BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780748|ref|YP_003065161.1| integration host factor, beta subunit [Candidatus Liberibacter asiaticus str. psy62] (100 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780748|ref|YP_003065161.1| integration host factor, beta subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 100 Score = 201 bits (511), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 100/100 (100%), Positives = 100/100 (100%) Query: 1 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL Sbjct: 1 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60 Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS 100 ARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS Sbjct: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERLNSPDSTLSNS 100 >gi|254780496|ref|YP_003064909.1| integration host factor subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 114 Score = 41.6 bits (96), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 22/90 (24%), Positives = 49/90 (54%), Gaps = 1/90 (1%) Query: 1 MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60 + +S L+ +I+K+ L+ +D + V L E+ + G ++I F +F V+++ +R+ Sbjct: 5 ITRSDLVKSISKEFG-LSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRV 63 Query: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERL 90 R + + ++ + V F+A LK+R+ Sbjct: 64 GRNLQTNQEVKIDPRRVVVFKASSILKKRI 93 >gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Score = 22.7 bits (47), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 47 GFGSFSVRKRAARLARAPLAQKVISVEEKMVPFFRAGKNLKE 88 G G ++ +R ARLA AP + ++ K G+N+++ Sbjct: 63 GVGKTAISRRLARLAGAPFIKVEVT---KFTEIGYVGRNVEQ 101 >gi|254781000|ref|YP_003065413.1| tRNA (uracil-5-)-methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Score = 21.2 bits (43), Expect = 4.1, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 11 AKKNPKLNYQDVEKIVNMLLEEMTQAL 37 A+ N N+ + KIV M +E TQA+ Sbjct: 247 ARYNIAANHVNNVKIVRMSSKEFTQAM 273 >gi|254781120|ref|YP_003065533.1| radical SAM protein [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Score = 20.8 bits (42), Expect = 5.4, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 15/25 (60%) Query: 17 LNYQDVEKIVNMLLEEMTQALANGG 41 +N+ E ++ M+ EE+ +AL G Sbjct: 1 MNFLKKESLIGMMREELEEALLKIG 25 >gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 20.4 bits (41), Expect = 6.4, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 14 NPKLNYQDVEKIVNMLLEEM 33 N N D+E+ N++LEE+ Sbjct: 108 NSSFNPSDIERERNVVLEEI 127 >gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 20.4 bits (41), Expect = 7.9, Method: Compositional matrix adjust. Identities = 14/62 (22%), Positives = 26/62 (41%), Gaps = 14/62 (22%) Query: 9 TIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARLARAPLAQK 68 +I +P+ + Q EK+V+ + + ++ N G +A L PL K Sbjct: 331 SIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDG--------------LSAWLEEHPLEAK 376 Query: 69 VI 70 +I Sbjct: 377 II 378 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 20.0 bits (40), Expect = 9.2, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 10/46 (21%) Query: 13 KNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFS-VRKRA 57 KN LNY D + + L NG RVE + SF V +RA Sbjct: 57 KNNLLNYID---------NDSSNKLKNGFRVECKPTSSFQRVVQRA 93 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.130 0.344 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,437 Number of Sequences: 1233 Number of extensions: 1822 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 100 length of database: 328,796 effective HSP length: 61 effective length of query: 39 effective length of database: 253,583 effective search space: 9889737 effective search space used: 9889737 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 32 (16.9 bits)