BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780746|ref|YP_003065159.1| hypothetical protein CLIBASIA_03165 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780746|ref|YP_003065159.1| hypothetical protein CLIBASIA_03165 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 438 bits (1126), Expect = e-125, Method: Compositional matrix adjust. Identities = 215/215 (100%), Positives = 215/215 (100%) Query: 1 MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60 MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL Sbjct: 1 MDHLDRRNKILLQRSKYRQHVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSIDL 60 Query: 61 LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120 LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM Sbjct: 61 LDFEPMIMKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120 Query: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV Sbjct: 121 YLFAHSARFNLANHTLYISQPFKMKVKDNLRLDFETAVLDVKNITINSSDPVIITHSDFV 180 Query: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN Sbjct: 181 LSANFARIENSSRSAVFAGQVSVVVNPGVLQKKEN 215 >gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Score = 29.3 bits (64), Expect = 0.052, Method: Compositional matrix adjust. Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 10/69 (14%) Query: 20 HVRFIQFLKFFFPFATVTIVGWFLLSSWIRISTFSKSSID---LLDFEPMIMKKF----- 71 + R + F+ +FF FAT +I+G L +S I I+ S++ D L + P + + Sbjct: 2 YYRIVSFIGYFFGFATYSILGAILGAS-IYIAKISQNLPDYAALNSYSPAVTTRIHAGNG 60 Query: 72 -ILSDYSKD 79 ++++Y+++ Sbjct: 61 ALMAEYARE 69 >gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Score = 24.3 bits (51), Expect = 1.7, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 13/20 (65%) Query: 162 KNITINSSDPVIITHSDFVL 181 K I I S DP II+ SDF L Sbjct: 517 KTIVIISHDPTIISMSDFSL 536 >gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 91 KTSFNSGKGIIFLQDFELTVPTQRSEYGDMYLF 123 KT+ S KG + L+D +T P D+ LF Sbjct: 2 KTAVASTKGGLELKDISVTYPNGYCALEDVNLF 34 >gi|254781208|ref|YP_003065621.1| hypothetical protein CLIBASIA_05575 [Candidatus Liberibacter asiaticus str. psy62] Length = 578 Score = 23.1 bits (48), Expect = 3.9, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 68 MKKFILSDYSKDRVKYSLVAERAKTSFNSGKGIIFLQDFELT 109 + +I++D D+V SL R+ F KG +++D +T Sbjct: 225 IGAYIVAD---DKVYRSLTTGRSGDRFGYSKGATYVKDNNIT 263 >gi|254780313|ref|YP_003064726.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 23.1 bits (48), Expect = 4.0, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 57 SIDLLDFEPMIMKKFILSDY 76 +ID+LD EP++ KF D+ Sbjct: 100 AIDILDMEPILGVKFFKFDF 119 >gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 23.1 bits (48), Expect = 4.0, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 85 LVAERAKTSFNSGKGIIFLQDFELTVPTQRSEYGDM 120 L+A + + NS I DFEL + T+R GD+ Sbjct: 471 LLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506 >gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 245 Score = 23.1 bits (48), Expect = 4.2, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 105 DFELTVPTQRSEYGDMYLF-AHSARFNLANHTL 136 DF L + TQ GD Y + AH R ++ L Sbjct: 13 DFPLCIKTQGKASGDQYHYLAHVLRMKEGDNIL 45 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.9 bits (45), Expect = 9.9, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Query: 116 EYGDMYLFAHSARFNLANHTLYISQPFKMKVKDNLRL---------DFETAVLDVKNITI 166 EY +L A FN NH + S K+ D ++ DF + +KN+TI Sbjct: 77 EYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGI--IKNLTI 134 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.137 0.392 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 132,809 Number of Sequences: 1233 Number of extensions: 5230 Number of successful extensions: 21 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 11 length of query: 215 length of database: 328,796 effective HSP length: 70 effective length of query: 145 effective length of database: 242,486 effective search space: 35160470 effective search space used: 35160470 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 36 (18.5 bits)