>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain. RNase E is an essential endoribonuclease in the processing and degradation of RNA. In addition to its role in mRNA degradation, RNase E has also been implicated in the processing of rRNA, and the maturation of tRNA, 10Sa RNA and the M1 precursor of RNase P. RNase E associates with PNPase (3' to 5' exonuclease), Rhl B (DEAD-box RNA helicase) and enolase (glycolytic enzyme) to form the RNA degradosome. RNase E tends to cut mRNA within single-stranded regions that are rich in A/U nucleotides. The N-terminal region of RNase E contains the catalytic site. Within the conserved N-terminal domain of RNAse E and RNase G, there is an S1-like subdomain, which is an ancient single-stranded RNA-binding domain. S1 domain is an RNA-binding module originally identified in the ribosomal protein S1. The S1 domain is required for RNA cleavage by RNase E. RNase G is paralogous to RNase E with an N-terminal catalytic domain th

Probab=99.95 E-value=3.4e-28 Score=215.02 Aligned_cols=87 Identities=46% Similarity=0.785 Sum_probs=79.1 Q ss_pred CCCCCCCCEEEEEEEEECCCCCEEEEEECCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC Q ss_conf 34604287879899783638823135327897713022213712102898899999998886311111000000011122 Q gi|254780751|r 34 HKKQIKGNIYLAKVTRVEPSLQAAFVDYGGNRHGFLPFLEIHPDYYQIPFSDRQALLKESNIAQTDSEAVADDVTHGDVT 113 (723) Q Consensus 34 ~~~~~~GnIY~G~V~~V~p~lqAAFVdiG~~k~gFL~~~ei~~~y~~ip~~d~~~l~~~~~~~~~~~~~~~~~~~~~~~~ 113 (723) T Consensus 2 ~~~~~vGnIY~GkV~~v~p~i~AAFVdiG~~k~gfL~~~d~~~~~~~--------------------------------- 48 (88) T cd04453 2 NREPIVGNIYLGRVKKIVPGLQAAFVDIGLGKNGFLHLSDILPAYFK--------------------------------- 48 (88) T ss_pred CCCCCCCCEEEEEEEEECCCCCEEEEECCCCCCEEEECHHCCHHHHC--------------------------------- T ss_conf 87561124899999886668748999658986899990345723513--------------------------------- Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCEEEEEEECCCCCCCC Q ss_conf 33444334454222233445543322223432112211121100001223444421331068885799984033323456 Q gi|254780751|r 114 IPNDHSLEEVAPIANFSQETEEESIISANNDVVSNVEDVKGGSPEDVPKKFKRQYCIQEVIKNRQILLVQIVKEERGNKG 193 (723) Q Consensus 114 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~lk~gq~ilVQV~ke~~~~Kg 193 (723) T Consensus 49 ----------------------------------------------------~~~~~~~~l~~G~~ilVQV~Ke~~~~Kg 76 (88) T cd04453 49 ----------------------------------------------------KHKKIAKLLKEGQEILVQVVKEPIGTKG 76 (88) T ss_pred ----------------------------------------------------CCCCHHHHCCCCCEEEEEEEECCCCCCC T ss_conf ----------------------------------------------------5788778377999999999766879978 Q ss_pred CCCCCCCCCCCC Q ss_conf 410123345765 Q gi|254780751|r 194 AAVTTYLSLAGR 205 (723) Q Consensus 194 a~lT~~isl~Gr 205 (723) T Consensus 77 p~lT~~isl~Gr 88 (88) T cd04453 77 PRLTTNISLPGR 88 (88) T ss_pred CEEEEEEECCCC T ss_conf 608845872889

HHsearch alignment for GI: 254780751 and conserved domain: cd04453