = 50/155 (32%), Gaps = 12/155 (7%)

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSG------KGIIFLQDFELTVPTQRSEYGDMYL 122
           ++   +  +   V Y+     A    +          + +  +  +T     ++     +
Sbjct: 39  QEPTYTSSTSHTVVYNPDGALAYRLISDKVTYFAADELSWFDNPVMT-TYDVNKIPTWSV 97

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSD 178
            A  A+    +  LY+    ++          R+  + AV+++    + S D V +    
Sbjct: 98  RADKAKL-TKDRMLYLYGHVEVNTLTQDSELERIKTDNAVVNLVTQDVTSDDQVTLYGRS 156

Query: 179 FVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
           F  +    R    ++ A    +V         +++
Sbjct: 157 FNSTGMKMRGNLRTKHAQLIEKVKSSYEIQNEKQQ 191


>gi|312142808|ref|YP_003994254.1| OstA family protein [Halanaerobium sp. 'sapolanicus']
 gi|311903459|gb|ADQ13900.1| OstA family protein [Halanaerobium sp. 'sapolanicus']
          Length = 208

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 32/100 (32%), Gaps = 2/100 (2%)

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT 175
           E  D YL A       A   +       ++ + +   + +  +  +     + S  V   
Sbjct: 111 EAADSYLEADRIEIYQAEERIEAFGNAYLEYE-DFWAEADEIISYLDREVTHLSGNVRGE 169

Query: 176 HSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
            +    SAN A I  +       GQ  + + P      +N
Sbjct: 170 RNGERFSANSAEINQAENEIRLRGQAKLSL-PEGEANDDN 208



 Score = 42.8 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 10/116 (8%), Positives = 35/116 (30%), Gaps = 6/116 (5%)

Query: 96  SGKGIIFLQDFELTVPTQRSEYG----DMYLFA-HSARFNLANHTLYISQPFKMKVKDNL 150
           +G  + FL      +   R +      ++ + A     ++  +  +      ++    + 
Sbjct: 28  TGDELDFLDSEAGQIIEARRDVELLYDELRITAEDEGIYHRYSGEIEFRYNVELFY-QDY 86

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +        ++++         ++  +D  L A+   I  +       G   +   
Sbjct: 87  QGRAHELTGNIESEVFYLEQDAVLEAADSYLEADRIEIYQAEERIEAFGNAYLEYE 142


>gi|160892222|ref|ZP_02073225.1| hypothetical protein BACUNI_04686 [Bacteroides uniformis ATCC 8492]
 gi|270296159|ref|ZP_06202359.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317480736|ref|ZP_07939822.1| hypothetical protein HMPREF1007_02939 [Bacteroides sp. 4_1_36]
 gi|156858700|gb|EDO52131.1| hypothetical protein BACUNI_04686 [Bacteroides uniformis ATCC 8492]
 gi|270273563|gb|EFA19425.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316903077|gb|EFV24945.1| hypothetical protein HMPREF1007_02939 [Bacteroides sp. 4_1_36]
          Length = 208

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/164 (10%), Positives = 44/164 (26%), Gaps = 7/164 (4%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS----KDR-VKYSLVA 87
            +   ++G  ++       +  K  +     E   M        +         +Y +  
Sbjct: 14  ASITIVLGAMVMLLLFSSCSGKKKELGDAITERDSMAVMDTRGVTTLVSDSGVTRYRINT 73

Query: 88  ER-AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           E        +     F +   L          +  + A +A F        +     ++ 
Sbjct: 74  EEWLVFDRKNPPYWAFEKGVYLE-KFDSIFQVEASIKADTAYFFNKEELWKLMGNVHIQN 132

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
               + D E    D +   I S + + I   D +++ +      
Sbjct: 133 LKGEQFDTELLYWDQRAQRIYSDEFIRIEQPDRIITGHGFESNQ 176


>gi|218701968|ref|YP_002409597.1| hypothetical protein ECIAI39_3694 [Escherichia coli IAI39]
 gi|218371954|emb|CAR19810.1| conserved hypothetical protein [Escherichia coli IAI39]
          Length = 191

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFMQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|331664812|ref|ZP_08365717.1| putative inner membrane protein [Escherichia coli TA143]
 gi|331058060|gb|EGI30042.1| putative inner membrane protein [Escherichia coli TA143]
          Length = 191

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/192 (11%), Positives = 64/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F       R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSCGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|220932587|ref|YP_002509495.1| hypothetical protein Hore_17510 [Halothermothrix orenii H 168]
 gi|219993897|gb|ACL70500.1| uncharacterized protein conserved in bacteria [Halothermothrix
           orenii H 168]
          Length = 219

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/137 (10%), Positives = 44/137 (32%), Gaps = 5/137 (3%)

Query: 72  ILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSE---YGDMYLFAHSAR 128
             +  ++D   Y+L  + +   +      +     +       +      ++ L  +   
Sbjct: 77  KFNTRTEDLEVYNL-GKISTPEYTLKGDTLKGNINKGKFNIDGNISLMGDNILLTGNVID 135

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
            + +     I+    ++ K  ++   +    + +  T+     V         S N  +I
Sbjct: 136 LDRSKEVAVITGKTSIEYK-GIKAVSDKLTYNYREETVYLEGNVSGKQDGHEFSGNTLKI 194

Query: 189 ENSSRSAVFAGQVSVVV 205
           + S    + +G  S++ 
Sbjct: 195 DLSREQIILSGNASLLF 211


>gi|325291769|ref|YP_004277633.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
 gi|325059622|gb|ADY63313.1| hypothetical protein AGROH133_03499 [Agrobacterium sp. H13-3]
          Length = 218

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/221 (12%), Positives = 68/221 (30%), Gaps = 28/221 (12%)

Query: 3   HLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLD 62
           H   R K      +  Q  R +   K     +       F  S    ++    ++ +   
Sbjct: 17  HPISRMKASESPVQMMQISRPVSLGK-----SAGVTAAAFAFSCLATVAFAQNTTSN--- 68

Query: 63  FEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL 122
                M    LS         ++ +++ +      K      + ++   T   + G M +
Sbjct: 69  -----MTGVKLSG----DQPIAIESDQLEIRDQERKAYFTG-NVKVVQGTTTLQAGKMTV 118

Query: 123 F-----AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP-VIITH 176
                 +     +     +++     +  +   +   +    D+   T   +   V+++ 
Sbjct: 119 NYKGEGSSLTSGDANIEKIFVDNNVYLTSET-QKATADHGEFDMAAQTFILTGKQVVLSE 177

Query: 177 SDFVLSANFARIENSSRSAVFA---GQVSVVVNPGVLQKKE 214
              V +     +  +S  A      G V ++++P   QKK+
Sbjct: 178 GANVFTGCKLTVLMNSGQAKLESCGGPVRIMLDPKSQQKKQ 218


>gi|332707286|ref|ZP_08427339.1| protein of unknown function, DUF1239 [Lyngbya majuscula 3L]
 gi|332354020|gb|EGJ33507.1| protein of unknown function, DUF1239 [Lyngbya majuscula 3L]
          Length = 364

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 10/96 (10%), Positives = 28/96 (29%), Gaps = 6/96 (6%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVI 173
             +  +   A   R+      L +           NL++  E  +  ++   +  +  + 
Sbjct: 138 GNHPKLQASAKEGRYLSRTQNLELIGQVAAISKDPNLQMKTERLLWQIEQQKVIGNKRIF 197

Query: 174 ITHSDF-----VLSANFARIENSSRSAVFAGQVSVV 204
           I           + A+ + +   +  A     V + 
Sbjct: 198 IERYKNKVVTERVEADNSEVNLKANIATLKKNVQLT 233


>gi|259417071|ref|ZP_05740990.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
 gi|259345977|gb|EEW57791.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           sp. TrichCH4B]
          Length = 165

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 12/132 (9%), Positives = 38/132 (28%), Gaps = 4/132 (3%)

Query: 77  SKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTL 136
           +       + ++    +   G  ++      +    + S    + +             L
Sbjct: 35  TDTSQPVDITSDNMSVNQEDGSALLTGSVLIIQGEMRLSADNVLVVRRAEG---NGIERL 91

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
                  +        +   A   +++ T+     V++T     L A    +  ++ +A 
Sbjct: 92  EARGNVLLV-SGEDAAEAREADYTIESGTVVMRGNVLLTQQGNTLGAEQMTVNITTGNAT 150

Query: 197 FAGQVSVVVNPG 208
            +G+V   +   
Sbjct: 151 LSGRVRTTLPGS 162


>gi|46201281|ref|ZP_00055391.2| COG1452: Organic solvent tolerance protein OstA [Magnetospirillum
           magnetotacticum MS-1]
          Length = 819

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/161 (10%), Positives = 46/161 (28%), Gaps = 20/161 (12%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKF--ILSDYSKDRVKYSLVAERAKTSFNSGKGII 101
             +   I   +  +          M++   I+    +      L               I
Sbjct: 51  AQAQPSIRAEASPTAQAQRSASRAMERASVIMRGEDESGDAVGLK----------RPPRI 100

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
             +     V T       +++ A    ++   + +      +M  +    +  +T   ++
Sbjct: 101 IPRAMRS-VKTTEDGNEPVHMVADQVIYDREFNVVTAKGRVEMMHE-GRTISADTVSYNM 158

Query: 162 KNITINSSDPVIITHSDFVLS-ANFARIENSSRSAVFAGQV 201
           K   + +S  V++T     ++ A +  +        F   V
Sbjct: 159 KQDVMGASGNVVLTEPSGEVTHAEYFELTGD-----FKNGV 194


>gi|320640270|gb|EFX09842.1| lipopolysaccharide exporter periplasmic protein [Escherichia coli
           O157:H7 str. G5101]
          Length = 191

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHIEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|332663483|ref|YP_004446271.1| OstA family protein [Haliscomenobacter hydrossis DSM 1100]
 gi|332332297|gb|AEE49398.1| OstA family protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 639

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 32/122 (26%), Gaps = 9/122 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
           +      + A+ A+    S      + +    V     +     L+     +       Y
Sbjct: 90  QQGDSLKIFADEAQYDGESK-----IANLLGRVILVNGDR---KLYTRRLDYRTDTRVAY 141

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            +    M    +L L  +     V        + V      F L A+       S+   F
Sbjct: 142 YTNNATMVSD-SLSLTSKVGYYYVATKEAQFREKVTAEGPRFRLKADSLNYNTESKVVDF 200

Query: 198 AG 199
            G
Sbjct: 201 LG 202



 Score = 44.3 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 27/88 (30%), Gaps = 1/88 (1%)

Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT 175
           E     L A S  +N  +  +    P  +    + ++  E    D  N     S      
Sbjct: 178 EGPRFRLKADSLNYNTESKVVDFLGPTIITTDSS-KVYCEDGFYDTANNRAEFSGNAQYV 236

Query: 176 HSDFVLSANFARIENSSRSAVFAGQVSV 203
            +D    A+    +++ +     G   V
Sbjct: 237 KNDQQAEADTITYDDNLKIYSLRGNARV 264



 Score = 38.2 bits (87), Expect = 0.85,   Method: Composition-based stats.
 Identities = 13/135 (9%), Positives = 44/135 (32%), Gaps = 8/135 (5%)

Query: 67  IMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHS 126
              +   S       +Y    ++A+    +    + +         + S    +    + 
Sbjct: 223 ANNRAEFSG----NAQYVKNDQQAEADTITYDDNLKIYSLRGNARVEDSTRLAI---GNL 275

Query: 127 ARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFA 186
            R++    T ++    + + +    ++ E    + K  T  +     I+    ++ A+  
Sbjct: 276 IRYDELQDTTFLQGNARYR-EKEQDINSEIISYNRKKGTFKTLGRTFISDPPNLMEADQI 334

Query: 187 RIENSSRSAVFAGQV 201
             ++++   +  G V
Sbjct: 335 GFDDATGFGLATGNV 349


>gi|261749111|ref|YP_003256796.1| hypothetical protein BPLAN_013 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497203|gb|ACX83653.1| conserved hypothetical protein [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
          Length = 565

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/137 (13%), Positives = 40/137 (29%), Gaps = 10/137 (7%)

Query: 73  LSDYSKDRVKYSLV---AERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARF 129
               SK++ K  +    A+  + +  + K   FL    +             LF   A +
Sbjct: 18  YEGNSKEKKKIQIKLIHADFIQKNEKNDKNAFFLIG-RVHFQHNG-----YELFCDRAIY 71

Query: 130 NLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
              ++        ++K   N             +  + +   V++   +  L+AN     
Sbjct: 72  YKKSNLFSGYGNVQLKSDKNKIF-SHEIEYHGNSKNLKALGKVVLFQENIKLTANAINYN 130

Query: 190 NSSRSAVFAGQVSVVVN 206
              +       V +  N
Sbjct: 131 FRKKIFQAIKNVVLFFN 147


>gi|218550482|ref|YP_002384273.1| hypothetical protein EFER_3176 [Escherichia fergusonii ATCC 35469]
 gi|218358023|emb|CAQ90669.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|324115197|gb|EGC09161.1| hypothetical protein ERIG_00073 [Escherichia fergusonii B253]
 gi|325498780|gb|EGC96639.1| hypothetical protein ECD227_2877 [Escherichia fergusonii ECD227]
          Length = 191

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLL--SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L       ++   +       +    ++         +
Sbjct: 2   SKARRWVIILLSLAVLVMIGINLADNEDTAQVVVNNNDPTYKSEHTDTLVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT    + +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLT-TFDKEKVPTWSIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQINLITQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|332163084|ref|YP_004299661.1| hypothetical protein YE105_C3464 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604036|emb|CBY25534.1| uncharacterized protein YrbK clustered with lipopolysaccharide
           transporters [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325667314|gb|ADZ43958.1| hypothetical protein YE105_C3464 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862758|emb|CBX72900.1| lipopolysaccharide export system protein lptC [Yersinia
           enterocolitica W22703]
          Length = 187

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 45/128 (35%), Gaps = 8/128 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y LVAE       + + + +     +T+  + +      + A  A+    +  LY+    
Sbjct: 61  YKLVAEEV--QNFNAQQLTWFTRPVMTMFDENA-VATWTVRADRAKL-TDDKMLYLYGHV 116

Query: 143 KMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++          ++  + A +++    ++S D V +    F  +    R     ++A   
Sbjct: 117 EVDSLTPDAQLQKIKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELI 176

Query: 199 GQVSVVVN 206
            +V     
Sbjct: 177 EKVKTSYE 184


>gi|16762079|ref|NP_457696.1| hypothetical protein STY3496 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766612|ref|NP_462227.1| hypothetical protein STM3317 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143568|ref|NP_806910.1| hypothetical protein t3234 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415246|ref|YP_152321.1| hypothetical protein SPA3184 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181825|ref|YP_218242.1| hypothetical protein SC3255 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161616327|ref|YP_001590292.1| hypothetical protein SPAB_04135 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167994510|ref|ZP_02575601.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231928|ref|ZP_02656986.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238019|ref|ZP_02663077.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243153|ref|ZP_02668085.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168262670|ref|ZP_02684643.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463457|ref|ZP_02697374.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168819613|ref|ZP_02831613.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445232|ref|YP_002042575.1| hypothetical protein SNSL254_A3578 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450441|ref|YP_002047346.1| hypothetical protein SeHA_C3614 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471529|ref|ZP_03077513.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194736180|ref|YP_002116267.1| hypothetical protein SeSA_A3509 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197248734|ref|YP_002148242.1| hypothetical protein SeAg_B3507 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197263576|ref|ZP_03163650.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197364176|ref|YP_002143813.1| hypothetical protein SSPA2972 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|200388469|ref|ZP_03215081.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205354218|ref|YP_002228019.1| hypothetical protein SG3207 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858565|ref|YP_002245216.1| hypothetical protein SEN3150 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213053148|ref|ZP_03346026.1| hypothetical protein Salmoneentericaenterica_09615 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213419714|ref|ZP_03352780.1| hypothetical protein Salmonentericaenterica_18738 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213426640|ref|ZP_03359390.1| hypothetical protein SentesTyphi_14123 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213585575|ref|ZP_03367401.1| hypothetical protein SentesTyph_31637 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213648390|ref|ZP_03378443.1| hypothetical protein SentesTy_14564 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855447|ref|ZP_03383687.1| hypothetical protein SentesT_15915 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224585114|ref|YP_002638913.1| hypothetical protein SPC_3387 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|289825828|ref|ZP_06544996.1| hypothetical protein Salmonellentericaenterica_10496 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25357913|pir||AD0905 probable exported protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16421874|gb|AAL22186.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504382|emb|CAD07834.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139203|gb|AAO70770.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129503|gb|AAV79009.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62129458|gb|AAX67161.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161365691|gb|ABX69459.1| hypothetical protein SPAB_04135 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403895|gb|ACF64117.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408745|gb|ACF68964.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194457893|gb|EDX46732.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194711682|gb|ACF90903.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633516|gb|EDX51930.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197095653|emb|CAR61221.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197212437|gb|ACH49834.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197241831|gb|EDY24451.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289110|gb|EDY28479.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|199605567|gb|EDZ04112.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205273999|emb|CAR39005.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205327634|gb|EDZ14398.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333908|gb|EDZ20672.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337725|gb|EDZ24489.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343545|gb|EDZ30309.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205348632|gb|EDZ35263.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710368|emb|CAR34726.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224469642|gb|ACN47472.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261248482|emb|CBG26319.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995516|gb|ACY90401.1| hypothetical protein STM14_4005 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159866|emb|CBW19385.1| possible exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914344|dbj|BAJ38318.1| hypothetical protein STMDT12_C33750 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087762|emb|CBY97526.1| Lipopolysaccharide export system protein lptC [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322615321|gb|EFY12242.1| hypothetical protein SEEM315_15185 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618320|gb|EFY15211.1| hypothetical protein SEEM971_03300 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622875|gb|EFY19719.1| hypothetical protein SEEM973_10125 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626803|gb|EFY23600.1| hypothetical protein SEEM974_16924 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631372|gb|EFY28132.1| hypothetical protein SEEM201_11014 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635361|gb|EFY32075.1| hypothetical protein SEEM202_21363 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643360|gb|EFY39924.1| hypothetical protein SEEM954_06208 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647068|gb|EFY43569.1| hypothetical protein SEEM054_06148 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648871|gb|EFY45316.1| hypothetical protein SEEM675_09037 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655063|gb|EFY51374.1| hypothetical protein SEEM965_16386 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657666|gb|EFY53934.1| hypothetical protein SEEM19N_17086 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664162|gb|EFY60360.1| hypothetical protein SEEM801_14252 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667445|gb|EFY63607.1| hypothetical protein SEEM507_15310 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674693|gb|EFY70785.1| hypothetical protein SEEM877_12124 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675674|gb|EFY71747.1| hypothetical protein SEEM867_11224 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682310|gb|EFY78333.1| hypothetical protein SEEM180_00857 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684913|gb|EFY80911.1| hypothetical protein SEEM600_02919 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716314|gb|EFZ07885.1| Lipopolysaccharide export system protein lptC [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323131677|gb|ADX19107.1| Lipopolysaccharide export system protein lptC [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323195882|gb|EFZ81053.1| hypothetical protein SEEM581_06584 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198999|gb|EFZ84096.1| hypothetical protein SEEM501_06316 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204301|gb|EFZ89310.1| hypothetical protein SEEM460_13182 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207648|gb|EFZ92595.1| hypothetical protein SEEM020_13827 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211299|gb|EFZ96143.1| hypothetical protein SEEM6152_16825 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214759|gb|EFZ99508.1| hypothetical protein SEEM0077_19014 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221239|gb|EGA05665.1| hypothetical protein SEEM0047_05091 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224019|gb|EGA08312.1| hypothetical protein SEEM0055_21780 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230331|gb|EGA14450.1| hypothetical protein SEEM0052_18719 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233307|gb|EGA17401.1| hypothetical protein SEEM3312_09546 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239344|gb|EGA23394.1| hypothetical protein SEEM5258_07080 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242405|gb|EGA26431.1| hypothetical protein SEEM1156_15652 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246915|gb|EGA30881.1| lipopolysaccharide exporter periplasmic protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323254152|gb|EGA37972.1| lipopolysaccharide exporter periplasmic protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255269|gb|EGA39046.1| lipopolysaccharide exporter periplasmic protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262732|gb|EGA46288.1| hypothetical protein SEEM8284_03211 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264042|gb|EGA47550.1| lipopolysaccharide exporter periplasmic protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323269428|gb|EGA52883.1| lipopolysaccharide exporter periplasmic protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326625067|gb|EGE31412.1| Lipopolysaccharide export system protein lptC [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326629340|gb|EGE35683.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332990175|gb|AEF09158.1| hypothetical protein STMUK_3303 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 191

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L        +   S       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAILVLIGINLADKDDPAAVMVNSNDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YFSDQAVSWFTQPVLTTFDKD-KVPTWSIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S+D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQINLVTQDVTSNDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|238764276|ref|ZP_04625228.1| hypothetical protein ykris0001_25420 [Yersinia kristensenii ATCC
           33638]
 gi|238697557|gb|EEP90322.1| hypothetical protein ykris0001_25420 [Yersinia kristensenii ATCC
           33638]
          Length = 169

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 45/129 (34%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y LVAE  +      + + +     +T+  + +      + A  A+    +  LY+   
Sbjct: 42  SYKLVAEEVQNFSE--QELTWFTRPVMTMFDENA-VATWSVRADRAKL-TNDKMLYLYGH 97

Query: 142 FKMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          ++  + A +++    ++S D V +    F  +    R     ++A  
Sbjct: 98  VEVDSLTPDAQLQKIKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAEL 157

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 158 IEKVKTSYE 166


>gi|56695007|ref|YP_165354.1| hypothetical protein SPO0080 [Ruegeria pomeroyi DSS-3]
 gi|56676744|gb|AAV93410.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 163

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 39/128 (30%), Gaps = 4/128 (3%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
              + A+    S   G               + S    + ++   A        L  +  
Sbjct: 39  PVEVTADSLDVSQEDGSAEFQGNVLVSQGEMRLSAKRVLVIYNQEAS---GIERLEATGD 95

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
             +    +     + A   +    I  +  V++T     LS+    +  +S +A   G+V
Sbjct: 96  VVLV-SGSDAAQAQRADYTIGTGVIVMTGDVLLTQGKNALSSGKMTVNLTSGTAQMVGRV 154

Query: 202 SVVVNPGV 209
             ++N G 
Sbjct: 155 KTILNSGS 162


>gi|206576103|ref|YP_002236389.1| hypothetical protein KPK_0512 [Klebsiella pneumoniae 342]
 gi|288933373|ref|YP_003437432.1| hypothetical protein Kvar_0490 [Klebsiella variicola At-22]
 gi|290511576|ref|ZP_06550945.1| hypothetical protein HMPREF0485_03347 [Klebsiella sp. 1_1_55]
 gi|206565161|gb|ACI06937.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
 gi|288888102|gb|ADC56420.1| protein of unknown function DUF1239 [Klebsiella variicola At-22]
 gi|289776569|gb|EFD84568.1| hypothetical protein HMPREF0485_03347 [Klebsiella sp. 1_1_55]
          Length = 191

 Score = 45.1 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 47/129 (36%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y L+AE  +  + S + + +     +T     ++     + A  A+    +  LY+   
Sbjct: 59  SYRLIAEHVE--YFSDQEVSWFTKPVMT-TFDTNKVPTWSIRADKAKL-TNDRMLYLYGH 114

Query: 142 FKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          ++  + A +++    + S D V +  + F  S    R    S++A  
Sbjct: 115 VEVNALAPDSQLRKITTDNAQINLVTQDVTSDDMVTLYGTTFNSSGLKMRGNLRSKNAEL 174

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 175 IEKVRTSYE 183


>gi|327404426|ref|YP_004345264.1| hypothetical protein Fluta_2441 [Fluviicola taffensis DSM 16823]
 gi|327319934|gb|AEA44426.1| hypothetical protein Fluta_2441 [Fluviicola taffensis DSM 16823]
          Length = 526

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 12/106 (11%), Positives = 31/106 (29%), Gaps = 2/106 (1%)

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVL 159
           I+        +   +S + ++   A    ++       ++     K      +  ++A  
Sbjct: 6   ILSAIFVCAQISYGQSSWLELLPGAKKLSYDEKTGKQRLTGFVNFKY-QGNVMFCDSAHY 64

Query: 160 DVKNITINSSDPVII-THSDFVLSANFARIENSSRSAVFAGQVSVV 204
             +   + +   V I       L  +       +R A   G V + 
Sbjct: 65  KERTNEVWAYGKVQINKADTLNLFCDSMYYNGKTRLAKLWGHVRIR 110



 Score = 38.2 bits (87), Expect = 0.87,   Method: Composition-based stats.
 Identities = 16/143 (11%), Positives = 40/143 (27%), Gaps = 15/143 (10%)

Query: 76  YSKDRVKYSLVAERAKTSFNSGKGIIF----LQDFELTVPTQRSEY----------GDMY 121
            + D + Y   + +A          I     L            E            ++ 
Sbjct: 116 LTTDSLDYDAKSSKAIYRNKGRIENITTNEVLTSVFGYFYPNTEESFFKGNVVYKSDELK 175

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVL 181
           L   +  +N   H ++   P     K + +   +     V+      ++   I  +  ++
Sbjct: 176 LTTDTLHYNYLVHKVFFYGPTVGTTK-DSKFYCDKGWYHVQKEEGFLTNHAKIEQAPRII 234

Query: 182 SANFARIENSSRSAVFAGQVSVV 204
           + +        + A   G V ++
Sbjct: 235 TGDSLFYAPKRKFAEGRGNVQML 257



 Score = 35.5 bits (80), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/197 (10%), Positives = 44/197 (22%), Gaps = 27/197 (13%)

Query: 27  LKFFFPFATVTIVGWFLL--SSWIRISTFSKSSIDLLDFEPMIMK---KFILSDY----S 77
           +K     + + +        SSW+ +   +K            +     F          
Sbjct: 1   MKIALILSAIFVCAQISYGQSSWLELLPGAKKLSYDEKTGKQRLTGFVNFKYQGNVMFCD 60

Query: 78  K---DRVKYSLVAERAKTSFNSGK-----------GIIFLQDFELTVPTQRSEYGDMYLF 123
                     + A        +             G   L      V  +  EY    L 
Sbjct: 61  SAHYKERTNEVWAYGKVQINKADTLNLFCDSMYYNGKTRLAKLWGHVRIRDREY---KLT 117

Query: 124 AHSARFN-LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
             S  ++  ++  +Y ++     +  N  L                   V+    +  L+
Sbjct: 118 TDSLDYDAKSSKAIYRNKGRIENITTNEVLTSVFGYFYPNTEESFFKGNVVYKSDELKLT 177

Query: 183 ANFARIENSSRSAVFAG 199
            +            F G
Sbjct: 178 TDTLHYNYLVHKVFFYG 194


>gi|261344900|ref|ZP_05972544.1| conserved hypothetical protein [Providencia rustigianii DSM 4541]
 gi|282567040|gb|EFB72575.1| conserved hypothetical protein [Providencia rustigianii DSM 4541]
          Length = 197

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 47/137 (34%), Gaps = 9/137 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y L A++      +   I +  +  LT     +      + +  AR       LY+    
Sbjct: 62  YKLAAKKV--DNYTSGKITWFTNPVLT-TYNDAGVPTWTVKSIKARL-TKERVLYLYSDV 117

Query: 143 KMKVKDN----LRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++          R+  + AV+++    ++S D V I       +    R    SR+A   
Sbjct: 118 QVDSLTQESQIQRVLTDNAVVNLVTQDVSSDDKVTIIGQGLNSTGLKMRGNLRSRTAELI 177

Query: 199 GQVSVVVNPGVLQKKEN 215
             V         ++++N
Sbjct: 178 EDVKTQYE-LQPKEQQN 193


>gi|294793351|ref|ZP_06758496.1| putative LPS-assembly protein (Organic solvent tolerance protein)
           [Veillonella sp. 6_1_27]
 gi|294455782|gb|EFG24147.1| putative LPS-assembly protein (Organic solvent tolerance protein)
           [Veillonella sp. 6_1_27]
          Length = 240

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 32/133 (24%), Gaps = 10/133 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 ++ A+      NSG+                    D  +      +N       
Sbjct: 25  AANDPLTISADTLSYDGNSGRADATGNVVI--------TQADKTMTGAKGWYNTKTQEAN 76

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   D        AV    N    ++  V +  +D  +  +       S   + 
Sbjct: 77  LDGGVSMIGSDMAM--SAQAVHSYNNNKFTANGSVHLQRADRQIFGDSVEYNTDSEYGLV 134

Query: 198 AGQVSVVVNPGVL 210
            G   ++     L
Sbjct: 135 TGNARLIAEGTTL 147


>gi|329298198|ref|ZP_08255534.1| lipopolysaccharide exporter periplasmic protein [Plautia stali
           symbiont]
          Length = 190

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/147 (10%), Positives = 46/147 (31%), Gaps = 10/147 (6%)

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFE-----LTVPTQRSEYGDMYLF 123
           +    +  +   V Y+     A    +        ++       +      ++     + 
Sbjct: 39  QAPTYTSANSSTVVYNPTGALAYKLVSDKVTYFSAEEVSWFDNPVMTTYDENKVPTWSVR 98

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHSDF 179
           A  A+    +  LY+    ++          R+  + A +++ +  + S+D V +    F
Sbjct: 99  ADKAKL-TKDRMLYLYGHVEVHTLTQDSQLERIITDNAQVNLVSQDVTSNDQVTLFGRSF 157

Query: 180 VLSANFARIENSSRSAVFAGQVSVVVN 206
             +    R    +++A    +V     
Sbjct: 158 NSTGMKMRGNLRAKNAELLEKVKTSYE 184


>gi|110635994|ref|YP_676202.1| OstA-like protein [Mesorhizobium sp. BNC1]
 gi|110286978|gb|ABG65037.1| OstA-like protein [Chelativorans sp. BNC1]
          Length = 186

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/193 (11%), Positives = 55/193 (28%), Gaps = 27/193 (13%)

Query: 34  ATVTIVGWFLL----SSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAER 89
               +    L      +    S  S+  ++L   EP+ +    +    + +   +L    
Sbjct: 8   LAFAMGLLMLWPAGGLAQTSESRPSQLGLNLSSDEPIQIDGARVE-VDQTQNLATLTG-- 64

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
                   +G   L+   L +             A+          L       +K +  
Sbjct: 65  ---DVQVVQGPTLLKTARLKIFYAEGSGLPTSGAAN-------IKRLEADGGVYVKSET- 113

Query: 150 LRLDFETAVLDVKNITINSSDP-VIITHSDFVLSANFARIENSSRSAVFA--------GQ 200
                +    D+    +  S   V++T  + V+      ++  +  A           G+
Sbjct: 114 QVATGDQGTFDMGTEVLVLSGKEVVLTEGENVIVGCKLTVQMKTGQATLESCKDGGSGGR 173

Query: 201 VSVVVNPGVLQKK 213
           V +++ P    ++
Sbjct: 174 VRMLLTPSSQNRQ 186


>gi|167552033|ref|ZP_02345786.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205323237|gb|EDZ11076.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 191

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L        +   S       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAILVLIGINLADKDDPAAVMVNSNDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YFSDQAVSWFTQPVLTTFDKD-KVSTWSIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S+D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQINLVTQDVTSNDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|312142845|ref|YP_003994291.1| OstA family protein [Halanaerobium sp. 'sapolanicus']
 gi|311903496|gb|ADQ13937.1| OstA family protein [Halanaerobium sp. 'sapolanicus']
          Length = 215

 Score = 44.7 bits (104), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/189 (10%), Positives = 51/189 (26%), Gaps = 19/189 (10%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            + + ++       +++I    ++      S +  +       E  I+           +
Sbjct: 4   SKRVLYILIILVIFSLSIGAEEVVEPRESQSVYINAESLSYQEEKTILSG----GVRIRK 59

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQD-FELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
               + A          +  IFL+D      P          + A      L        
Sbjct: 60  ADTLITALTG--DLFRSEQRIFLEDDIRAEYPDG-------IVTASFLNAFLNEEEYIFE 110

Query: 140 QPFKMKVKDNLR-----LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
           +   +  + +       L  +   L   + +  +   V I +       + A  +  +  
Sbjct: 111 ETVLLNYRLSAEKDILVLTSQYLKLFGSDNSFTAEKDVEIDYEGQNFRGDRADYDGQTEI 170

Query: 195 AVFAGQVSV 203
            + +G V +
Sbjct: 171 LLLSGNVEI 179



 Score = 42.4 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 35/106 (33%), Gaps = 3/106 (2%)

Query: 106 FELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT 165
                  +  E   +Y+ A S  +        +S   +++ K +  +   T  L      
Sbjct: 21  IGAEEVVEPRESQSVYINAESLSYQEEK--TILSGGVRIR-KADTLITALTGDLFRSEQR 77

Query: 166 INSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
           I   D +   + D +++A+F     +    +F   V +       +
Sbjct: 78  IFLEDDIRAEYPDGIVTASFLNAFLNEEEYIFEETVLLNYRLSAEK 123


>gi|269792855|ref|YP_003317759.1| hypothetical protein Taci_1246 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100490|gb|ACZ19477.1| hypothetical protein Taci_1246 [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 184

 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 61/187 (32%), Gaps = 11/187 (5%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVK 82
            I  +K   P A +  VG F L   + +   +K +  L     +  +   + D +    +
Sbjct: 4   RIGRMKILLPLAALLAVGAFFLYRDLSLPERAKEAGTLRSLPDVEAQGLSI-DRTIKGER 62

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLAN---HTLYIS 139
           + + A+RA        G + + DF +   +       M L A    ++       TL  S
Sbjct: 63  WLMEAQRA----EKSGGTVRVWDFRVRRSSPSGR-PVMELTAREGLYDEDGTFVKTLDFS 117

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
             F+     +       AV  V     + +  V ++   F    +   I          G
Sbjct: 118 GTFRSA-GRDYVCSGGEAVYHVDQDRWDLARGVKVSRDGFTAQGDGGVIHRDG-RISLRG 175

Query: 200 QVSVVVN 206
            + V + 
Sbjct: 176 GIRVTLE 182


>gi|198243210|ref|YP_002217288.1| hypothetical protein SeD_A3676 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197937726|gb|ACH75059.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 191

 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L        +   S       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAILVLIGINLADKDDPAAVMVNSNDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     L A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YFSDQAVSWFTQPVLTTFDKD-KVPTWSLKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S+D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQINLVTQDVTSNDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|260577295|ref|ZP_05845268.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
 gi|259020476|gb|EEW23799.1| lipopolysaccharide transport periplasmic protein LptA [Rhodobacter
           sp. SW2]
          Length = 169

 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 40/121 (33%), Gaps = 6/121 (4%)

Query: 99  GIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH-----TLYISQPFKMKVKDNLRLD 153
            +       +         G++ L A + R            L+ S    +        +
Sbjct: 49  DVDQATGVAVFTGNVLVGQGELRLSAATVRVEYDAEGKAISKLHASGGVTLANATEA-AE 107

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
              AV  + + ++  +  V++T  +  ++     I+ ++ +    G+V  V  P     K
Sbjct: 108 SSEAVYTIASGSVVMTGNVLLTQGESAITGQRLVIDVNAGTGTMEGRVQTVFVPAKKPAK 167

Query: 214 E 214
           +
Sbjct: 168 Q 168


>gi|204931217|ref|ZP_03222011.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204319984|gb|EDZ05190.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 191

 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/192 (13%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSS--WIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  L        +   S       +    ++         +
Sbjct: 2   SKTRRWVIILLSLAILVLIGINLADKDHPAAVMVNSNDPTYKSEHTDTVVYSP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YFSDQAVSWFTQPVLTTFDKD-KVPTWSIKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S+D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDAQLRRITTDNAQINLVTQDVTSNDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|218659744|ref|ZP_03515674.1| hypothetical protein RetlI_08857 [Rhizobium etli IE4771]
          Length = 71

 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 7/45 (15%), Positives = 14/45 (31%)

Query: 20 HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFE 64
          H   ++ LK   P A + +       + + I        +    E
Sbjct: 27 HSARVRRLKILLPVAALIVAAGLTAVALVSIYLPENVKFEGAKIE 71


>gi|88808699|ref|ZP_01124209.1| hypothetical protein WH7805_03377 [Synechococcus sp. WH 7805]
 gi|88787687|gb|EAR18844.1| hypothetical protein WH7805_03377 [Synechococcus sp. WH 7805]
          Length = 395

 Score = 44.7 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 14/173 (8%), Positives = 51/173 (29%), Gaps = 10/173 (5%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKT 92
           F++  +     L+                 F  + +++   +       ++SL +  A+ 
Sbjct: 10  FSSCLLASLPWLAGCADGDAPVAVEAPPFVFRSLELEQKSSTGQ----KEWSLSSPEARY 65

Query: 93  SFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLR- 151
             N    ++  +     +           + +  A+       + +    K++     + 
Sbjct: 66  ELNRR--LVRARQPVGLLFRN--GKPSFRIQSDLAQVINDGEKILLEGNVKLQQLTGSKL 121

Query: 152 -LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
            +  +          +        +  +  +SA+ A ++ ++      G V +
Sbjct: 122 LIQGDRLRWRPDQGVLTMEQRPRASDQESRISASQAELQQTTNELTLTGTVQL 174


>gi|170079301|ref|YP_001735939.1| hypothetical protein SYNPCC7002_A2708 [Synechococcus sp. PCC 7002]
 gi|169886970|gb|ACB00684.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 362

 Score = 44.7 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/99 (17%), Positives = 30/99 (30%), Gaps = 5/99 (5%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITH--S 177
            L A      L    + +S    +      ++     A  D++   I   D V +T    
Sbjct: 207 RLRADQGEAQLKAQKIIVSGNVLLNSLDPEIQFASGAATWDIQAGIITGQDSVQLTQTAE 266

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVVN--PGVLQKKE 214
                 N  R    ++ A  +G V       P  L+  +
Sbjct: 267 RVQFRGNQGRYNLKTQQAQLSGAVRGTGEDPPTSLKANQ 305


>gi|218781660|ref|YP_002432978.1| Organic solvent tolerance protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763044|gb|ACL05510.1| Organic solvent tolerance protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 753

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 9/88 (10%), Positives = 31/88 (35%), Gaps = 1/88 (1%)

Query: 113 QRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPV 172
                    + A   +++   +T   S    +      R++ + A  D  N ++ +   V
Sbjct: 37  NMDPSEPWNITADKLQYDNMTNTYRGSGNVLIWRS-GYRMEADEAGFDRNNNSLWAVGNV 95

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQ 200
            +     V++ +   ++ ++ + +    
Sbjct: 96  TVKGGGDVVTGDRVYMDLATETGLVENG 123


>gi|238758313|ref|ZP_04619491.1| hypothetical protein yaldo0001_2000 [Yersinia aldovae ATCC 35236]
 gi|238703436|gb|EEP95975.1| hypothetical protein yaldo0001_2000 [Yersinia aldovae ATCC 35236]
          Length = 164

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 44/128 (34%), Gaps = 8/128 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y LVAE       S + + +     +T+    +      + A  A+    +  LY+    
Sbjct: 38  YKLVAEDV--QNFSVQELTWFTKPVMTLF-GDNAVATWTVRADRAKL-TDDKMLYLYGHV 93

Query: 143 KMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++          ++  + A +++    ++S D V +    F  +    R     ++A   
Sbjct: 94  EVDSLTPDAQLQKIKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELI 153

Query: 199 GQVSVVVN 206
            +V     
Sbjct: 154 EKVKTSYE 161


>gi|254453115|ref|ZP_05066552.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           238]
 gi|198267521|gb|EDY91791.1| cell envelope biogenesis protein YhbN [Octadecabacter antarcticus
           238]
          Length = 143

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 44/133 (33%), Gaps = 14/133 (10%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAH--SARFNLANHT---L 136
              + A+       SG  I                 GD+ L A      +N A+     L
Sbjct: 19  PVEITADSLSIDQASGTAIFIGNVVFGQ--------GDLRLNAARVQVIYNDASGDISRL 70

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAV 196
             S             +  TA  ++   T+  +  V++T     +S++  R+  S  SA 
Sbjct: 71  SASGGVTFATATEAA-EALTADYNLDTGTLELAGDVLLTQGASAISSDTMRVNLSDGSAQ 129

Query: 197 FAGQVSVVVNPGV 209
             G+V  + N G 
Sbjct: 130 MEGRVRTIFNQGN 142


>gi|168786085|ref|ZP_02811092.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|261228210|ref|ZP_05942491.1| hypothetical protein EscherichiacoliO157_26893 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255066|ref|ZP_05947599.1| inner membrane protein [Escherichia coli O157:H7 str. FRIK966]
 gi|189373949|gb|EDU92365.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
          Length = 191

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 23/192 (11%), Positives = 65/192 (33%), Gaps = 16/192 (8%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLS--SWIRISTFSKSSIDLLDFEPMIMKKFILSDYSK 78
            +  +++      A + ++G  +       ++   +       +    ++         +
Sbjct: 2   SKARRWVIIVLSLAFLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNP------E 55

Query: 79  DRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
             + Y L+A+  +  + S + + +     LT   +  +     + A  A+    +  LY+
Sbjct: 56  GALSYRLIAQHVE--YYSDQAVSWFTQPVLTTFDKD-KIPTWSVKADKAKL-TNDRMLYL 111

Query: 139 SQPFKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRS 194
               ++          R+  + A +++    + S D V +  + F  S    R    S++
Sbjct: 112 YGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKN 171

Query: 195 AVFAGQVSVVVN 206
           A    +V     
Sbjct: 172 AELIEKVRTSYE 183


>gi|303230205|ref|ZP_07316973.1| OstA-like protein [Veillonella atypica ACS-134-V-Col7a]
 gi|302515131|gb|EFL57105.1| OstA-like protein [Veillonella atypica ACS-134-V-Col7a]
          Length = 239

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 12/137 (8%), Positives = 36/137 (26%), Gaps = 10/137 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            +    ++ A+      N+G+           +  Q        +   +  +N       
Sbjct: 25  ANEGPLTISADTLSYDGNTGRAEASGNVV---ITQQDK-----TMTGANGWYNTKTREAS 76

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   +        +V  V +   ++   V +   D  +  +     + +     
Sbjct: 77  LEGGVSMIGDNMSM--SAQSVHSVNDNQFSAEGDVHLQRDDRQIFGDSVEYNSDTEYGKV 134

Query: 198 AGQVSVVVNPGVLQKKE 214
            G   ++     L   +
Sbjct: 135 VGNAKLIAEGTTLTGNQ 151


>gi|303230987|ref|ZP_07317730.1| OstA-like protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302514369|gb|EFL56368.1| OstA-like protein [Veillonella atypica ACS-049-V-Sch6]
          Length = 239

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 12/137 (8%), Positives = 36/137 (26%), Gaps = 10/137 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
            +    ++ A+      N+G+           +  Q        +   +  +N       
Sbjct: 25  ANEGPLTISADTLSYDGNTGRAEASGNVV---ITQQDK-----TMTGANGWYNTKTREAS 76

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   +        +V  V +   ++   V +   D  +  +     + +     
Sbjct: 77  LEGGVSMIGDNMSM--SAQSVHSVNDNQFSAEGDVHLQRDDRQIFGDSVEYNSDTEYGKV 134

Query: 198 AGQVSVVVNPGVLQKKE 214
            G   ++     L   +
Sbjct: 135 VGNAKLIAEGTTLTGNQ 151


>gi|152972123|ref|YP_001337269.1| hypothetical protein KPN_03609 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238896706|ref|YP_002921451.1| hypothetical protein KP1_4921 [Klebsiella pneumoniae NTUH-K2044]
 gi|329997611|ref|ZP_08302880.1| lipopolysaccharide export system protein LptC [Klebsiella sp. MS
           92-3]
 gi|150956972|gb|ABR79002.1| hypothetical protein KPN_03609 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238549033|dbj|BAH65384.1| hypothetical protein KP1_4921 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|328538952|gb|EGF65005.1| lipopolysaccharide export system protein LptC [Klebsiella sp. MS
           92-3]
          Length = 191

 Score = 44.3 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 51/137 (37%), Gaps = 11/137 (8%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y L+AE  +  + S + + +     +T     ++     + A  A+    +  LY+   
Sbjct: 59  SYRLIAEHVE--YFSDQEVSWFTKPVMT-TFDTNKVPTWSVRADKAKL-TNDRMLYLYGH 114

Query: 142 FKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          ++  + A +++    + S D V +  + F  S    R    S++A  
Sbjct: 115 VEVNALAPDSQLRKITTDNAQINLVTQDVTSDDMVTLYGTTFNSSGLKMRGNLRSKNAEL 174

Query: 198 AGQVSVVVNPGVLQKKE 214
             +V        +Q K+
Sbjct: 175 IEKVRTSYE---IQNKQ 188


>gi|238789758|ref|ZP_04633540.1| hypothetical protein yfred0001_29080 [Yersinia frederiksenii ATCC
           33641]
 gi|238722117|gb|EEQ13775.1| hypothetical protein yfred0001_29080 [Yersinia frederiksenii ATCC
           33641]
          Length = 169

 Score = 44.3 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 47/128 (36%), Gaps = 8/128 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y LVAE    +F + + + +     +T+  + +      + A  A+    +  LY+    
Sbjct: 43  YKLVAEE-VQNFAT-QELTWFTRPVMTMFDENA-VATWTVRADRAKL-TNDKMLYLYGHV 98

Query: 143 KMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++          ++  + A +++    ++S D V +    F  +    R     ++A   
Sbjct: 99  EVDSLTPDAQLQKIRTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELI 158

Query: 199 GQVSVVVN 206
            +V     
Sbjct: 159 EKVKTSYE 166


>gi|123443939|ref|YP_001007910.1| hypothetical protein YE3756 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090900|emb|CAL13782.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 187

 Score = 44.3 bits (103), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 45/128 (35%), Gaps = 8/128 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y LVAE  +      + + +     +T+  + +      + A  A+    +  LY+    
Sbjct: 61  YKLVAEEVQNFSA--QQLTWFTRPVMTMFDENA-VATWTVRADRAKL-TDDKMLYLYGHV 116

Query: 143 KMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++          ++  + A +++    ++S D V +    F  +    R     ++A   
Sbjct: 117 EVDSLTPDAQLQKIKTDNAQVNLITQDVSSDDEVTLFGVGFTSNGMKMRGNLRDKTAELI 176

Query: 199 GQVSVVVN 206
            +V     
Sbjct: 177 EKVKTSYE 184


>gi|332830540|gb|EGK03161.1| hypothetical protein HMPREF9455_00731 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 795

 Score = 44.3 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/175 (11%), Positives = 49/175 (28%), Gaps = 6/175 (3%)

Query: 25  QFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYS 84
           + L+       +T++   +L S+  I           +   +        + + D   Y 
Sbjct: 15  KSLRIIN-LLGLTLIFACILVSYTYIKRELSYDKFYSNAHRIARMTLSYENNTADGRIYG 73

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM 144
           + A++        + ++ L+     +         +     S  F    + L I     +
Sbjct: 74  ISAKQIWQDIPEIEDVLKLELVNTAILNHNGNKQVL-----SNLFFAGENLLNILDIPLI 128

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +           +V+  + + +       I      LS+          S VF  
Sbjct: 129 EGNSKEAFRSPESVIISERLALQLFGRTDIIGEKIELSSRRIESTVRFISGVFKN 183


>gi|206890519|ref|YP_002248079.1| hypothetical protein THEYE_A0230 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742457|gb|ACI21514.1| hypothetical protein THEYE_A0230 [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 172

 Score = 44.3 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 25/183 (13%), Positives = 59/183 (32%), Gaps = 22/183 (12%)

Query: 28  KFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS----KDRV-K 82
           KF   FA + ++   L+       T      +      + M+     D      KD   K
Sbjct: 3   KFILIFAAIVVIAILLI-------TLDYMDKESQIKVRVSMEGSFFKDAEFIQKKDGQVK 55

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
             L ++ A    +    ++ ++   +  P +        + +    +   +  L ++   
Sbjct: 56  LQLSSKEAF--MSDDGKLMDMKYLTMFFPEKE-----FTVKSQRGFYYPESGDLILTDGI 108

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
           +     + R+    A    K+ T+ S  P+ +  S F +  +  +    +        V 
Sbjct: 109 EGL-SKDYRVYGTEAYWSAKDKTLYSEKPLKVVSSKFSIEGSSGKAS--ADLIELKKGVV 165

Query: 203 VVV 205
            +V
Sbjct: 166 AIV 168


>gi|238019690|ref|ZP_04600116.1| hypothetical protein VEIDISOL_01564 [Veillonella dispar ATCC 17748]
 gi|237863731|gb|EEP65021.1| hypothetical protein VEIDISOL_01564 [Veillonella dispar ATCC 17748]
          Length = 244

 Score = 44.3 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 14/137 (10%), Positives = 35/137 (25%), Gaps = 10/137 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 ++ A+      N+G+                    D  +   +  +N       
Sbjct: 29  AANDPLTISADTLSYDGNTGRADANGNVVI--------TQADKTMTGANGWYNTKTQEAN 80

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   D        +V    N    ++  V +  SD  +  +       +   + 
Sbjct: 81  LDGGVSMIGTDMAM--SAQSVHSYNNNKFTANGGVHLQRSDRQIFGDKVEYNTDTEYGLV 138

Query: 198 AGQVSVVVNPGVLQKKE 214
           +G   ++     L   +
Sbjct: 139 SGNARLIAEGTTLTGNQ 155


>gi|257126783|ref|YP_003164897.1| OstA family protein [Leptotrichia buccalis C-1013-b]
 gi|257050722|gb|ACV39906.1| OstA family protein [Leptotrichia buccalis C-1013-b]
          Length = 841

 Score = 44.3 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 26/81 (32%), Gaps = 1/81 (1%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
           L A    ++  N  +        K  + N +L  +    D KN   N+   VI T  +  
Sbjct: 237 LTADKMTYDDINKIVTAEGHAFYKDKEKNRQLRADKMRFDDKNQVGNAEGHVIYTDPENR 296

Query: 181 LSANFARIENSSRSAVFAGQV 201
           L+ +              G +
Sbjct: 297 LTGDKVDYYRKEERIEGQGHI 317



 Score = 42.0 bits (97), Expect = 0.053,   Method: Composition-based stats.
 Identities = 19/137 (13%), Positives = 42/137 (30%), Gaps = 7/137 (5%)

Query: 85  LVAERAKTSFNSGKGIIFLQDFELTVPTQRS-EYGDMYLFAHSARFNLANHTLYISQPFK 143
            V   AK  F S K    +      +       Y ++ L +     +   + +       
Sbjct: 519 FVGNTAKIYFISHKNGKNMSITRSEIKGNVRMTYKEVTLDSQYNEIDTGRNLILARDKVM 578

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITH-----SDFVLSANFARIENSSRSAVFA 198
           +  ++N ++      +D+      + + V I            SA+ A I    +     
Sbjct: 579 VDFRNNTKMTSNYLYMDMNKQEGYARNNVKIISRLPQFKTINTSADRAIIYLKDKKIKLN 638

Query: 199 GQVSVVVNPGVLQKKEN 215
           G+V V      +   ++
Sbjct: 639 GKV-VTYQGKNMISSQS 654



 Score = 41.2 bits (95), Expect = 0.099,   Method: Composition-based stats.
 Identities = 10/90 (11%), Positives = 25/90 (27%), Gaps = 1/90 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L      +      +       +    N  +  + A   +K   I+    V  T    +
Sbjct: 296 RLTGDKVDYYRKEERIEGQGHI-VYTGRNSVISGDKATYFIKKKQIDGRGNVKYTGQTMI 354

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVL 210
           ++ +    +  S+     G  +    P  +
Sbjct: 355 ITGDHVFYDEVSKILNGDGNGTYNYLPRKI 384



 Score = 40.9 bits (94), Expect = 0.14,   Method: Composition-based stats.
 Identities = 10/84 (11%), Positives = 23/84 (27%), Gaps = 3/84 (3%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITH--S 177
            + A    +N                 K    L  +    D  +    +   VI     +
Sbjct: 174 TMTADKIIYNTTTKITNAEGHVIYIDKKKKRELRGDKMSYDEVHKFGTAEGHVIYLDHAN 233

Query: 178 DFVLSANFARIENSSRSAVFAGQV 201
           +  L+A+    ++ ++     G  
Sbjct: 234 NRELTADKMTYDDINKIVTAEGHA 257


>gi|262042759|ref|ZP_06015913.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039984|gb|EEW41101.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 191

 Score = 44.3 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 47/129 (36%), Gaps = 8/129 (6%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
            Y L+AE  +  + S + + +     +T     ++     + A  A+    +  LY+   
Sbjct: 59  SYRLIAEHVE--YFSDQEVSWFTKPVMT-TFDTNKVPTWSVRADKAKL-TNDRMLYLYGH 114

Query: 142 FKMK----VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
            ++          ++  + A +++    + S D V +  + F  S    R    S++A  
Sbjct: 115 VEVNALAPDSQLRKITTDNAQINLVTQDVTSDDMVTLYGTTFNSSGLKMRGNLRSKNAEL 174

Query: 198 AGQVSVVVN 206
             +V     
Sbjct: 175 IEKVRTSYE 183


>gi|224024285|ref|ZP_03642651.1| hypothetical protein BACCOPRO_01008 [Bacteroides coprophilus DSM
           18228]
 gi|224017507|gb|EEF75519.1| hypothetical protein BACCOPRO_01008 [Bacteroides coprophilus DSM
           18228]
          Length = 208

 Score = 43.9 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 10/72 (13%), Positives = 21/72 (29%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
           D  + A +A +        +     ++ +   + D +    D     I S   + I   D
Sbjct: 105 DASIKADTAYYYETKKLWELRGNVHIQSQRGDKFDTQLMYWDQGKEKIYSDRFIRIEQPD 164

Query: 179 FVLSANFARIEN 190
            +L         
Sbjct: 165 GLLMGYGFESNQ 176


>gi|255007874|ref|ZP_05280000.1| hypothetical protein Bfra3_01968 [Bacteroides fragilis 3_1_12]
          Length = 167

 Score = 43.9 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 8/74 (10%), Positives = 23/74 (31%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
           D  + A +A +   +    +     +K      +  E    +     + +   V +   D
Sbjct: 67  DASIKADTAYYYDRDRLWKLIGNVDIKSLKGDHVSTELLYWNEATKKVYTDKFVQMEQPD 126

Query: 179 FVLSANFARIENSS 192
            V++      ++  
Sbjct: 127 QVITGYGFESDDRF 140


>gi|86749598|ref|YP_486094.1| organic solvent tolerance protein [Rhodopseudomonas palustris HaA2]
 gi|86572626|gb|ABD07183.1| Organic solvent tolerance protein [Rhodopseudomonas palustris HaA2]
          Length = 833

 Score = 43.9 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 28/84 (33%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + +  A+    N      +P +      + +       D  N  +++   V +  +   
Sbjct: 45  SISSAEAQSYTYNPRPARPRPPQTGTDGQMLVQATEVNYDYNNQRVSAVGNVQMFFNGTS 104

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           + A+    + +++     G V + 
Sbjct: 105 VEADRLVYDQNTKRLRAEGNVRMT 128


>gi|315187276|gb|EFU21032.1| protein of unknown function DUF1239 [Spirochaeta thermophila DSM
           6578]
          Length = 181

 Score = 43.9 bits (102), Expect = 0.014,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 37/126 (29%), Gaps = 6/126 (4%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
            S+ AE+A+        I+ +         +          A  ARF+     +      
Sbjct: 52  LSVTAEKAEE--YRDAQILAVTGVLFQEFDREGNVVR-QARAAHARFHRDTEDIETEGEV 108

Query: 143 KMKVKDNLR-LDFETAVLDVKNITINSS--DPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +++ +     +         K  +I++     V I   D+ L       +  + S  F G
Sbjct: 109 EVQDRTEDITIRGSDFTWKKKERSISAPPGVEVEIQGEDYRLRGTGFSADAGTLSLRFTG 168

Query: 200 QVSVVV 205
                 
Sbjct: 169 NPQGTY 174


>gi|49475337|ref|YP_033378.1| hypothetical protein BH05430 [Bartonella henselae str. Houston-1]
 gi|49238143|emb|CAF27351.1| expressed protein [Bartonella henselae str. Houston-1]
          Length = 789

 Score = 43.9 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 10/83 (12%), Positives = 25/83 (30%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
                   + L A    +N   +T+      +++     ++  +    + K   I +   
Sbjct: 47  HSPKPVSPLLLSADELIYNRDENTVSAQGNVQIEYN-GNKVVAQKVTYNQKTGRIIAQGN 105

Query: 172 VIITHSDFV-LSANFARIENSSR 193
           V I   D   + +N   +     
Sbjct: 106 VEIVQKDGNKIYSNQIDMTKDFG 128



 Score = 37.8 bits (86), Expect = 1.0,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 20/53 (37%)

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           L  +  + +    T+++   V I ++   + A        +   +  G V +V
Sbjct: 57  LSADELIYNRDENTVSAQGNVQIEYNGNKVVAQKVTYNQKTGRIIAQGNVEIV 109


>gi|213961698|ref|ZP_03389964.1| OstA family protein [Capnocytophaga sputigena Capno]
 gi|213955487|gb|EEB66803.1| OstA family protein [Capnocytophaga sputigena Capno]
          Length = 560

 Score = 43.9 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 17/185 (9%), Positives = 52/185 (28%), Gaps = 12/185 (6%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYS---KDRVKY 83
           +K  F +  + I      +   + +      I+++      +        +    D  + 
Sbjct: 1   MKKTFFYILLLIFVCGAQNIVAQNNEPKTKRIEIVYGGEFTIDNVKYPGATIFKSDGQRV 60

Query: 84  SLVAERAKTSFNSGKGIIFL----QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYIS 139
                      +    +  L     +          +   + + +    +     T    
Sbjct: 61  QFR----HQGLDVWCDLAVLYEEKNEVIAHGNVVLQQGDTLQMNSQYISYKGNTKTAVAR 116

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +   ++   N+ L+ E    D        ++   IT  +  L++   +   +++   F  
Sbjct: 117 EGVVLR-NGNMTLETEELFFDRNKQEAYYNNFGKITDPENELTSQTGKYYVTTKKNQFTN 175

Query: 200 QVSVV 204
            V +V
Sbjct: 176 SVKIV 180


>gi|254526892|ref|ZP_05138944.1| putative SMC domain N terminal domain [Prochlorococcus marinus str.
           MIT 9202]
 gi|221538316|gb|EEE40769.1| putative SMC domain N terminal domain [Prochlorococcus marinus str.
           MIT 9202]
          Length = 193

 Score = 43.9 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 13/109 (11%), Positives = 36/109 (33%), Gaps = 3/109 (2%)

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN--LRLDFETAVLDVKNI 164
           +  +     E     + +  +  +  N  L +    K+K        L  +  + +++N 
Sbjct: 54  KPIINIFNGEETKYIISSDESTLSDNNKLLKLKGNVKLKTLKKGVDILYADNFIWNIENT 113

Query: 165 TINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKK 213
                  +   + + +L++  A I  +     F   V  ++     + K
Sbjct: 114 NYLLEGNIRFENQNIILNSGKA-ILGTDNIIEFFNPVKYIIKDENNENK 161


>gi|269797611|ref|YP_003311511.1| OstA family protein [Veillonella parvula DSM 2008]
 gi|269094240|gb|ACZ24231.1| OstA family protein [Veillonella parvula DSM 2008]
          Length = 239

 Score = 43.9 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 32/133 (24%), Gaps = 10/133 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 ++ A+      NSG+                    D  +      +N       
Sbjct: 24  AANDPLTISADTLSYDGNSGRADATGNVVI--------TQADKTMTGAKGWYNTKTQEAN 75

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   D        AV    N    ++  V +  +D  +  +       S   + 
Sbjct: 76  LDGGVSMIGSDMAM--SAQAVHSYNNNKFTANGSVHLQRADRQIFGDSVEYSTDSEYGLV 133

Query: 198 AGQVSVVVNPGVL 210
            G   ++     L
Sbjct: 134 TGNARLIAEGTTL 146


>gi|311744942|ref|ZP_07718727.1| lipoprotein [Algoriphagus sp. PR1]
 gi|126577449|gb|EAZ81669.1| lipoprotein [Algoriphagus sp. PR1]
          Length = 203

 Score = 43.9 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 6/97 (6%), Positives = 23/97 (23%), Gaps = 2/97 (2%)

Query: 104 QDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK-DNLRLDFETAVLDVK 162
           +  ++    +          A    +    +        +++    +  L  E    +  
Sbjct: 88  EGVDIQFFDKDGNVTT-TFRADKGFYLRDENLYKGVGDVQVENLVKDQSLKAEEIFWNPN 146

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +  I +   V +     V +      +    +     
Sbjct: 147 DKKIYTEKFVTVRDGQTVFNGTGMEADEGFSNYTLRN 183


>gi|300769994|ref|ZP_07079873.1| hypothetical protein HMPREF0766_10204 [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300762470|gb|EFK59287.1| hypothetical protein HMPREF0766_10204 [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 798

 Score = 43.9 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/187 (10%), Positives = 57/187 (30%), Gaps = 22/187 (11%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKK---------FILSDYS 77
           +K  F F    +   F L +  +    +   + L+    M + K          +     
Sbjct: 1   MKRLFLF---VLTYIFCLFASAQQPQPTGDQLKLVSSSSMRLVKNPDRTIYYRPVFEHKG 57

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 +L A+      ++     F     + +           +++    ++ A     
Sbjct: 58  S-----TLSADSGYMYEDAIGRQFFEAFDNVVITQPSGTI----IYSDKLHYDAAPQVAT 108

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +++  +M    +  L       ++++     +    I      +++  A    +++ A F
Sbjct: 109 LTRNVRMV-DRSSVLTTNYLTYNMRSKVGTYTGGGRIVSKGDTITSKNAYYFENTQDAYF 167

Query: 198 AGQVSVV 204
             +V V 
Sbjct: 168 RNKVVVR 174


>gi|317485283|ref|ZP_07944163.1| hypothetical protein HMPREF0179_01516 [Bilophila wadsworthia 3_1_6]
 gi|316923409|gb|EFV44615.1| hypothetical protein HMPREF0179_01516 [Bilophila wadsworthia 3_1_6]
          Length = 235

 Score = 43.5 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/185 (12%), Positives = 55/185 (29%), Gaps = 11/185 (5%)

Query: 24  IQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMI--MKKFILSDY-SKDR 80
           ++  +     A V ++      +     T     +  +  +  I  +    L    ++  
Sbjct: 1   MKRSRILLITALVALLAGGWYVAKRGGETTLIGRLLDVANKGGIKSLDGAKLQGNATQSG 60

Query: 81  VKYSLVAERAKTSFNSGKGI--IFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYI 138
                VA  A    N  +G   + L   + +          + +     R+ L       
Sbjct: 61  NPLEEVAGLAIKGINLFQGNKGLELWRLKASWAHMSQNGDTIDVDKPVVRYALG------ 114

Query: 139 SQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
                    D L +  +   +      +   D V+IT  D V++++    + + R   F 
Sbjct: 115 EGSASNPDDDVLDVQAQLGRITDNQRFLTLWDNVVITRYDDVITSSRMNYDANKRLMTFP 174

Query: 199 GQVSV 203
              ++
Sbjct: 175 EGAAL 179


>gi|262370368|ref|ZP_06063694.1| organic solvent tolerance protein [Acinetobacter johnsonii SH046]
 gi|262314710|gb|EEY95751.1| organic solvent tolerance protein [Acinetobacter johnsonii SH046]
          Length = 819

 Score = 43.5 bits (101), Expect = 0.017,   Method: Composition-based stats.
 Identities = 7/98 (7%), Positives = 27/98 (27%), Gaps = 2/98 (2%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
           +L           +      + A    +N    ++ +     +  +   ++  +   +D 
Sbjct: 84  WLTPVSPETKAADAANATSTITADYGHYNPQGDSV-LEGNVLIDQE-GRQIRADKITIDQ 141

Query: 162 KNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
                N+   V +  S  +  ++       ++      
Sbjct: 142 TQTFANAEGRVQMAQSGLLAQSDQINYNLKTQQGDLKN 179


>gi|254713810|ref|ZP_05175621.1| organic solvent tolerance protein [Brucella ceti M644/93/1]
 gi|254717132|ref|ZP_05178943.1| organic solvent tolerance protein [Brucella ceti M13/05/1]
 gi|261218947|ref|ZP_05933228.1| organic solvent tolerance protein [Brucella ceti M13/05/1]
 gi|261321554|ref|ZP_05960751.1| organic solvent tolerance protein [Brucella ceti M644/93/1]
 gi|260924036|gb|EEX90604.1| organic solvent tolerance protein [Brucella ceti M13/05/1]
 gi|261294244|gb|EEX97740.1| organic solvent tolerance protein [Brucella ceti M644/93/1]
          Length = 792

 Score = 43.5 bits (101), Expect = 0.018,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIHSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.5 bits (88), Expect = 0.59,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIHSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|239831519|ref|ZP_04679848.1| LPS-assembly protein precursor [Ochrobactrum intermedium LMG 3301]
 gi|239823786|gb|EEQ95354.1| LPS-assembly protein precursor [Ochrobactrum intermedium LMG 3301]
          Length = 799

 Score = 43.5 bits (101), Expect = 0.018,   Method: Composition-based stats.
 Identities = 10/83 (12%), Positives = 28/83 (33%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++      L  +    + +   + ++  
Sbjct: 51  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNHLVADKVTYNQQTRRMTATGN 109

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 110 VEIVERDGNKIYSDHMDVTDSFR 132



 Score = 39.7 bits (91), Expect = 0.25,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 27/87 (31%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
           +L A    +N     +  +   ++  +D  ++  +   +         +   + T  +  
Sbjct: 89  HLVADKVTYNQQTRRMTATGNVEIVERDGNKIYSDHMDVTDSFRDGFVNGLRVETTDNTR 148

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
            +A  A   ++     F   V     P
Sbjct: 149 FAAESAE-RSNGEITTFNNGVYTACEP 174



 Score = 38.9 bits (89), Expect = 0.44,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 23/67 (34%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +   ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 47  LGANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNHLVADKVTYNQQTRRMTA 106

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 107 TGNVEIV 113


>gi|34763051|ref|ZP_00144025.1| S-layer protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|27887277|gb|EAA24374.1| S-layer protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
          Length = 643

 Score = 43.5 bits (101), Expect = 0.018,   Method: Composition-based stats.
 Identities = 8/96 (8%), Positives = 27/96 (28%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L+ +  V   
Sbjct: 35  DIINIYGKIK---GGNPVYSVLADKGEYNVNDKKIRIFGNVDITSTKGEKLNLDNFVYSS 91

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
           +    +     +  T  +  L A +      ++   
Sbjct: 92  ETKEADMYGNKIKYTSPENNLEAEYIHYNTVTKEVT 127



 Score = 40.9 bits (94), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 30/98 (30%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +     E G+  + A      +    + +++   +K   +             V     +
Sbjct: 527 LTIDDGEKGNTLVKADDVTAYIDKELIKLNKNVYVKNINEKKEETVLTADRGTVTKQMAD 586

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V I   D V +AN    +  +R     G V V  
Sbjct: 587 VYDRVKIVTKDSVTTANEGHYDMVNRKIRAKGNVHVDY 624



 Score = 35.8 bits (81), Expect = 3.5,   Method: Composition-based stats.
 Identities = 9/73 (12%), Positives = 22/73 (30%), Gaps = 1/73 (1%)

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
            N    +L ++   K     +   D      +  +  IN    +   +  + + A+    
Sbjct: 1   MNETTQSLKVTDDVKFTY-QDYVFDVSYIEKEPNSDIINIYGKIKGGNPVYSVLADKGEY 59

Query: 189 ENSSRSAVFAGQV 201
             + +     G V
Sbjct: 60  NVNDKKIRIFGNV 72


>gi|260431733|ref|ZP_05785704.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415561|gb|EEX08820.1| lipopolysaccharide transport periplasmic protein LptA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 137

 Score = 43.5 bits (101), Expect = 0.019,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 32/97 (32%), Gaps = 6/97 (6%)

Query: 117 YGDMYLFAHSAR--FNLA---NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            GDM L A      +N        +  S+   +    +     + A   +    I  +  
Sbjct: 40  QGDMRLSAEKVVVIYNQDRSGIERMEASENVVLVAPPDA-AQADRAEYSIATGVIVMTGN 98

Query: 172 VIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           V++      +S +      +  +A   G+V  ++  G
Sbjct: 99  VLLNQGPSTISGDRMVANLTDGTATMTGRVKTILQQG 135



 Score = 37.0 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/97 (13%), Positives = 34/97 (35%), Gaps = 6/97 (6%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT-----INSSDPVI 173
            + + + + + N  + +        +    ++RL  E  V+           + +S+ V+
Sbjct: 13  PVEVTSETLKVNQEDGSAEFLGNVIVVQ-GDMRLSAEKVVVIYNQDRSGIERMEASENVV 71

Query: 174 ITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVL 210
           +        A+ A    ++   V  G V +   P  +
Sbjct: 72  LVAPPDAAQADRAEYSIATGVIVMTGNVLLNQGPSTI 108


>gi|186685198|ref|YP_001868394.1| hypothetical protein Npun_R5117 [Nostoc punctiforme PCC 73102]
 gi|186467650|gb|ACC83451.1| protein of unknown function DUF1239 [Nostoc punctiforme PCC 73102]
          Length = 971

 Score = 43.5 bits (101), Expect = 0.019,   Method: Composition-based stats.
 Identities = 8/122 (6%), Positives = 33/122 (27%), Gaps = 1/122 (0%)

Query: 88  ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK 147
           ++   +  S   +      +       ++   + + +    ++     +       ++  
Sbjct: 328 QQQTQAPTSTPPVNTTNQPQAPASKPPAQPRIVEVTSDRQEYDEQRRIITAVGNVVVRFD 387

Query: 148 DNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNP 207
               +D +   +++ N+       V +T  D +L            +         +  P
Sbjct: 388 -GAVVDADRLQVNLDNLIAAGEGNVTLTRGDQILRGQRFTYNFVQDNGELLNGRGEIYVP 446

Query: 208 GV 209
             
Sbjct: 447 SA 448


>gi|121534203|ref|ZP_01666028.1| OstA family protein [Thermosinus carboxydivorans Nor1]
 gi|121307306|gb|EAX48223.1| OstA family protein [Thermosinus carboxydivorans Nor1]
          Length = 157

 Score = 43.5 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 10/122 (8%)

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQP 141
           K S  A+R    F++G  ++   + ++ + T+        + A  AR NLA   ++ S  
Sbjct: 24  KLSFKADRQYFDFSTGLHVLSG-NVQIEIGTR-------TITAGEARVNLATMEVWASGG 75

Query: 142 FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQV 201
             +    N        V      +   S  V++T     +SA+       +++AVF G V
Sbjct: 76  ITVT--QNDLYFTGDTVYVYAKDSAEISGGVVLTRDGLKISADSVDYNWRTKTAVFKGNV 133

Query: 202 SV 203
            V
Sbjct: 134 QV 135


>gi|294634659|ref|ZP_06713192.1| conserved hypothetical protein [Edwardsiella tarda ATCC 23685]
 gi|291091905|gb|EFE24466.1| conserved hypothetical protein [Edwardsiella tarda ATCC 23685]
          Length = 190

 Score = 43.5 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 49/164 (29%), Gaps = 13/164 (7%)

Query: 48  IRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDF 106
              +                +       Y       Y LVA+       S +G+ +    
Sbjct: 29  PSDAPSVSDPSQPTYQSQHTLTVV----YDPSGKLSYKLVAQDV--QHYSEQGVTWFTRP 82

Query: 107 ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK----VKDNLRLDFETAVLDVK 162
            LT            + A  A+    ++ LY+    ++          R+  + A +++ 
Sbjct: 83  VLT-TFDPQAVATWSVRADRAKL-TKDNMLYLYGNVEVNSLTPTSQLERITTDNAQVNLV 140

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
              I+S D V +  S+F       R     ++A    +V+    
Sbjct: 141 TQDISSDDEVTLYGSNFTSHGLKMRGNMRDKTARLIDKVNTYYE 184


>gi|282850058|ref|ZP_06259440.1| OstA-like protein [Veillonella parvula ATCC 17745]
 gi|282580247|gb|EFB85648.1| OstA-like protein [Veillonella parvula ATCC 17745]
          Length = 240

 Score = 43.2 bits (100), Expect = 0.022,   Method: Composition-based stats.
 Identities = 15/133 (11%), Positives = 31/133 (23%), Gaps = 10/133 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 ++ A+      NSG+                    D  +      +N       
Sbjct: 25  AANDPLTISADTLSYDGNSGRADATGNVVI--------TQADKTMTGAKGWYNTKTQEAN 76

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   D         V    N    ++  V +  +D  +  +       S   + 
Sbjct: 77  LDGGVSMIGSDMAM--SAQTVHSYNNNKFTANGSVHLQRADRQIFGDSVEYSTDSEYGLV 134

Query: 198 AGQVSVVVNPGVL 210
            G   ++     L
Sbjct: 135 TGNARLIAEGTTL 147


>gi|19704029|ref|NP_603591.1| S-layer protein [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
 gi|19714221|gb|AAL94890.1| S-layer protein [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
          Length = 643

 Score = 43.2 bits (100), Expect = 0.022,   Method: Composition-based stats.
 Identities = 9/96 (9%), Positives = 25/96 (26%), Gaps = 4/96 (4%)

Query: 102 FLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDV 161
            + +    +           + A    +N+ +  + I     +      +L  +  V   
Sbjct: 35  DIINIYGKIK---GGNPTYSVLADKGEYNVNDKKIRIFGNVDITSTKGEKLLLDNVVYSS 91

Query: 162 KNITINSSDP-VIITHSDFVLSANFARIENSSRSAV 196
                +     +  T  D  L A +      ++   
Sbjct: 92  ATKEADMYGNKIKYTSPDNNLEAEYIHYNTVTKEVT 127



 Score = 38.5 bits (88), Expect = 0.60,   Method: Composition-based stats.
 Identities = 14/98 (14%), Positives = 28/98 (28%), Gaps = 2/98 (2%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV--KDNLRLDFETAVLDVKNITIN 167
           +       G   + A      +    + +++   +K   +             V     +
Sbjct: 527 LTIDDGPKGSTLVKADDVTGYIDKELIKLNKNVYVKNINEKKEETVLTADRGAVTKEMAD 586

Query: 168 SSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
             D V I   + V +AN    +  +R     G V V  
Sbjct: 587 VYDKVKIVTKESVTTANEGHYDMVNRKIRAKGNVHVDY 624



 Score = 36.6 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 9/73 (12%), Positives = 22/73 (30%), Gaps = 1/73 (1%)

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
            N    +L ++   K     +   D      +  +  IN    +   +  + + A+    
Sbjct: 1   MNETTQSLKVTDDVKFTY-QDYVFDVSYIEKEPNSDIINIYGKIKGGNPTYSVLADKGEY 59

Query: 189 ENSSRSAVFAGQV 201
             + +     G V
Sbjct: 60  NVNDKKIRIFGNV 72


>gi|313894684|ref|ZP_07828247.1| OstA-like protein [Veillonella sp. oral taxon 158 str. F0412]
 gi|313440874|gb|EFR59303.1| OstA-like protein [Veillonella sp. oral taxon 158 str. F0412]
          Length = 231

 Score = 43.2 bits (100), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/133 (10%), Positives = 33/133 (24%), Gaps = 10/133 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 ++ A+      N+G+                    D  +   +  +N       
Sbjct: 16  AANDPLTISADTLSYDGNTGRADATGNVVI--------TQADKTMTGANGWYNTKTQEAS 67

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     +   D        +V    N    +S  V +   D  +  +       S   + 
Sbjct: 68  LEGGVSLIGSDMAM--SAQSVHSYNNNKFTASGGVHLQRGDRQIFGDSVEYSTDSEYGLV 125

Query: 198 AGQVSVVVNPGVL 210
           +G   ++     L
Sbjct: 126 SGNARLIAEGTTL 138


>gi|294795170|ref|ZP_06760304.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
 gi|294453962|gb|EFG22337.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
          Length = 240

 Score = 43.2 bits (100), Expect = 0.023,   Method: Composition-based stats.
 Identities = 15/133 (11%), Positives = 31/133 (23%), Gaps = 10/133 (7%)

Query: 78  KDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLY 137
                 ++ A+      NSG+                    D  +      +N       
Sbjct: 25  AANDPLTISADTLSYDGNSGRADATGNVVI--------TQADKTMTGAKGWYNTKTQEAN 76

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +     M   D         V    N    ++  V +  +D  +  +       S   + 
Sbjct: 77  LDGGVSMIGSDMAM--SAQTVHSYNNNKFTANGSVHLQRADRQIFGDSVEYSTDSEYGLV 134

Query: 198 AGQVSVVVNPGVL 210
            G   ++     L
Sbjct: 135 TGNARLIAEGTTL 147


>gi|310778162|ref|YP_003966495.1| OstA family protein [Ilyobacter polytropus DSM 2926]
 gi|309747485|gb|ADO82147.1| OstA family protein [Ilyobacter polytropus DSM 2926]
          Length = 752

 Score = 43.2 bits (100), Expect = 0.023,   Method: Composition-based stats.
 Identities = 6/90 (6%), Positives = 27/90 (30%), Gaps = 3/90 (3%)

Query: 114 RSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSD--- 170
           +       +   +  ++     + +     +  KD   L  +  + + +   + +     
Sbjct: 137 QGGDDIYSIKGKNGYYDTLKKQVELKGDVVVSSKDGKELKADRGIYETETKVLYAYGDTK 196

Query: 171 PVIITHSDFVLSANFARIENSSRSAVFAGQ 200
            VI    D  +++     ++ +       +
Sbjct: 197 DVIYKSPDGKVTSKEIVYKSETEELFLNKK 226



 Score = 41.2 bits (95), Expect = 0.089,   Method: Composition-based stats.
 Identities = 7/88 (7%), Positives = 23/88 (26%), Gaps = 4/88 (4%)

Query: 122 LFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITINSSDPVIITHS 177
           + +     NL      +    ++          +   +  ++  K         V    +
Sbjct: 662 VTSDIVDVNLTTEVANLINNVEITNFSQESGYTKATADKGIIRNKEKIAELEGNVKAESA 721

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVVV 205
              + A+    + ++      G V +  
Sbjct: 722 TATIEADKGIYDMNTNKFKAIGNVFINY 749



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/105 (12%), Positives = 39/105 (37%), Gaps = 10/105 (9%)

Query: 105 DFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK-------VKDNLRLDFETA 157
           + +  +  +  +   + + A   R++       I    K+K          +L   F+ A
Sbjct: 7   NLDGDILMESEK---IKVSADKIRYSDDTKIADIIGNIKVKGENLSEDTPGSLEGSFKNA 63

Query: 158 VLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
             ++++  + + DP +I ++   L  +       + + + +  V 
Sbjct: 64  RYNLESKVLEAWDPFVIDYNGIKLYGDKLIYYEETGNFLVSENVH 108



 Score = 38.9 bits (89), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/146 (13%), Positives = 54/146 (36%), Gaps = 7/146 (4%)

Query: 69  KKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSAR 128
           +K + +  + +    +  A      + + K    L      V  +     +  +    A 
Sbjct: 453 EKSVYTGKAFEGKSDTATASGDFIKYYTEKDSFELT---GNVVLKD---PETEIRGSQAE 506

Query: 129 FNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARI 188
           + + ++ +   QPFK+    NL ++      ++ + +++ +  VI +++D  L  +    
Sbjct: 507 YFIDSNEMQAKQPFKVFYD-NLVINSAKGKFNMDSKSLDGNKVVITSNNDEKLQGDHVFG 565

Query: 189 ENSSRSAVFAGQVSVVVNPGVLQKKE 214
             + +   F G V   +     +  +
Sbjct: 566 SFADKKVDFVGNVKASMYQTDKKTGK 591



 Score = 36.2 bits (82), Expect = 3.0,   Method: Composition-based stats.
 Identities = 13/100 (13%), Positives = 35/100 (35%), Gaps = 5/100 (5%)

Query: 120 MYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITH--- 176
           M L +     +L  +     +  ++ +++   +  +   +++     N  + V IT+   
Sbjct: 630 MTLHSDYLELDLVRNLALGREGSRLIMENGTEVTSDIVDVNLTTEVANLINNVEITNFSQ 689

Query: 177 --SDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
                  +A+   I N  + A   G V        ++  +
Sbjct: 690 ESGYTKATADKGIIRNKEKIAELEGNVKAESATATIEADK 729


>gi|154491015|ref|ZP_02030956.1| hypothetical protein PARMER_00932 [Parabacteroides merdae ATCC
           43184]
 gi|154088763|gb|EDN87807.1| hypothetical protein PARMER_00932 [Parabacteroides merdae ATCC
           43184]
          Length = 246

 Score = 43.2 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 21/169 (12%), Positives = 50/169 (29%), Gaps = 12/169 (7%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVA- 87
               FA V ++  F  S           + D      +    +          +Y  +A 
Sbjct: 15  ITTIFAVVVMLLLFTASCNGDNKEVVVVAFDPETTYTLRTTDYTTQFSDSGITRYRAIAK 74

Query: 88  -----ERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
                ++AK  F+     I+++ F+           +  L A +A          +    
Sbjct: 75  EFLKFDKAKEPFSYFPEGIYVEKFDTLFNI------EASLKADTAYNYEKKGLWKLIGNV 128

Query: 143 KMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENS 191
           +++  +  + +      D K   + S   + I   D +++        +
Sbjct: 129 RVENLEGKKFETSLLFWDQKEEKVYSDKYIRIQEDDKIITGIGFESNQN 177


>gi|323137697|ref|ZP_08072773.1| Organic solvent tolerance protein [Methylocystis sp. ATCC 49242]
 gi|322396994|gb|EFX99519.1| Organic solvent tolerance protein [Methylocystis sp. ATCC 49242]
          Length = 862

 Score = 43.2 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 9/88 (10%), Positives = 29/88 (32%), Gaps = 2/88 (2%)

Query: 108 LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITIN 167
                +  +   M + A    ++   +T+      ++  K    L+ +  V D     + 
Sbjct: 31  ALAAPKTGDGARMVVEAKEMVYDEKKNTVTARGDVQIYYK-GRLLEADRVVYDRNTSRVF 89

Query: 168 SSDPVIITHSDFVL-SANFARIENSSRS 194
           +     +T ++  +  A    + +  + 
Sbjct: 90  AEGHAKLTETNGTIARAERFDLTDDFKQ 117



 Score = 35.1 bits (79), Expect = 6.6,   Method: Composition-based stats.
 Identities = 11/66 (16%), Positives = 26/66 (39%)

Query: 149 NLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
            + ++ +  V D K  T+ +   V I +   +L A+    + ++      G   +    G
Sbjct: 42  RMVVEAKEMVYDEKKNTVTARGDVQIYYKGRLLEADRVVYDRNTSRVFAEGHAKLTETNG 101

Query: 209 VLQKKE 214
            + + E
Sbjct: 102 TIARAE 107


>gi|254414897|ref|ZP_05028661.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196178386|gb|EDX73386.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 380

 Score = 43.2 bits (100), Expect = 0.024,   Method: Composition-based stats.
 Identities = 11/97 (11%), Positives = 32/97 (32%), Gaps = 7/97 (7%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVIITH 176
             + + A+  ++      + +    +      N++L  E  +  +K   +          
Sbjct: 157 EQIEVTANEGQYLTRQEQMELKGSVQAISKDPNVQLKTEQLLWQIKGQKLIGDQRTQTER 216

Query: 177 -SDFVLS----ANFARIENSSRSAVFAGQVSVV-VNP 207
             D  ++    AN       ++ A+    V +  ++P
Sbjct: 217 YKDNTVTDRVVANQTDYNLKTKVAILKKDVQLTSIDP 253



 Score = 41.2 bits (95), Expect = 0.091,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 3/87 (3%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKV-KDNLRLDFETAVLDVKNITINSSDPVII--THS 177
            + A+   +NL      + +  ++      + +    A+ DVK  T+ S+ PV I     
Sbjct: 225 RVVANQTDYNLKTKVAILKKDVQLTSIDPPILISSNEAIWDVKAETVRSNQPVQIVHQEE 284

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVV 204
             V++AN  +++  S  A   G V  V
Sbjct: 285 KVVITANQGQVDLESEVANLKGGVQGV 311


>gi|329962045|ref|ZP_08300056.1| hypothetical protein HMPREF9446_01631 [Bacteroides fluxus YIT
           12057]
 gi|328530693|gb|EGF57551.1| hypothetical protein HMPREF9446_01631 [Bacteroides fluxus YIT
           12057]
          Length = 208

 Score = 43.2 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 21/160 (13%), Positives = 46/160 (28%), Gaps = 3/160 (1%)

Query: 33  FATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVAER-A 90
                +V   L SS         ++I   D  P++  + + +  S     +Y +  E   
Sbjct: 18  IVLGAMVMLLLFSSCSGRKKDLGAAITERDSLPVMDTRGVTTLISDSGITRYRINTEEWL 77

Query: 91  KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL 150
                +     F +   L          +  + A +A F        +     +K     
Sbjct: 78  VFDRKNPPYWAFEKGVYLE-KFDSLFQVEASIKADTAYFYNKEELWKLMGNVDVKNLKGE 136

Query: 151 RLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
           R + +    D +   + S   + I   D +++        
Sbjct: 137 RFNTDLLYWDQRKQKVYSDQFIRIEQPDRIITGRGFESNQ 176


>gi|238751359|ref|ZP_04612852.1| hypothetical protein yrohd0001_15450 [Yersinia rohdei ATCC 43380]
 gi|238710417|gb|EEQ02642.1| hypothetical protein yrohd0001_15450 [Yersinia rohdei ATCC 43380]
          Length = 164

 Score = 43.2 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 45/128 (35%), Gaps = 8/128 (6%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
           Y LVAE       + K + +     +T+  + +      + A  A+    +  LY+    
Sbjct: 38  YKLVAEDV--QNFTAKELTWFTKPVMTMFDENA-VATWTVRADRAKL-TNDKMLYLYGHV 93

Query: 143 KMKV----KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFA 198
           ++          ++  + A +++    ++S D V +    F  +    R     ++A   
Sbjct: 94  EVDSLTPDAQLQKIKTDNAQVNLITQDVSSDDEVTLFGVGFRSNGMKMRGNLRDKTAELI 153

Query: 199 GQVSVVVN 206
            +V     
Sbjct: 154 EKVKTSYE 161


>gi|157737225|ref|YP_001489908.1| hypothetical protein Abu_0979 [Arcobacter butzleri RM4018]
 gi|315636940|ref|ZP_07892164.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|157699079|gb|ABV67239.1| hypothetical protein Abu_0979 [Arcobacter butzleri RM4018]
 gi|315478770|gb|EFU69479.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 180

 Score = 43.2 bits (100), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/179 (10%), Positives = 57/179 (31%), Gaps = 5/179 (2%)

Query: 36  VTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFN 95
           +  +       +   +T    + D  D   +I    I+   +++ V   ++A  A   + 
Sbjct: 7   IIALLVVASIVYFIPATSLNKNQDTKDIPLLIFDNPIMYTLNENSVNRVVIASNAVR-YE 65

Query: 96  SGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFE 155
           +   +    D  L       ++    L A             ++   K K  D ++++  
Sbjct: 66  NRDEMFNA-DITLKNQDPTQDFNSERLNADKIV--KRGGIYTLTDNVKYKRDDFIKINTN 122

Query: 156 TAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
             + D  N    +  P    ++          ++ ++ +   +      ++    +K++
Sbjct: 123 HLIYDDINKIAKNDKPFESVYNSHFYKGINLYLDLNNSNIK-SKDAHFEIDLNKTKKEK 180


>gi|91977436|ref|YP_570095.1| organic solvent tolerance protein [Rhodopseudomonas palustris
           BisB5]
 gi|91683892|gb|ABE40194.1| Organic solvent tolerance protein [Rhodopseudomonas palustris
           BisB5]
          Length = 833

 Score = 43.2 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 28/84 (33%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            + +  A+    N      +P +      + +       D  N  +++   V +  +   
Sbjct: 45  SISSAEAQSYTYNPRPARPRPPQSGQDGQMLVQATEVNYDYNNQRVSAIGNVQMHFNGTS 104

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           + A+    + +++     G V + 
Sbjct: 105 VEADRLVYDQNTKRLRAEGNVRMT 128


>gi|159184263|ref|NP_353366.2| hypothetical protein Atu0334 [Agrobacterium tumefaciens str. C58]
 gi|159139590|gb|AAK86151.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 187

 Score = 43.2 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 24/197 (12%), Positives = 66/197 (33%), Gaps = 18/197 (9%)

Query: 21  VRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR 80
            R +   +     A           ++ + +T S   + L   +P+ ++   L    ++R
Sbjct: 5   SRPVSLGRTAGLTAAGLFFSCLATVAFAQNTTSSMQGVKLSGDQPIAIESDQLEIRDQER 64

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
             Y         +    +G   LQ  ++TV  +        L +     +     +++  
Sbjct: 65  KAYF------TGNVKVVQGTTTLQAGKMTVNYKGQGS---SLTSG----DANIEKIFVDN 111

Query: 141 PFKMKVKDNLRLDFETAVLDVKNITINSSDP-VIITHSDFVLSANFARIENSSRSAVFA- 198
              +  +   +   +    D+   T   +   V+++    V +     +  ++  A    
Sbjct: 112 NVYLTSET-QKATADHGEFDMAAQTFILTGKQVVLSEGTNVFTGCKLTVLMNTGQAKLES 170

Query: 199 --GQVSVVVNPGVLQKK 213
             G V ++++P   +K+
Sbjct: 171 CGGPVRIMLDPKSQKKQ 187


>gi|225852205|ref|YP_002732438.1| LPS-assembly protein precursor [Brucella melitensis ATCC 23457]
 gi|256264287|ref|ZP_05466819.1| organic solvent tolerance protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|225640570|gb|ACO00484.1| LPS-assembly protein precursor [Brucella melitensis ATCC 23457]
 gi|263094547|gb|EEZ18356.1| organic solvent tolerance protein [Brucella melitensis bv. 2 str.
           63/9]
          Length = 792

 Score = 43.2 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.20,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.74,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|119512213|ref|ZP_01631302.1| hypothetical protein N9414_08919 [Nodularia spumigena CCY9414]
 gi|119463111|gb|EAW44059.1| hypothetical protein N9414_08919 [Nodularia spumigena CCY9414]
          Length = 835

 Score = 42.8 bits (99), Expect = 0.029,   Method: Composition-based stats.
 Identities = 14/169 (8%), Positives = 44/169 (26%), Gaps = 7/169 (4%)

Query: 48  IRISTFSKSSIDLLDFEPMIMKKFILS-DYSKDRVKYSLVAERAKTSFNSGKGIIFLQDF 106
            +    +       D   + + +          +      +   +++  S    I  +  
Sbjct: 141 PQEPESNIPVQQFPDSINISVDQPNYVPSSQPVQNTLEFKSRN-RSNETSTPSTIEFKSP 199

Query: 107 ELT----VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
                   PT  +    + + +    ++     +       ++      +D +   +++ 
Sbjct: 200 TPQAQQPTPTPPARQRTIEVISDRQEYDEQRRIITAEGNVVVRFD-GSVVDADRLQVNLD 258

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
           N+    S  V +T  D VL            +         +  P   +
Sbjct: 259 NLIAVGSGNVALTRGDQVLRGERFNYNFIQDNGEIENASGEIFVPSAQR 307


>gi|306842050|ref|ZP_07474723.1| organic solvent tolerance protein [Brucella sp. BO2]
 gi|306287891|gb|EFM59311.1| organic solvent tolerance protein [Brucella sp. BO2]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.77,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|254693439|ref|ZP_05155267.1| Organic solvent tolerance protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261213692|ref|ZP_05927973.1| organic solvent tolerance protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260915299|gb|EEX82160.1| organic solvent tolerance protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.20,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.77,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|256159411|ref|ZP_05457189.1| organic solvent tolerance protein precursor [Brucella ceti
           M490/95/1]
 gi|256254705|ref|ZP_05460241.1| organic solvent tolerance protein precursor [Brucella ceti B1/94]
 gi|261221885|ref|ZP_05936166.1| organic solvent tolerance protein [Brucella ceti B1/94]
 gi|265997848|ref|ZP_06110405.1| organic solvent tolerance protein [Brucella ceti M490/95/1]
 gi|260920469|gb|EEX87122.1| organic solvent tolerance protein [Brucella ceti B1/94]
 gi|262552316|gb|EEZ08306.1| organic solvent tolerance protein [Brucella ceti M490/95/1]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106


>gi|254688957|ref|ZP_05152211.1| organic solvent tolerance protein [Brucella abortus bv. 6 str. 870]
 gi|256257205|ref|ZP_05462741.1| organic solvent tolerance protein [Brucella abortus bv. 9 str. C68]
 gi|260754446|ref|ZP_05866794.1| organic solvent tolerance protein [Brucella abortus bv. 6 str. 870]
 gi|260883475|ref|ZP_05895089.1| organic solvent tolerance protein [Brucella abortus bv. 9 str. C68]
 gi|260674554|gb|EEX61375.1| organic solvent tolerance protein [Brucella abortus bv. 6 str. 870]
 gi|260873003|gb|EEX80072.1| organic solvent tolerance protein [Brucella abortus bv. 9 str. C68]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|254718821|ref|ZP_05180632.1| organic solvent tolerance protein precursor [Brucella sp. 83/13]
 gi|265983806|ref|ZP_06096541.1| organic solvent tolerance protein [Brucella sp. 83/13]
 gi|264662398|gb|EEZ32659.1| organic solvent tolerance protein [Brucella sp. 83/13]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.79,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|254701468|ref|ZP_05163296.1| organic solvent tolerance protein [Brucella suis bv. 5 str. 513]
 gi|256060810|ref|ZP_05450970.1| organic solvent tolerance protein [Brucella neotomae 5K33]
 gi|256369120|ref|YP_003106628.1| organic solvent tolerance, putative [Brucella microti CCM 4915]
 gi|261324802|ref|ZP_05963999.1| organic solvent tolerance protein [Brucella neotomae 5K33]
 gi|261752011|ref|ZP_05995720.1| organic solvent tolerance protein [Brucella suis bv. 5 str. 513]
 gi|294852047|ref|ZP_06792720.1| organic solvent tolerance protein [Brucella sp. NVSL 07-0026]
 gi|255999280|gb|ACU47679.1| organic solvent tolerance, putative [Brucella microti CCM 4915]
 gi|261300782|gb|EEY04279.1| organic solvent tolerance protein [Brucella neotomae 5K33]
 gi|261741764|gb|EEY29690.1| organic solvent tolerance protein [Brucella suis bv. 5 str. 513]
 gi|294820636|gb|EFG37635.1| organic solvent tolerance protein [Brucella sp. NVSL 07-0026]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.79,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|326408704|gb|ADZ65769.1| LPS-assembly protein precursor [Brucella melitensis M28]
 gi|326538428|gb|ADZ86643.1| LPS-assembly protein precursor [Brucella melitensis M5-90]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|306845286|ref|ZP_07477862.1| organic solvent tolerance protein [Brucella sp. BO1]
 gi|306274445|gb|EFM56252.1| organic solvent tolerance protein [Brucella sp. BO1]
          Length = 799

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 51  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 109

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 110 VEIVERDGNRIYSDHIDVTDSFR 132



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 47  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 106

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 107 TGNVEIV 113



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 89  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 148

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 149 FVAESAE-RSNGEITTFNNGAYTACEP 174


>gi|256044378|ref|ZP_05447282.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260563730|ref|ZP_05834216.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           16M]
 gi|265990796|ref|ZP_06103353.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260153746|gb|EEW88838.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           16M]
 gi|263001580|gb|EEZ14155.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|161618654|ref|YP_001592541.1| organic solvent tolerance protein precursor [Brucella canis ATCC
           23365]
 gi|254704015|ref|ZP_05165843.1| organic solvent tolerance protein precursor [Brucella suis bv. 3
           str. 686]
 gi|260566736|ref|ZP_05837206.1| organic solvent tolerance protein [Brucella suis bv. 4 str. 40]
 gi|261754670|ref|ZP_05998379.1| organic solvent tolerance protein [Brucella suis bv. 3 str. 686]
 gi|161335465|gb|ABX61770.1| Organic solvent tolerance protein precursor [Brucella canis ATCC
           23365]
 gi|260156254|gb|EEW91334.1| organic solvent tolerance protein [Brucella suis bv. 4 str. 40]
 gi|261744423|gb|EEY32349.1| organic solvent tolerance protein [Brucella suis bv. 3 str. 686]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|148559713|ref|YP_001258667.1| putative organic solvent tolerance [Brucella ovis ATCC 25840]
 gi|148370970|gb|ABQ60949.1| putative organic solvent tolerance [Brucella ovis ATCC 25840]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|23501572|ref|NP_697699.1| organic solvent tolerance [Brucella suis 1330]
 gi|23347485|gb|AAN29614.1| organic solvent tolerance, putative [Brucella suis 1330]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|62289647|ref|YP_221440.1| organic solvent tolerance protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699575|ref|YP_414149.1| organic solvent tolerance protein [Brucella melitensis biovar
           Abortus 2308]
 gi|254697091|ref|ZP_05158919.1| Organic solvent tolerance protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729987|ref|ZP_05188565.1| Organic solvent tolerance protein [Brucella abortus bv. 4 str. 292]
 gi|260545601|ref|ZP_05821342.1| organic solvent tolerance protein [Brucella abortus NCTC 8038]
 gi|260757665|ref|ZP_05870013.1| organic solvent tolerance protein [Brucella abortus bv. 4 str. 292]
 gi|260761492|ref|ZP_05873835.1| organic solvent tolerance protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62195779|gb|AAX74079.1| organic solvent tolerance, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82615676|emb|CAJ10663.1| Organic solvent tolerance protein [Brucella melitensis biovar
           Abortus 2308]
 gi|260097008|gb|EEW80883.1| organic solvent tolerance protein [Brucella abortus NCTC 8038]
 gi|260667983|gb|EEX54923.1| organic solvent tolerance protein [Brucella abortus bv. 4 str. 292]
 gi|260671924|gb|EEX58745.1| organic solvent tolerance protein [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|218441925|ref|YP_002380254.1| OstA family protein [Cyanothece sp. PCC 7424]
 gi|218174653|gb|ACK73386.1| OstA family protein [Cyanothece sp. PCC 7424]
          Length = 833

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 9/99 (9%), Positives = 29/99 (29%), Gaps = 3/99 (3%)

Query: 111 PTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSD 170
              + E   + L A    ++     +       +++ +   L  +   +++      +  
Sbjct: 196 TPAQEEVSVIELTADQQEYDSIREIVTARGNVALELTNGY-LTADRLQVNIPQRLAVAEG 254

Query: 171 PVIITHSDFVLSANFARIE-NSSRSAVFAGQVSVVVNPG 208
            V++   D ++  +            VF      +  P 
Sbjct: 255 NVVLQRGDQIIRGDRFEYYFVEDSGIVFNANGE-IYQPT 292


>gi|163842955|ref|YP_001627359.1| organic solvent tolerance protein precursor [Brucella suis ATCC
           23445]
 gi|163673678|gb|ABY37789.1| Organic solvent tolerance protein precursor [Brucella suis ATCC
           23445]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 37.4 bits (85), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/83 (10%), Positives = 23/83 (27%), Gaps = 1/83 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSV 203
             A  A   ++     F      
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYT 163


>gi|99079866|ref|YP_612020.1| OstA-like protein [Ruegeria sp. TM1040]
 gi|99036146|gb|ABF62758.1| OstA-like protein [Ruegeria sp. TM1040]
          Length = 144

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 14/97 (14%), Positives = 31/97 (31%), Gaps = 6/97 (6%)

Query: 117 YGDMYLFAHSARFNLANH-----TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            G+M L A +              L       +        +   A   +++ T+     
Sbjct: 46  QGEMRLSADNVLVVRRTEGNGIERLEARGNVLLV-SGEDAAEAREADYTIQSGTVVMRGN 104

Query: 172 VIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           V++T     L A    +  ++ +A  +G+V   +   
Sbjct: 105 VLLTQQGSTLGAEQMTVNMTTGNATLSGRVRTTLPGS 141


>gi|260168436|ref|ZP_05755247.1| organic solvent tolerance, putative [Brucella sp. F5/99]
 gi|261757898|ref|ZP_06001607.1| organic solvent tolerance protein [Brucella sp. F5/99]
 gi|261737882|gb|EEY25878.1| organic solvent tolerance protein [Brucella sp. F5/99]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.77,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|254707611|ref|ZP_05169439.1| organic solvent tolerance protein precursor [Brucella pinnipedialis
           M163/99/10]
 gi|254709806|ref|ZP_05171617.1| organic solvent tolerance protein precursor [Brucella pinnipedialis
           B2/94]
 gi|256031297|ref|ZP_05444911.1| organic solvent tolerance protein precursor [Brucella pinnipedialis
           M292/94/1]
 gi|261315101|ref|ZP_05954298.1| organic solvent tolerance protein [Brucella pinnipedialis
           M163/99/10]
 gi|261317344|ref|ZP_05956541.1| organic solvent tolerance protein [Brucella pinnipedialis B2/94]
 gi|265988382|ref|ZP_06100939.1| organic solvent tolerance protein [Brucella pinnipedialis
           M292/94/1]
 gi|261296567|gb|EEY00064.1| organic solvent tolerance protein [Brucella pinnipedialis B2/94]
 gi|261304127|gb|EEY07624.1| organic solvent tolerance protein [Brucella pinnipedialis
           M163/99/10]
 gi|264660579|gb|EEZ30840.1| organic solvent tolerance protein [Brucella pinnipedialis
           M292/94/1]
          Length = 792

 Score = 42.8 bits (99), Expect = 0.030,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.79,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|306838743|ref|ZP_07471577.1| organic solvent tolerance protein precursor [Brucella sp. NF 2653]
 gi|306406145|gb|EFM62390.1| organic solvent tolerance protein precursor [Brucella sp. NF 2653]
          Length = 799

 Score = 42.8 bits (99), Expect = 0.031,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 51  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 109

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 110 VEIVERDGNRIYSDHIDVTDSFR 132



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 47  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 106

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 107 TGNVEIV 113



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 89  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 148

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 149 FVAESAE-RSNGEITTFNNGAYTACEP 174


>gi|171912110|ref|ZP_02927580.1| hypothetical protein VspiD_13060 [Verrucomicrobium spinosum DSM
           4136]
          Length = 258

 Score = 42.8 bits (99), Expect = 0.031,   Method: Composition-based stats.
 Identities = 16/108 (14%), Positives = 43/108 (39%), Gaps = 9/108 (8%)

Query: 104 QDFELTVPTQRSEYGDMYLFA------HSARFNLANHTLYISQPFKMKVKDNLRLDFETA 157
           ++ ++ +P+ R    +  + A            +    + +  P K     ++R+  +TA
Sbjct: 56  RNLDVKIPSFRDGRPNSLMRAGSMTRLDEDNMAIEKMDIRMFGPTK---DRDVRVQLKTA 112

Query: 158 VLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
              + + T++S     I+  DF +  +    +  ++     G V +V+
Sbjct: 113 TYHMPSATLSSEQRSRISREDFQMEGDSMVFDTKTQQGKMTGNVRMVI 160


>gi|297248055|ref|ZP_06931773.1| organic solvent tolerance protein [Brucella abortus bv. 5 str.
           B3196]
 gi|297175224|gb|EFH34571.1| organic solvent tolerance protein [Brucella abortus bv. 5 str.
           B3196]
          Length = 797

 Score = 42.8 bits (99), Expect = 0.031,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 49  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 107

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 108 VEIVERDGNRIYSDHIDVTDSFR 130



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 45  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 104

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 105 TGNVEIV 111



 Score = 38.2 bits (87), Expect = 0.81,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 87  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 146

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 147 FVAESAE-RSNGEITTFNNGAYTACEP 172


>gi|189023897|ref|YP_001934665.1| Organic solvent tolerance protein [Brucella abortus S19]
 gi|237815138|ref|ZP_04594136.1| LPS-assembly protein precursor [Brucella abortus str. 2308 A]
 gi|189019469|gb|ACD72191.1| Organic solvent tolerance protein [Brucella abortus S19]
 gi|237789975|gb|EEP64185.1| LPS-assembly protein precursor [Brucella abortus str. 2308 A]
          Length = 799

 Score = 42.8 bits (99), Expect = 0.032,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 51  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 109

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 110 VEIVERDGNRIYSDHIDVTDSFR 132



 Score = 40.1 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 47  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 106

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 107 TGNVEIV 113



 Score = 38.2 bits (87), Expect = 0.81,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 89  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 148

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 149 FVAESAE-RSNGEITTFNNGAYTACEP 174


>gi|313497324|gb|ADR58690.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 190

 Score = 42.8 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 11/173 (6%), Positives = 35/173 (20%), Gaps = 9/173 (5%)

Query: 39  VGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSG 97
           V     +           +                  +  D   +Y + A+R        
Sbjct: 20  VAIGYWNVSPESFLDKPVAQVDESAIDYYAINAHSVQFLPDGKLQYEMTADR--IEHLKT 77

Query: 98  KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK----DNLRLD 153
             +  +   +L +          ++ +  A  N     + +    ++           + 
Sbjct: 78  SEVTQVTTPDLHLYR--GTEYPWHVQSTRAEVNPDGTEVELIDKVRIARTDEKQRETIIT 135

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
                +  +     +   V I  +    +    +             V     
Sbjct: 136 SSRMTVFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGKMDLLSNVRGQYE 188


>gi|307294653|ref|ZP_07574495.1| Organic solvent tolerance protein [Sphingobium chlorophenolicum
           L-1]
 gi|306879127|gb|EFN10345.1| Organic solvent tolerance protein [Sphingobium chlorophenolicum
           L-1]
          Length = 754

 Score = 42.8 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 10/93 (10%), Positives = 33/93 (35%), Gaps = 6/93 (6%)

Query: 103 LQDFELTVPTQR----SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAV 158
           LQ+ +  V             +   A +  ++  +  +  S   ++  +   RL  +  V
Sbjct: 34  LQEPQAAVSAPDAPVPETEDQIGFAADALEYDSDSEIVTASGNVQLLRE-GNRLRADKVV 92

Query: 159 LDVKNITINSSDPVIITHSDFVLS-ANFARIEN 190
            +     + ++  V +T  +  ++  +   + +
Sbjct: 93  WNRTTGKVEATGNVSVTDPEGNIAYGDRFDVTD 125


>gi|225627182|ref|ZP_03785220.1| LPS-assembly protein precursor [Brucella ceti str. Cudo]
 gi|225618017|gb|EEH15061.1| LPS-assembly protein precursor [Brucella ceti str. Cudo]
          Length = 799

 Score = 42.8 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 51  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 109

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 110 VEIVERDGNRIYSDHIDVTDSFR 132



 Score = 40.1 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 47  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 106

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 107 TGNVEIV 113



 Score = 38.2 bits (87), Expect = 0.84,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 89  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 148

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 149 FVAESAE-RSNGEITTFNNGAYTACEP 174


>gi|17987547|ref|NP_540181.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           16M]
 gi|17983250|gb|AAL52445.1| organic solvent tolerance protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 797

 Score = 42.8 bits (99), Expect = 0.033,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            Q      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 49  YQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 107

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 108 VEIVERDGNRIYSDHIDVTDSFR 130



 Score = 40.1 bits (92), Expect = 0.22,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 45  LSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 104

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 105 TGNVEIV 111



 Score = 38.2 bits (87), Expect = 0.83,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 87  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 146

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 147 FVAESAE-RSNGEITTFNNGAYTACEP 172


>gi|51597815|ref|YP_072006.1| hypothetical protein YPTB3523 [Yersinia pseudotuberculosis IP
           32953]
 gi|153947595|ref|YP_001399437.1| hypothetical protein YpsIP31758_0444 [Yersinia pseudotuberculosis
           IP 31758]
 gi|170022759|ref|YP_001719264.1| hypothetical protein YPK_0508 [Yersinia pseudotuberculosis YPIII]
 gi|186897007|ref|YP_001874119.1| hypothetical protein YPTS_3709 [Yersinia pseudotuberculosis PB1/+]
 gi|51591097|emb|CAH22761.1| Putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|152959090|gb|ABS46551.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
 gi|169749293|gb|ACA66811.1| protein of unknown function DUF1239 [Yersinia pseudotuberculosis
           YPIII]
 gi|186700033|gb|ACC90662.1| protein of unknown function DUF1239 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 187

 Score = 42.8 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 18/160 (11%), Positives = 45/160 (28%), Gaps = 13/160 (8%)

Query: 52  TFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIFLQDFELTV 110
                  +        +       ++      Y LVAE  +        + +     +T+
Sbjct: 33  PVVADDNEPSSQSQHTVTTV----FNPVGQLNYKLVAEEVQNFSAK--ELTWFTKPVMTL 86

Query: 111 PTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNL----RLDFETAVLDVKNITI 166
               +      + A  A+    +  LY+    ++          ++  + A +++    +
Sbjct: 87  F-GDNAVATWTVRADRAKL-TDDKMLYLYGHVEVDSLTADAQLKKIRTDNAQVNLITQDV 144

Query: 167 NSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            S D V +    F       R     ++A    +V     
Sbjct: 145 ASDDEVTLFGIGFTSEGMRMRGNLRDKTAELIEKVKTSYE 184


>gi|225851254|ref|YP_002731488.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
 gi|225646594|gb|ACO04780.1| lipopolysaccharide transport periplasmic protein LptA
           [Persephonella marina EX-H1]
          Length = 156

 Score = 42.8 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 36/109 (33%), Gaps = 5/109 (4%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKN----IT 165
            P +  +   + + A    +N   +T        +K K NL ++ E  ++ +        
Sbjct: 16  YPQEEKKEEPILIEADELVYNKNENTAVYKGNVTVK-KGNLTINAEKMIIYLSEEGDISR 74

Query: 166 INSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           I +   V     +   S+  A         V   +  ++    +++  E
Sbjct: 75  IYAEGDVRFKKGNRSGSSKKAEYIKDKDIIVLIDKAKLIQEKNIIEGDE 123


>gi|256113221|ref|ZP_05454089.1| organic solvent tolerance protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265994632|ref|ZP_06107189.1| organic solvent tolerance protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765745|gb|EEZ11534.1| organic solvent tolerance protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 792

 Score = 42.4 bits (98), Expect = 0.038,   Method: Composition-based stats.
 Identities = 10/83 (12%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            +      M L A    ++   +T+      +++     RL  +    + +   + ++  
Sbjct: 44  YESDPNARMLLQADELVYDRDVNTVTAQGKVRIEYD-GNRLVADKVTYNQQTRRMTATGN 102

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + ++   + +S R
Sbjct: 103 VEIVERDGNRIYSDHIDVTDSFR 125



 Score = 40.1 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           +S  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 40  LSANYESDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTRRMTA 99

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 100 TGNVEIV 106



 Score = 38.2 bits (87), Expect = 0.78,   Method: Composition-based stats.
 Identities = 10/87 (11%), Positives = 24/87 (27%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L A    +N     +  +   ++  +D  R+  +   +         +   + T  +  
Sbjct: 82  RLVADKVTYNQQTRRMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTR 141

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
             A  A   ++     F         P
Sbjct: 142 FVAESAE-RSNGEITTFNNGAYTACEP 167


>gi|126662025|ref|ZP_01733024.1| hypothetical protein FBBAL38_01700 [Flavobacteria bacterium BAL38]
 gi|126625404|gb|EAZ96093.1| hypothetical protein FBBAL38_01700 [Flavobacteria bacterium BAL38]
          Length = 596

 Score = 42.4 bits (98), Expect = 0.038,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 58/190 (30%), Gaps = 10/190 (5%)

Query: 27  LKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFI-LSDYSKDRVKYSL 85
           LK  F +    ++    L +        ++S D +D     +   I  +          +
Sbjct: 33  LKNTFFYIAFLLLSVTFLVAQENKKIIIENS-DFVDMNQTEIPGAIVFTGN------VRI 85

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMK 145
           +    K   N           +     Q ++   + + +  A +N      + +    ++
Sbjct: 86  IHNGVKMFCNKAYHFKDENYIKAFGNVQMNQGDTITMNSRYAEYNGDKELAFATGDVVLR 145

Query: 146 VKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVV 205
                 L  +T   D KN   + +    I + +  L++   R     +   F   V  V 
Sbjct: 146 -SPESILTTDTVYFDKKNQVASYNTYGTIRNKENTLTSKSGRYYVDQKKYKFTTAV-TVK 203

Query: 206 NPGVLQKKEN 215
           NP    K  N
Sbjct: 204 NPESTIKTNN 213


>gi|91215797|ref|ZP_01252767.1| hypothetical protein P700755_02732 [Psychroflexus torquis ATCC
           700755]
 gi|91186263|gb|EAS72636.1| hypothetical protein P700755_02732 [Psychroflexus torquis ATCC
           700755]
          Length = 568

 Score = 42.4 bits (98), Expect = 0.038,   Method: Composition-based stats.
 Identities = 20/159 (12%), Positives = 41/159 (25%), Gaps = 32/159 (20%)

Query: 75  DYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANH 134
            YS+   K    ++R +    +  G   L      V         + ++   A F   + 
Sbjct: 17  SYSQHGKKIDYTSDRTRVDEVNYPGAFILSKVNNQVYFLHDG---IEVWCDRAIFYQTDD 73

Query: 135 TLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE----- 189
                   +MK  D + +  + A  +       +S+ V++T     L+ +          
Sbjct: 74  FFRAFGNVRMKQGDTVNMTSKYAEYNGYTQFAFASEDVVLTTPSNRLTTDSLFFNRLKQE 133

Query: 190 ------------------------NSSRSAVFAGQVSVV 204
                                    +     F   V V 
Sbjct: 134 AFYRSGGAVKDSASTITSVIGRYFMNQEKFSFRKDVKVR 172


>gi|150025820|ref|YP_001296646.1| hypothetical protein FP1772 [Flavobacterium psychrophilum JIP02/86]
 gi|149772361|emb|CAL43839.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 551

 Score = 42.4 bits (98), Expect = 0.039,   Method: Composition-based stats.
 Identities = 12/99 (12%), Positives = 33/99 (33%), Gaps = 1/99 (1%)

Query: 106 FELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT 165
            ++       +   + + +  A +N      Y +    ++    + L  +T   D  +  
Sbjct: 76  VKIFGNVNMVQGDTLSMNSKYAEYNGNTKFAYATGDVLLR-DPKMTLATDTINFDRNSQQ 134

Query: 166 INSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
              +    I   +  L +N  +   + +   F+  V+V 
Sbjct: 135 AYYNSKGTIRDPENTLVSNSGKYYLNQKKFQFSDAVTVT 173


>gi|307719860|ref|YP_003875392.1| hypothetical protein STHERM_c21910 [Spirochaeta thermophila DSM
           6192]
 gi|306533585|gb|ADN03119.1| hypothetical protein STHERM_c21910 [Spirochaeta thermophila DSM
           6192]
          Length = 181

 Score = 42.4 bits (98), Expect = 0.040,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 37/126 (29%), Gaps = 6/126 (4%)

Query: 83  YSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPF 142
            S+ AE+A+        I+ +         +          A  ARF+     +      
Sbjct: 52  LSVTAEKAEE--YRDAQILAVTGVLFQEFDREGNVVR-QGRAAHARFHRDTEDIETEGEV 108

Query: 143 KMKVKDNLR-LDFETAVLDVKNITINSS--DPVIITHSDFVLSANFARIENSSRSAVFAG 199
           +++ +     +         K  +I++     V I   ++ L       +  + S  F G
Sbjct: 109 EVQDRTEDITIRGSDFTWKKKERSISAPPGVEVEIQGENYRLRGTGFSADAGTLSLRFTG 168

Query: 200 QVSVVV 205
                 
Sbjct: 169 NPQGTY 174


>gi|288803873|ref|ZP_06409298.1| conserved hypothetical protein [Prevotella melaninogenica D18]
 gi|288333638|gb|EFC72088.1| conserved hypothetical protein [Prevotella melaninogenica D18]
          Length = 624

 Score = 42.4 bits (98), Expect = 0.040,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 25/84 (29%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +    A  N     +++     +K      +       + K   +  +    IT     
Sbjct: 178 RITTPEAHGNTETGLVHVVGKSVIKTAKGEVVHTNDGTYNSKTDQMELNGRSTITSPKQD 237

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           +  +     +S+  A   G V +V
Sbjct: 238 VEGDNIVYNSSTGEAEGHGNVKIV 261


>gi|302345882|ref|YP_003814235.1| OstA-like protein [Prevotella melaninogenica ATCC 25845]
 gi|302149982|gb|ADK96244.1| OstA-like protein [Prevotella melaninogenica ATCC 25845]
          Length = 624

 Score = 42.4 bits (98), Expect = 0.041,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 25/84 (29%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +    A  N     +++     +K      +       + K   +  +    IT     
Sbjct: 178 RITTPEAHGNTETGLVHVVGKSVIKTAKGEVVHTNDGTYNSKTDQMELNGRSTITSPKQD 237

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           +  +     +S+  A   G V +V
Sbjct: 238 VEGDNIVYNSSTGEAEGHGNVKIV 261


>gi|148244254|ref|YP_001218948.1| hypothetical protein COSY_0088 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326081|dbj|BAF61224.1| hypothetical protein [Candidatus Vesicomyosocius okutanii HA]
          Length = 347

 Score = 42.4 bits (98), Expect = 0.042,   Method: Composition-based stats.
 Identities = 9/100 (9%), Positives = 34/100 (34%), Gaps = 2/100 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT--INSSDPVIIT 175
             + + +   +    +  + +    K+  +D  ++  +   ++         S + ++  
Sbjct: 197 ETVKIISQGIQIRSKDDIIKLIGNIKINQRDGQQILTKDLYINQIEGQKHFYSKNKIVYM 256

Query: 176 HSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215
                + A+   I    +     G+V ++ + G     +N
Sbjct: 257 FQKDKIYADSIDINEQKQIIELLGKVKIMKDSGSKISTKN 296


>gi|320106529|ref|YP_004182119.1| OstA family protein [Terriglobus saanensis SP1PR4]
 gi|319925050|gb|ADV82125.1| OstA family protein [Terriglobus saanensis SP1PR4]
          Length = 815

 Score = 42.4 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 16/210 (7%), Positives = 54/210 (25%), Gaps = 28/210 (13%)

Query: 23  FIQFLKFFFPFATVTIVGWFLLSSWIRIS-TFSKSSIDLLDFEPMIMKKFILSDYSKDRV 81
            ++        A + ++G     +  R     ++    L          F  S   K + 
Sbjct: 7   RVRRWLVVIALAVLVLLGAVFGYARYRAHRFLTRLPKQLGIDVTSETNGFTWSQSVKGKT 66

Query: 82  KYSLVAERAKTSFNSGKGIIFLQDF-ELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQ 140
            +++ A +A    +    +  +          ++ +     ++ +   ++  N  +    
Sbjct: 67  LFTIHAAKAIQRHDGKTTLHDVVIILYGRTVDEQHKERTDRIYGNEFEYDQPNGVIRAVG 126

Query: 141 PFKMK------VKDN--------------------LRLDFETAVLDVKNITINSSDPVII 174
              +          +                    + +     V   K     + +P+  
Sbjct: 127 EVHIDLQAPGATDPHAAVAAARRAGSQDESQEHDVIHVRTSGLVFLQKLGVAATDEPLDF 186

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVV 204
             +     A  A  ++ +   +    V + 
Sbjct: 187 HANGVDGDARGADYDSDTGVLILRKDVKLR 216


>gi|326799028|ref|YP_004316847.1| hypothetical protein Sph21_1615 [Sphingobacterium sp. 21]
 gi|326549792|gb|ADZ78177.1| hypothetical protein Sph21_1615 [Sphingobacterium sp. 21]
          Length = 803

 Score = 42.4 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 11/85 (12%), Positives = 27/85 (31%), Gaps = 1/85 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDF- 179
            L A S+ +N             +   +   +  +       +     ++ V +  +   
Sbjct: 55  TLSADSSDYNPEERFFDAFGNVVITQPNGTVVYADKLHYIKDDRIAILTNNVRMVDTKGA 114

Query: 180 VLSANFARIENSSRSAVFAGQVSVV 204
           VL+ N      +S+   + G   +V
Sbjct: 115 VLTTNHLTYNLNSKIGTYTGGGRIV 139



 Score = 40.5 bits (93), Expect = 0.18,   Method: Composition-based stats.
 Identities = 10/69 (14%), Positives = 26/69 (37%), Gaps = 3/69 (4%)

Query: 137 YISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS-ANFARIENSSRSA 195
              +P  +   +   L  +++  + +    ++   V+IT  +  +  A+        R A
Sbjct: 43  RFYKPVFLH--EGSTLSADSSDYNPEERFFDAFGNVVITQPNGTVVYADKLHYIKDDRIA 100

Query: 196 VFAGQVSVV 204
           +    V +V
Sbjct: 101 ILTNNVRMV 109


>gi|296134690|ref|YP_003641932.1| protein of unknown function DUF1239 [Thiomonas intermedia K12]
 gi|295794812|gb|ADG29602.1| protein of unknown function DUF1239 [Thiomonas intermedia K12]
          Length = 206

 Score = 42.4 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 48/174 (27%), Gaps = 8/174 (4%)

Query: 40  GWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKG 99
            W++    +R     +      +    +++ F  + Y+       L A    T       
Sbjct: 28  SWWVAQVVMRAEQNPRIDAAHSNLPDYLLRGFSAASYNAQGQ---LSAVLRGTQMVHLPA 84

Query: 100 IIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVK-----DNLRLDF 154
                     +     +       A     N     + +     ++         L +  
Sbjct: 85  SDTFDITSPQLRAVNPQGIVTTASALRGLSNKDGSNVQLLGQAVVERSGVPHQVPLIVRS 144

Query: 155 ETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           E   +      + S+ P ++     V S N       + +A   G+V  V+ PG
Sbjct: 145 EFLNIFPNQQIVQSNRPTVVQQGQTVFSGNAVDFNGIAGTASLQGRVKAVIVPG 198


>gi|153009930|ref|YP_001371145.1| organic solvent tolerance protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561818|gb|ABS15316.1| Organic solvent tolerance protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 786

 Score = 42.4 bits (98), Expect = 0.044,   Method: Composition-based stats.
 Identities = 9/83 (10%), Positives = 27/83 (32%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            +      M L A    ++   +T+      +++      L  +    + +   + ++  
Sbjct: 51  YESDPNARMLLQADELVYDRDINTVTAQGKVRIEYD-GNHLVADKVTYNQQTRRMTATGN 109

Query: 172 VII-THSDFVLSANFARIENSSR 193
           V I       + +    + +S R
Sbjct: 110 VEIVERDGNKIYSEHMDVTDSFR 132



 Score = 40.5 bits (93), Expect = 0.17,   Method: Composition-based stats.
 Identities = 11/87 (12%), Positives = 27/87 (31%), Gaps = 1/87 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
           +L A    +N     +  +   ++  +D  ++  E   +         +   + T  +  
Sbjct: 89  HLVADKVTYNQQTRRMTATGNVEIVERDGNKIYSEHMDVTDSFRDGFVNGLRVETTDNTR 148

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNP 207
            +A  A   ++     F   V     P
Sbjct: 149 FAAESAE-RSNGEITTFNNGVYTACEP 174



 Score = 38.5 bits (88), Expect = 0.60,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 24/67 (35%)

Query: 138 ISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVF 197
           ++  ++      + L  +  V D    T+ +   V I +    L A+       +R    
Sbjct: 47  LASNYESDPNARMLLQADELVYDRDINTVTAQGKVRIEYDGNHLVADKVTYNQQTRRMTA 106

Query: 198 AGQVSVV 204
            G V +V
Sbjct: 107 TGNVEIV 113


>gi|332706280|ref|ZP_08426348.1| organic solvent tolerance protein OstA [Lyngbya majuscula 3L]
 gi|332354985|gb|EGJ34457.1| organic solvent tolerance protein OstA [Lyngbya majuscula 3L]
          Length = 1061

 Score = 42.4 bits (98), Expect = 0.045,   Method: Composition-based stats.
 Identities = 11/106 (10%), Positives = 34/106 (32%), Gaps = 3/106 (2%)

Query: 86  VAERAKTSFNSGKGIIFLQ-DFELTVPTQRSEYGDM-YLFAHSARFNLANHTLYISQPFK 143
            A ++    +  +    L  +      T  +   D+  L +    ++     +       
Sbjct: 409 TAPQSDQDLSQRQSGSELDSEVTAPTSTFDTNEPDILELTSDRQEYDDTRQVITAVGNVT 468

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIE 189
           ++   +  L+ +   +++ N  + +   V +T  + VL        
Sbjct: 469 LRF-QDALLEADRLQVNLPNKIVVADGSVALTRGNQVLEGERFEYY 513


>gi|327312554|ref|YP_004327991.1| OstA-like protein [Prevotella denticola F0289]
 gi|326944965|gb|AEA20850.1| OstA-like protein [Prevotella denticola F0289]
          Length = 643

 Score = 42.4 bits (98), Expect = 0.045,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 25/84 (29%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +    A  N     +++     ++      +       + K   +  +    IT     
Sbjct: 197 RINTPEAHGNTETGIVHVVGKSVIRTAKGEVIHTNDGTYNSKTDHMELNGRSTITSPKQD 256

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           +  +     +++  A   G V +V
Sbjct: 257 VEGDNIIYNSTTGEAEGHGNVKIV 280


>gi|254509814|ref|ZP_05121881.1| OstA family protein [Rhodobacteraceae bacterium KLH11]
 gi|221533525|gb|EEE36513.1| OstA family protein [Rhodobacteraceae bacterium KLH11]
          Length = 151

 Score = 42.4 bits (98), Expect = 0.046,   Method: Composition-based stats.
 Identities = 15/97 (15%), Positives = 37/97 (38%), Gaps = 6/97 (6%)

Query: 117 YGDMYLFAHSA--RFNLA---NHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            G+M L A      +N        +  ++   +    +   + + A   + +  I     
Sbjct: 54  QGEMRLTAERVLVIYNEDRSAIERMEATENVVLVSPPDA-AEGDWAEYTIDSGVIRMRGN 112

Query: 172 VIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPG 208
           V++T    ++S +      +S +A  +G+V  ++  G
Sbjct: 113 VLLTQGPSIISGDQMIANLTSGTATMSGRVKTILQQG 149



 Score = 36.2 bits (82), Expect = 3.1,   Method: Composition-based stats.
 Identities = 11/101 (10%), Positives = 32/101 (31%), Gaps = 6/101 (5%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNIT-----INSSDPVI 173
            + + + +   N  N +        +     +RL  E  ++           + +++ V+
Sbjct: 27  PVEVTSETLNVNQENGSAEFVGNVIVIQ-GEMRLTAERVLVIYNEDRSAIERMEATENVV 85

Query: 174 ITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
           +         ++A     S      G V +   P ++   +
Sbjct: 86  LVSPPDAAEGDWAEYTIDSGVIRMRGNVLLTQGPSIISGDQ 126


>gi|254494859|ref|ZP_01052006.2| conserved hypothetical protein [Polaribacter sp. MED152]
 gi|213690441|gb|EAQ41434.2| conserved hypothetical protein [Polaribacter sp. MED152]
          Length = 559

 Score = 42.4 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 45/143 (31%), Gaps = 9/143 (6%)

Query: 73  LSDYSKDRVKYSL-VAERAKTSFNSGKG-IIFLQDFELTVPTQRSEYGDMYLFAHSARFN 130
           +  YS+++ K  +  AE          G  I L +  +        +  + L    A F 
Sbjct: 28  IISYSQEKKKIIIENAEIQYADEEKTPGATILLGNVRIK-------HDGINLTCQQALFY 80

Query: 131 LANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIEN 190
              +         +K  D +    + A  D       S   V++      L+ +  + + 
Sbjct: 81  KKENFFKAIGNVLIKQGDTITQTSDYADYDANAKQALSWGNVVLKDPTMTLTTDTLQFDR 140

Query: 191 SSRSAVFAGQVSVVVNPGVLQKK 213
            ++   +    ++      L+ K
Sbjct: 141 INQKLYYQNYATIRDVTNTLKSK 163


>gi|325851862|ref|ZP_08171027.1| OstA-like protein [Prevotella denticola CRIS 18C-A]
 gi|325484704|gb|EGC87617.1| OstA-like protein [Prevotella denticola CRIS 18C-A]
          Length = 605

 Score = 42.4 bits (98), Expect = 0.047,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 25/84 (29%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +    A  N     +++     ++      +       + K   +  +    IT     
Sbjct: 159 RINTPEAHGNTETGIVHVVGKSVIRTAKGEVIHTNDGTYNSKTDHMELNGRSTITSPKQD 218

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           +  +     +++  A   G V +V
Sbjct: 219 VEGDNIIYNSTTGEAEGHGNVKIV 242


>gi|326386747|ref|ZP_08208368.1| organic solvent tolerance protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208800|gb|EGD59596.1| organic solvent tolerance protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 777

 Score = 42.0 bits (97), Expect = 0.048,   Method: Composition-based stats.
 Identities = 9/83 (10%), Positives = 26/83 (31%), Gaps = 2/83 (2%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
              ++   +   A    ++     +  S       + +  +  +T   + K   I ++  
Sbjct: 65  PTPAKDETIRFQADKVNYDNDAELVTASGNVVA-HRADQSVRADTVTWNRKTGQIMAAGN 123

Query: 172 VIITHSDFV-LSANFARIENSSR 193
           V     D   L A+   + +  +
Sbjct: 124 VRFVDEDGNVLYADHLELTDEFK 146


>gi|288940553|ref|YP_003442793.1| Organic solvent tolerance protein [Allochromatium vinosum DSM 180]
 gi|288895925|gb|ADC61761.1| Organic solvent tolerance protein [Allochromatium vinosum DSM 180]
          Length = 848

 Score = 42.0 bits (97), Expect = 0.049,   Method: Composition-based stats.
 Identities = 8/92 (8%), Positives = 32/92 (34%), Gaps = 1/92 (1%)

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
           + +     P   ++   + + A    ++     + +     +  + + RL  E +  D +
Sbjct: 139 VTNITPASPPPETQRLPIEITADLVDYDRERDLIQLQGEVDIIQE-SRRLRAERSRYDRR 197

Query: 163 NITINSSDPVIITHSDFVLSANFARIENSSRS 194
              +++   V + + +  +    A     ++ 
Sbjct: 198 TGDVSAGGSVALDYPELRVIGERADYNLETKR 229


>gi|312130161|ref|YP_003997501.1| hypothetical protein Lbys_1434 [Leadbetterella byssophila DSM
           17132]
 gi|311906707|gb|ADQ17148.1| protein of unknown function DUF1239 [Leadbetterella byssophila DSM
           17132]
          Length = 549

 Score = 42.0 bits (97), Expect = 0.050,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 25/83 (30%), Gaps = 1/83 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            L +++  +N            ++       L  +T   D             IT    V
Sbjct: 156 TLTSNTGYYNTNTKYFNYIGDVEVL-NPKFVLCTDTMDYDTHTKRAIFKAFTTITGETGV 214

Query: 181 LSANFARIENSSRSAVFAGQVSV 203
           L+A        ++ + F G+  V
Sbjct: 215 LTAEKGWYNIQTKESYFNGRSQV 237


>gi|294012539|ref|YP_003545999.1| organic solvent tolerance protein OstA [Sphingobium japonicum
           UT26S]
 gi|292675869|dbj|BAI97387.1| organic solvent tolerance protein OstA [Sphingobium japonicum
           UT26S]
          Length = 754

 Score = 42.0 bits (97), Expect = 0.050,   Method: Composition-based stats.
 Identities = 11/102 (10%), Positives = 35/102 (34%), Gaps = 7/102 (6%)

Query: 90  AKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDN 149
           A       +  +     +  VP    + G     A +  ++  +  +  S   ++  +  
Sbjct: 30  AAQQLQEPQTTVSA--PDAPVPENDDQIG---FAADALEYDSDSEVVTASGNVQLLRE-G 83

Query: 150 LRLDFETAVLDVKNITINSSDPVIITHSDFVLS-ANFARIEN 190
            RL  +  V +     + ++  V +T  +  ++  +   + +
Sbjct: 84  NRLRADKVVWNRTTGKVEATGNVSVTDPEGNIAYGDRFDVTD 125


>gi|325268742|ref|ZP_08135370.1| hypothetical protein HMPREF9141_0579 [Prevotella multiformis DSM
           16608]
 gi|324988910|gb|EGC20865.1| hypothetical protein HMPREF9141_0579 [Prevotella multiformis DSM
           16608]
          Length = 643

 Score = 42.0 bits (97), Expect = 0.051,   Method: Composition-based stats.
 Identities = 11/113 (9%), Positives = 23/113 (20%), Gaps = 29/113 (25%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKV-----------------------------KDNLR 151
            + A    +N   H         M                                    
Sbjct: 168 TVVADEGDYNTETHEANFFGNVVMFTPKYRINTPEAHGNTETGLVHVVGKSVIRTAKGEV 227

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           +       + K   +  +    IT     +  +     +++  A   G V +V
Sbjct: 228 IHTNDGTYNSKTDHMELNGHSTITSPRQDVEGDNIVYNSTTGDAEGHGNVKIV 280


>gi|282859616|ref|ZP_06268719.1| OstA-like protein [Prevotella bivia JCVIHMP010]
 gi|282587619|gb|EFB92821.1| OstA-like protein [Prevotella bivia JCVIHMP010]
          Length = 630

 Score = 42.0 bits (97), Expect = 0.051,   Method: Composition-based stats.
 Identities = 13/85 (15%), Positives = 30/85 (35%), Gaps = 2/85 (2%)

Query: 117 YGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITH 176
           YG+  + A    +N        S    M+     +++  TA  +++   ++   P +I  
Sbjct: 146 YGNTTIIADQGDYNTETKDANFSGNVVMRT-PKYKINTPTAQGNMETGELHVMGPSVIRT 204

Query: 177 SDFVLS-ANFARIENSSRSAVFAGQ 200
           +   +   N     + S      G+
Sbjct: 205 AKGEVVHTNDGTYNSKSDDMTLNGR 229



 Score = 36.6 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/166 (9%), Positives = 49/166 (29%), Gaps = 15/166 (9%)

Query: 54  SKSSIDLLDFEPMIMKKFIL--SDYSKDRV----KYSLVAERAKTSFN-----SGKGIIF 102
           +  + D      ++M+      +  +        +  ++      +       +  G   
Sbjct: 159 NTETKDANFSGNVVMRTPKYKINTPTAQGNMETGELHVMGPSVIRTAKGEVVHTNDGTYN 218

Query: 103 LQDFELTVPTQRSEYGDMY-LFAHSARFNLANHTLYISQPFKMKVKDNLRLDF-ETAVLD 160
            +  ++T+  + +       +      +N +          K+  K N R+   E  + +
Sbjct: 219 SKSDDMTLNGRSTITSPQRDVEGDYITYNSSTGDATGHGKVKIVDKVNKRIITGEDVIYN 278

Query: 161 VKNITINSSDPVIITHS--DFVLSANFARIENSSRSAVFAGQVSVV 204
            K         V +  +     ++ +     + +  +   G V +V
Sbjct: 279 AKTGYSEGQGNVKVIDNREQRTITGDAVIYNSKTGHSEGHGNVKIV 324


>gi|254470648|ref|ZP_05084051.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
 gi|211959790|gb|EEA94987.1| cell envelope biogenesis protein YhbN [Pseudovibrio sp. JE062]
          Length = 169

 Score = 42.0 bits (97), Expect = 0.052,   Method: Composition-based stats.
 Identities = 16/159 (10%), Positives = 39/159 (24%), Gaps = 19/159 (11%)

Query: 73  LSDYSKDR-VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYL--------F 123
            + +  D      + A   +        I            +      +           
Sbjct: 11  FAGFGSDNKEPIEIEATNLQVRDKDKSAIFSGNVVVTQGEAKLEAQRLIVFYSGSMANGN 70

Query: 124 AHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP-VIITHSDFVLS 182
           A       +   L       +    +     + A  D++   +  +   V ++    V+ 
Sbjct: 71  ADGQPVQQSISRLEAKGDVLV-SSKDQVATGDDASFDMEKQIVVMTGKRVTLSQGPNVIV 129

Query: 183 ANFARIENSSRSAVF--------AGQVSVVVNPGVLQKK 213
                I   +  A           G+V +++ P  L+ K
Sbjct: 130 GKRLVINLETGKANLDSSGTGGNTGRVRMLLQPNSLENK 168


>gi|290968955|ref|ZP_06560490.1| OstA-like protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290780911|gb|EFD93504.1| OstA-like protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 242

 Score = 42.0 bits (97), Expect = 0.053,   Method: Composition-based stats.
 Identities = 12/87 (13%), Positives = 24/87 (27%), Gaps = 2/87 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + + A    ++             ++      L  + A+ ++K      S    I   
Sbjct: 30  RPITITADVLAYDGETRVATADGNVYIRQ-GETGLTGQHAIYNIKTDVAEVSGNACIVQP 88

Query: 178 DFVLSANFARIENSSRSAVFAGQVSVV 204
           D  + A        +     AG V  V
Sbjct: 89  DLQVRAAKIEAYQKNHIIA-AGNVQAV 114


>gi|254473355|ref|ZP_05086752.1| organic solvent tolerance protein [Pseudovibrio sp. JE062]
 gi|211957471|gb|EEA92674.1| organic solvent tolerance protein [Pseudovibrio sp. JE062]
          Length = 800

 Score = 42.0 bits (97), Expect = 0.053,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 28/79 (35%), Gaps = 2/79 (2%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
                M L A   R++  N  +  S   ++    N  L  +    + K+   ++   V +
Sbjct: 60  DTSQPMLLEAKELRYDFDNDVIIASGSVEIYFD-NYTLLADRVTYNRKDGKFSAHGNVQM 118

Query: 175 THSDFVLS-ANFARIENSS 192
           T  D  L  A+   + +  
Sbjct: 119 TEPDGNLILADNLTLSDDF 137



 Score = 38.5 bits (88), Expect = 0.68,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 24/72 (33%)

Query: 144 MKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSV 203
           +     + L+ +    D  N  I +S  V I   ++ L A+              G V +
Sbjct: 59  IDTSQPMLLEAKELRYDFDNDVIIASGSVEIYFDNYTLLADRVTYNRKDGKFSAHGNVQM 118

Query: 204 VVNPGVLQKKEN 215
               G L   +N
Sbjct: 119 TEPDGNLILADN 130


>gi|316933706|ref|YP_004108688.1| Organic solvent tolerance protein [Rhodopseudomonas palustris DX-1]
 gi|315601420|gb|ADU43955.1| Organic solvent tolerance protein [Rhodopseudomonas palustris DX-1]
          Length = 839

 Score = 42.0 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 10/90 (11%), Positives = 27/90 (30%)

Query: 115 SEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVII 174
                  + + SA+    N      +P        + +       D  N  + +   V +
Sbjct: 41  GAVQTFAIESASAQGYNYNPRPARPKPPPAANNGQMLVQATEVNYDYNNKRVAAVGNVQM 100

Query: 175 THSDFVLSANFARIENSSRSAVFAGQVSVV 204
            ++   + A+    +  ++     G V + 
Sbjct: 101 YYNGTTVEADRLVYDQDTKRLRAEGNVRMT 130


>gi|209693974|ref|YP_002261902.1| organic solvent tolerance protein [Aliivibrio salmonicida LFI1238]
 gi|208007925|emb|CAQ78056.1| organic solvent tolerance protein precursor [Aliivibrio salmonicida
           LFI1238]
          Length = 784

 Score = 42.0 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 11/137 (8%), Positives = 34/137 (24%), Gaps = 12/137 (8%)

Query: 71  FILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFEL--------TVPTQRSEYGDMYL 122
              +           +A+ A         IIF    +          +  +  +   + +
Sbjct: 10  ASFTGCLLYGSP--AIADDAGQFIPPENNIIFPLKTDAVNSCQVPVKMSKEEEDQQPVLI 67

Query: 123 FAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS 182
            A S   +  +          +  K    +  +   L  +     +   V  +  D   +
Sbjct: 68  QADSVEAHNNSK-ATYKGNVHVI-KGRQEIKADNITLHQQENIAIAEGNVDYSSMDMRST 125

Query: 183 ANFARIENSSRSAVFAG 199
           ++    + ++       
Sbjct: 126 SDKVTTDLNTEDTTMIN 142


>gi|124023177|ref|YP_001017484.1| hypothetical protein P9303_14731 [Prochlorococcus marinus str. MIT
           9303]
 gi|123963463|gb|ABM78219.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9303]
          Length = 394

 Score = 42.0 bits (97), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/176 (10%), Positives = 51/176 (28%), Gaps = 11/176 (6%)

Query: 30  FFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDR-VKYSLVAE 88
             P   +  +   L     + S  ++         P + K   L     D    + L + 
Sbjct: 5   LLPSRHLGSLLLILTMVGCQESPSTQKK----SSVPFVFKSLELRHKQADGSRDWDLNSP 60

Query: 89  RAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD 148
            A+  +  G  ++  ++ E  +  +        + A +A       T+ +    K++   
Sbjct: 61  LAR--YELGSRVVRARNPEGVLYKEN--KPSFEVSAQAATVLKDGETVLLEGNVKVQQLT 116

Query: 149 NLR--LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVS 202
             +  +  +          +          +   ++A     +  ++  VF G   
Sbjct: 117 GEKVLITGDRLRWTPNESKMVIEQRPQALDNLSRITAKTVLFQQLTQEIVFKGPTK 172


>gi|170746988|ref|YP_001753248.1| organic solvent tolerance protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653510|gb|ACB22565.1| Organic solvent tolerance protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 859

 Score = 42.0 bits (97), Expect = 0.058,   Method: Composition-based stats.
 Identities = 7/77 (9%), Positives = 25/77 (32%), Gaps = 2/77 (2%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIIT-HS 177
            + + A    ++    T+      ++       L  +    D  +  + +   V +T   
Sbjct: 45  KLLVEADELIYDNDRGTVTARGNAELHYGP-RTLQADRVRYDRNSGRVFAEGNVRLTEAD 103

Query: 178 DFVLSANFARIENSSRS 194
             V++     + +  ++
Sbjct: 104 GGVVTGARMELTDDFKT 120



 Score = 35.8 bits (81), Expect = 4.0,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 20/53 (37%)

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           ++ +  + D    T+ +     + +    L A+  R + +S      G V + 
Sbjct: 48  VEADELIYDNDRGTVTARGNAELHYGPRTLQADRVRYDRNSGRVFAEGNVRLT 100


>gi|294672826|ref|YP_003573442.1| hypothetical protein PRU_0035 [Prevotella ruminicola 23]
 gi|294473834|gb|ADE83223.1| conserved hypothetical protein [Prevotella ruminicola 23]
          Length = 517

 Score = 42.0 bits (97), Expect = 0.059,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 27/86 (31%), Gaps = 1/86 (1%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
           G   L +    +N  +     +   KMK      L  +T   D +    +   P  IT  
Sbjct: 149 GKTTLTSDWGEYNTKSKMSVFNYDVKMK-SPKFFLTTDTLYYDTRLSMAHIVGPSNITSG 207

Query: 178 DFVLSANFARIENSSRSAVFAGQVSV 203
           +  + +     +  +  A    +  +
Sbjct: 208 ESHIYSEQGYYDTKNDRARLMNRSVL 233


>gi|158425551|ref|YP_001526843.1| hypothetical protein AZC_3927 [Azorhizobium caulinodans ORS 571]
 gi|158332440|dbj|BAF89925.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 198

 Score = 42.0 bits (97), Expect = 0.061,   Method: Composition-based stats.
 Identities = 28/188 (14%), Positives = 64/188 (34%), Gaps = 9/188 (4%)

Query: 29  FFFPFATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAE 88
                A    V    + +  +    +    + L        + I    + D ++     +
Sbjct: 4   LSLRLAAAACVLSLAVPALAQQPAANSGPPNALQGFARNRDEPI--RINSDTLEVKDKEK 61

Query: 89  RAKTSFNSG--KGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKV 146
           +A  S      +G   L   +L V         +   A S         L       ++ 
Sbjct: 62  QATFSGKVVVVQGDTTLHCPQLVVYYDGDVAAGVQGGAPSDS--SKIRKLEALGGVVVQT 119

Query: 147 KDNLRLDFETAVLDVKNITINSSD-PVIITHSDFVLSANFARIENSSRSAVFAGQ-VSVV 204
           K +     +T V ++K  T+  +  PV++T    V+      ++ ++  + F G  V ++
Sbjct: 120 K-DQTATGDTGVFEMKTNTVTLTGKPVVLTQGPNVVRGQKLVVDLTTGVSKFEGGRVDML 178

Query: 205 VNPGVLQK 212
           + PG +++
Sbjct: 179 LTPGSMKQ 186


>gi|310817098|ref|YP_003965062.1| OstA-like protein [Ketogulonicigenium vulgare Y25]
 gi|308755833|gb|ADO43762.1| OstA-like protein [Ketogulonicigenium vulgare Y25]
          Length = 160

 Score = 42.0 bits (97), Expect = 0.062,   Method: Composition-based stats.
 Identities = 15/130 (11%), Positives = 41/130 (31%), Gaps = 14/130 (10%)

Query: 81  VKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNL-----ANHT 135
               + +E    +  S   I       +         GD+ + A  A  +          
Sbjct: 37  QPVEITSETLNVNQGSQTAIFSGNVVIIQ--------GDIRIGAQIANVSYSSVTSQITR 88

Query: 136 LYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSA 195
           + +              + + A  D+ +  +   D V++T    +++++    + ++ +A
Sbjct: 89  ILLEGGVTFTTPTEA-AESDRATYDIGDGALVLEDNVLLTQGGLIMASDRMAADLAAGTA 147

Query: 196 VFAGQVSVVV 205
              G V   +
Sbjct: 148 QLDGNVRTRL 157


>gi|94497695|ref|ZP_01304263.1| organic solvent tolerance protein [Sphingomonas sp. SKA58]
 gi|94422912|gb|EAT07945.1| organic solvent tolerance protein [Sphingomonas sp. SKA58]
          Length = 756

 Score = 41.6 bits (96), Expect = 0.064,   Method: Composition-based stats.
 Identities = 12/89 (13%), Positives = 32/89 (35%), Gaps = 5/89 (5%)

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVK 162
           +   +  +P    + G     A +  +N     +  S   ++  +   RL  +  V D  
Sbjct: 42  ISAPDAPMPASEDQIG---FAADTLEYNSETEMVTASGNVQLLRE-GNRLRADKVVWDRN 97

Query: 163 NITINSSDPVIITHSDFVLS-ANFARIEN 190
           +  + +   V +T  D  ++  +   + +
Sbjct: 98  SGKVEAQGNVSVTDPDGNVAYGDRFDVTD 126


>gi|16125934|ref|NP_420498.1| hypothetical protein CC_1689 [Caulobacter crescentus CB15]
 gi|221234697|ref|YP_002517133.1| organic solvent tolerance protein [Caulobacter crescentus NA1000]
 gi|13423100|gb|AAK23666.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963869|gb|ACL95225.1| organic solvent tolerance protein [Caulobacter crescentus NA1000]
          Length = 809

 Score = 41.6 bits (96), Expect = 0.065,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 31/108 (28%), Gaps = 8/108 (7%)

Query: 86  VAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGD-MYLFAHSARFNLANHTLYISQPFKM 144
            A  A+ +  +       Q   +          D  YL +     +  N  +      + 
Sbjct: 39  SAAHAQQNLATIP-----QTPVIKTAPPDGLGDDGYYLESDLLIRDDKNQIMTAEGAVEA 93

Query: 145 KVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLS-ANFARIENS 191
           +      L  +  + D K   I +   V + + D     A+   ++  
Sbjct: 94  RY-QGRTLRADKVIYDSKTGAITADGNVQLINPDGTAEFADHLELDRD 140



 Score = 37.0 bits (84), Expect = 1.6,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 147 KDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
            D   L+ +  + D KN  + +   V   +    L A+    ++ + +    G V + +N
Sbjct: 66  DDGYYLESDLLIRDDKNQIMTAEGAVEARYQGRTLRADKVIYDSKTGAITADGNVQL-IN 124

Query: 207 P 207
           P
Sbjct: 125 P 125


>gi|307565710|ref|ZP_07628179.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
 gi|307345536|gb|EFN90904.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
          Length = 616

 Score = 41.6 bits (96), Expect = 0.067,   Method: Composition-based stats.
 Identities = 8/113 (7%), Positives = 25/113 (22%), Gaps = 29/113 (25%)

Query: 121 YLFAHSARFNLANHTLYISQPFKM-----------------------------KVKDNLR 151
            + A    +N             M                             + +    
Sbjct: 136 TIIADQGDYNTETKDANFYGNVIMRSYKYHITTPTAHGNTETGELHVVGPSVIRTRKGEI 195

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           +       +  +  +  +    I      +  ++    +++  A   G+V +V
Sbjct: 196 IHTSDGTYNSISDDMTLNGRSTIKSPQRDVEGDYITYNSNTGDATGHGKVKIV 248


>gi|294778906|ref|ZP_06744322.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|294447215|gb|EFG15799.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
          Length = 190

 Score = 41.6 bits (96), Expect = 0.067,   Method: Composition-based stats.
 Identities = 9/82 (10%), Positives = 23/82 (28%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
           D  + A +A +        +     ++ +   + D +    D K   + S   + I   D
Sbjct: 81  DASIKADTAYYYEKKKLWELRSNVHIRSQRGDKFDTDLLFWDEKQERVYSDKFIRIEQED 140

Query: 179 FVLSANFARIENSSRSAVFAGQ 200
            +++                  
Sbjct: 141 KIITGYGFESNQQMTEYQIYNN 162


>gi|300776320|ref|ZP_07086178.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
 gi|300501830|gb|EFK32970.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
          Length = 579

 Score = 41.6 bits (96), Expect = 0.070,   Method: Composition-based stats.
 Identities = 22/216 (10%), Positives = 57/216 (26%), Gaps = 45/216 (20%)

Query: 34  ATVTIVGWFLLSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRVKYSLVAERAKTS 93
             + ++ +    S+ +     K    L    P   K+    D  K      + A+  K +
Sbjct: 3   IALFLLLFISTLSFAQDKNPVKRDPYLQAPSPTQPKQVRPEDKVK-----IIHADEIKKN 57

Query: 94  FNSGKGIIFLQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLD 153
                G  +     + +  Q S      L A         + +      +++  D   + 
Sbjct: 58  PEKYDGNQYFTG-NVQIEHQGSI-----LTADEVVLYNEENFVKAIGNTRLQNTDGSVIT 111

Query: 154 FETAVLDVKNITINSSDPVIITHSDFVLSANFARIE------------------------ 189
                 D       +   V++T     +  +    +                        
Sbjct: 112 AGEMEYDANTQKGVARKNVVLTDPKQTIKTDILYYDRLANQAYFNTGGTISDGQNVTYAK 171

Query: 190 -----NSSRSAVFAGQVSV-----VVNPGVLQKKEN 215
                 ++R     G V +     +++   +++ +N
Sbjct: 172 VGTYFLNTRVVDLTGNVKIETPQYIIDGPNIKQNQN 207



 Score = 38.5 bits (88), Expect = 0.56,   Method: Composition-based stats.
 Identities = 11/92 (11%), Positives = 27/92 (29%), Gaps = 3/92 (3%)

Query: 122 LFAHSARFNLANHTLYISQP--FKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDF 179
           +   + + N          P     K     R+  E     +       +    I +++ 
Sbjct: 197 IDGPNIKQNQNTKIADFIGPTTITSKTNPRNRIYTEKGTYKMDTKEAYLTKNSRIFYNEK 256

Query: 180 VLSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
           +L+ +       S      G V++  +P   +
Sbjct: 257 ILTGDDMYYNQISGFGKATGNVTLD-DPKEKR 287


>gi|89890154|ref|ZP_01201665.1| conserved hypothetical protein [Flavobacteria bacterium BBFL7]
 gi|89518427|gb|EAS21083.1| conserved hypothetical protein [Flavobacteria bacterium BBFL7]
          Length = 189

 Score = 41.6 bits (96), Expect = 0.071,   Method: Composition-based stats.
 Identities = 7/91 (7%), Positives = 18/91 (19%)

Query: 110 VPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSS 169
              +     +  + A  A     +  + +     +   D    + E    D     I + 
Sbjct: 88  YEHKNDSLLETNITADYAIMYSESDLVDLKGNVTIVNHDGNTFNGEQLYWDQTAKWIFTD 147

Query: 170 DPVIITHSDFVLSANFARIENSSRSAVFAGQ 200
                   +   S      +           
Sbjct: 148 QSFSTQLKNASTSGTMLDADEEYNKITVRDN 178


>gi|150005097|ref|YP_001299841.1| hypothetical protein BVU_2562 [Bacteroides vulgatus ATCC 8482]
 gi|254883231|ref|ZP_05255941.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|319642606|ref|ZP_07997252.1| hypothetical protein HMPREF9011_02852 [Bacteroides sp. 3_1_40A]
 gi|149933521|gb|ABR40219.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]
 gi|254836024|gb|EET16333.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|317385694|gb|EFV66627.1| hypothetical protein HMPREF9011_02852 [Bacteroides sp. 3_1_40A]
          Length = 214

 Score = 41.6 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 9/82 (10%), Positives = 23/82 (28%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
           D  + A +A +        +     ++ +   + D +    D K   + S   + I   D
Sbjct: 105 DASIKADTAYYYEKKKLWELRSNVHIRSQRGDKFDTDLLFWDEKQERVYSDKFIRIEQED 164

Query: 179 FVLSANFARIENSSRSAVFAGQ 200
            +++                  
Sbjct: 165 KIITGYGFESNQQMTEYQIYNN 186


>gi|319408318|emb|CBI81971.1| Organic solvent tolerance protein [Bartonella schoenbuchensis R1]
          Length = 780

 Score = 41.6 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 26/75 (34%), Gaps = 2/75 (2%)

Query: 118 GDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHS 177
             + L A    +N    T+      +++  +N  +  +    + K   I +   V I   
Sbjct: 43  SPLLLSADKLTYNHDADTVSAEGNVQIEYDNNKVI-AQKVTYNQKTGRIIAQGNVEIIQK 101

Query: 178 DFV-LSANFARIENS 191
           D   + +++  +   
Sbjct: 102 DGNKVYSDYIDLTQD 116



 Score = 37.8 bits (86), Expect = 0.98,   Method: Composition-based stats.
 Identities = 7/53 (13%), Positives = 19/53 (35%)

Query: 152 LDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVV 204
           L  +    +    T+++   V I + +  + A        +   +  G V ++
Sbjct: 47  LSADKLTYNHDADTVSAEGNVQIEYDNNKVIAQKVTYNQKTGRIIAQGNVEII 99


>gi|182677565|ref|YP_001831711.1| OstA family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633448|gb|ACB94222.1| OstA family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 212

 Score = 41.6 bits (96), Expect = 0.072,   Method: Composition-based stats.
 Identities = 12/94 (12%), Positives = 27/94 (28%), Gaps = 1/94 (1%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
              +     +     +       M  K +     ++ V +     +  +  V +T    V
Sbjct: 110 TANSAGGTGSDQVRRMEAPNAVVMISK-DQVGTGDSGVYEKAENKVTLNGNVTLTQGPNV 168

Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKE 214
              +    +  +  AV  G V  +  P   +  E
Sbjct: 169 TKGDKLVYDLHTSQAVVIGHVRSLFLPSDSKSAE 202



 Score = 38.2 bits (87), Expect = 0.91,   Method: Composition-based stats.
 Identities = 11/122 (9%), Positives = 32/122 (26%), Gaps = 15/122 (12%)

Query: 108 LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKD---------------NLRL 152
             V    + +  + + A    +      L  +        +                   
Sbjct: 52  GRVLPGGNGHQPVNIEATKLDYFDKEQKLIYTGNVVATQGETILKTSTLIIYLVPKGSTA 111

Query: 153 DFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQK 212
           +        +   + + + V++   D V + +    E +       G V++   P V + 
Sbjct: 112 NSAGGTGSDQVRRMEAPNAVVMISKDQVGTGDSGVYEKAENKVTLNGNVTLTQGPNVTKG 171

Query: 213 KE 214
            +
Sbjct: 172 DK 173


>gi|84514853|ref|ZP_01002216.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
 gi|84511012|gb|EAQ07466.1| hypothetical protein SKA53_11553 [Loktanella vestfoldensis SKA53]
          Length = 153

 Score = 41.6 bits (96), Expect = 0.074,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 37/99 (37%), Gaps = 4/99 (4%)

Query: 117 YGDMYLFAHSARFNLANHTLYISQPFK----MKVKDNLRLDFETAVLDVKNITINSSDPV 172
            GD+ L A        N T  I++       +        + +TA  D+    +  +  V
Sbjct: 55  QGDLRLSAQRVEVVYGNDTAEIARLIASGGALLANTQDAAEADTADYDITTGLLTLTGDV 114

Query: 173 IITHSDFVLSANFARIENSSRSAVFAGQVSVVVNPGVLQ 211
           ++T    V+SA    +  +  +A   G+V  ++     +
Sbjct: 115 LVTQGGNVISAQSMIVNVTDGTATMQGRVRTMLQQSTNE 153


>gi|325273321|ref|ZP_08139593.1| hypothetical protein G1E_09881 [Pseudomonas sp. TJI-51]
 gi|324101554|gb|EGB99128.1| hypothetical protein G1E_09881 [Pseudomonas sp. TJI-51]
          Length = 190

 Score = 41.6 bits (96), Expect = 0.075,   Method: Composition-based stats.
 Identities = 8/168 (4%), Positives = 39/168 (23%), Gaps = 9/168 (5%)

Query: 44  LSSWIRISTFSKSSIDLLDFEPMIMKKFILSDYSKDRV-KYSLVAERAKTSFNSGKGIIF 102
            +           +                  +  D   +Y + A++ +        +  
Sbjct: 25  WNVSPESFLDQPVAQVDESAIDYYAINAHSVQFLPDGKLQYEMTADKVE--HVKATEVTL 82

Query: 103 LQDFELTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKM----KVKDNLRLDFETAV 158
           +   +L +          ++ +  A  +   + + +    ++    + + +  +      
Sbjct: 83  VTTPDLRLYR--GTEYPWHVQSERAEVSPDGNEVELINKVRVARTDERQRDTIITSSRMT 140

Query: 159 LDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAGQVSVVVN 206
           +  +     +   V I  +    +    +             V     
Sbjct: 141 VFPQKQYAQTEQAVRIDGAGGTTTGKGMKAYLKEGKMDLLSNVRGQYE 188


>gi|260591264|ref|ZP_05856722.1| conserved hypothetical protein [Prevotella veroralis F0319]
 gi|260537129|gb|EEX19746.1| conserved hypothetical protein [Prevotella veroralis F0319]
          Length = 643

 Score = 41.6 bits (96), Expect = 0.075,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 25/84 (29%)

Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180
            +    A  N     +++     ++      +       + +   +  +    IT     
Sbjct: 197 RITTPEAHGNTETGLVHVVGKSVIRTAKGEVVHTNDGTYNSRTDNMELNGHSTITSPKQD 256

Query: 181 LSANFARIENSSRSAVFAGQVSVV 204
           +  +     +S+  A   G V +V
Sbjct: 257 VEGDNIVYNSSTGEAEGHGNVKIV 280


>gi|212694488|ref|ZP_03302616.1| hypothetical protein BACDOR_04016 [Bacteroides dorei DSM 17855]
 gi|237711175|ref|ZP_04541656.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237727540|ref|ZP_04558021.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265750765|ref|ZP_06086828.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|212662989|gb|EEB23563.1| hypothetical protein BACDOR_04016 [Bacteroides dorei DSM 17855]
 gi|229434396|gb|EEO44473.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229455019|gb|EEO60740.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263237661|gb|EEZ23111.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 214

 Score = 41.6 bits (96), Expect = 0.076,   Method: Composition-based stats.
 Identities = 9/82 (10%), Positives = 23/82 (28%)

Query: 119 DMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSD 178
           D  + A +A +        +     ++ +   + D +    D K   + S   + I   D
Sbjct: 105 DASIKADTAYYYEKKKLWELRSNVHIRSQRGDKFDTDLLFWDEKQERVYSDKFIRIEQED 164

Query: 179 FVLSANFARIENSSRSAVFAGQ 200
            +++                  
Sbjct: 165 KIITGYGFESNQQMTEYQIYNN 186


>gi|67458646|ref|YP_246270.1| organic solvent tolerance protein [Rickettsia felis URRWXCal2]
 gi|67004179|gb|AAY61105.1| Organic solvent tolerance protein homolog [Rickettsia felis
           URRWXCal2]
          Length = 713

 Score = 41.6 bits (96), Expect = 0.079,   Method: Composition-based stats.
 Identities = 12/115 (10%), Positives = 39/115 (33%), Gaps = 8/115 (6%)

Query: 108 LTVPTQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITIN 167
             +           + A    +N +   +Y     ++       L  +  + D+KN  + 
Sbjct: 20  ADLSKNGQNIKISNMIADFVEYNESQDLIYAKGNIRIITD-EYLLTADNLLYDIKNDILW 78

Query: 168 SSDPVIITHSDFV-LSANFARIENSSRS------AVFAGQVSVVVNPGVLQKKEN 215
           +   + I +     +  + A +++  +        + +G  ++++     +  EN
Sbjct: 79  AEGNIRIKNKQNRIIEGDKAVLKDEFKKGIISEFILLSGDNNLLIAKLAERIDEN 133



 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 37/104 (35%), Gaps = 13/104 (12%)

Query: 93  SFNSGKGIIFLQDFELTVPTQRSEYGDMY-------------LFAHSARFNLANHTLYIS 139
             +     I + +              +Y             L A +  +++ N  L+  
Sbjct: 21  DLSKNGQNIKISNMIADFVEYNESQDLIYAKGNIRIITDEYLLTADNLLYDIKNDILWAE 80

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSA 183
              ++K K N  ++ + AVL  +      S+ ++++  + +L A
Sbjct: 81  GNIRIKNKQNRIIEGDKAVLKDEFKKGIISEFILLSGDNNLLIA 124


>gi|158523218|ref|YP_001531088.1| organic solvent tolerance protein [Desulfococcus oleovorans Hxd3]
 gi|158512044|gb|ABW69011.1| Organic solvent tolerance protein [Desulfococcus oleovorans Hxd3]
          Length = 799

 Score = 41.2 bits (95), Expect = 0.083,   Method: Composition-based stats.
 Identities = 11/89 (12%), Positives = 31/89 (34%), Gaps = 1/89 (1%)

Query: 112 TQRSEYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDP 171
            +        + A +  ++             +  K+  R+  ++   D KN  + +   
Sbjct: 65  FRMDPKSAWRIDAGAITYDKQADLYLAVGKVTI-TKEGKRIVADSIWFDQKNQRLFADGN 123

Query: 172 VIITHSDFVLSANFARIENSSRSAVFAGQ 200
           V +T    VLS +   ++ ++ +   +  
Sbjct: 124 VTMTAGPDVLSGDHMEMDMAAETGTISNG 152



 Score = 38.5 bits (88), Expect = 0.68,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 26/71 (36%)

Query: 140 QPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFVLSANFARIENSSRSAVFAG 199
             F+M  K   R+D      D +     +   V IT     + A+    +  ++     G
Sbjct: 63  DLFRMDPKSAWRIDAGAITYDKQADLYLAVGKVTITKEGKRIVADSIWFDQKNQRLFADG 122

Query: 200 QVSVVVNPGVL 210
            V++   P VL
Sbjct: 123 NVTMTAGPDVL 133


>gi