RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780754|ref|YP_003065167.1| inorganic polyphosphate/ATP-NAD kinase [Candidatus Liberibacter asiaticus str. psy62] (264 letters) >gnl|CDD|30410 COG0061, COG0061, Predicted sugar kinase [Carbohydrate transport and metabolism]. Length = 281 Score = 160 bits (406), Expect = 3e-40 Identities = 76/270 (28%), Positives = 120/270 (44%), Gaps = 18/270 (6%) Query: 1 MDRNIQKIHFKASNAKKAQEAYDKFV--KIYGNSTSEEADVIVVLGGDGFMLQSFHQSKE 58 R + + FK + QE ++ Y + E+AD+IVVLGGDG +L++ Sbjct: 18 AKRLYEFLKFKGVTVEVDQELAEELKDFADYVDDDEEKADLIVVLGGDGTLLRAARLLAR 77 Query: 59 YDKPIYGMNCGSVGFLMNEYC--IENLVERLSVAVECTFHP---LKMTVFDYDNSICAEN 113 D P+ G+N G +GFL + +E ++ L + E L+++V D Sbjct: 78 LDIPVLGINLGHLGFLTDFEPDELEKALDAL-LEGEYRIEERLLLEVSVNRGDIRRA--- 133 Query: 114 ILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGP 173 LA+NEV I R + + EV +DD DGL+VSTP GSTAYN SA GP Sbjct: 134 -LALNEVVIHRGSPA----KMIEFEVYIDD-EFFESFRGDGLIVSTPTGSTAYNLSAGGP 187 Query: 174 ILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRI 233 IL + LTP+ P + +LP+ + I+VL +R + D + ++ Sbjct: 188 ILHPGLDAIQLTPICPHSL-SFRPLVLPSSSTVRIEVLLTPKRDAVVVVDGQELLLINPG 246 Query: 234 NVTQSSDITMRILSDSHRSWSDRILTAQFS 263 + + + RS+ D + Sbjct: 247 DRIEIRRSPYKARFIRLRSYDDFFERLRSK 276 >gnl|CDD|144927 pfam01513, NAD_kinase, ATP-NAD kinase. Members of this family include ATP-NAD kinases EC:2.7.1.23, which catalyses the phosphorylation of NAD to NADP utilising ATP and other nucleoside triphosphates as well as inorganic polyphosphate as a source of phosphorus. Also includes NADH kinases EC:2.7.1.86. Length = 243 Score = 106 bits (267), Expect = 6e-24 Identities = 66/209 (31%), Positives = 106/209 (50%), Gaps = 11/209 (5%) Query: 35 EEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECT 94 E D+IVVLGGDG L + ++D PI G+N G++GFL E+ E + L +E Sbjct: 34 EGVDLIVVLGGDGTALDAARLLGDHDIPILGINTGTLGFL-TEFSPEEAAKLLDALLEGE 92 Query: 95 FHP---LKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELV 151 + + V + LA+NEV II P + ++EV +D ++ L + Sbjct: 93 YKIEKRELLDVIVRRSKRLLIVDLALNEVVIIGGPASTMI----EIEVYIDGEL-LESIR 147 Query: 152 CDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVL 211 DGL+VSTP GSTAY+ SA GPI+ +LLTP+ P ++P+ + I++ Sbjct: 148 GDGLIVSTPTGSTAYSLSAGGPIISPGVLAILLTPICPHS-LSSRPIVVPSSSKLRIRLD 206 Query: 212 EHKQRPVIATADR-LAIEPVSRINVTQSS 239 ++ ++ R L ++P + V +S Sbjct: 207 SKEEALLVLDGQRELDLKPGDEVTVRKSP 235 >gnl|CDD|37389 KOG2178, KOG2178, KOG2178, Predicted sugar kinase [Carbohydrate transport and metabolism]. Length = 409 Score = 75.8 bits (186), Expect = 1e-14 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 29/188 (15%) Query: 38 DVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMN-----------EYCIENLVER 86 D+I+ LGGDG +L + + P+ + GS+GFL Sbjct: 170 DLIITLGGDGTVLYASSLFQRSVPPVLSFSLGSLGFLTPFPFANFQEQLARVLNGRAAVN 229 Query: 87 LSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVR 146 L + + C+ + + A + +NEV I R P + L++ VDD++ Sbjct: 230 LRMRLRCSLKRKDLAEKTH----AASSHYVLNEVVIDRGPSP----FLSNLDLYVDDKL- 280 Query: 147 LPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSP----FKPRRWHGAILPN 202 + ++ DGL+V+TP GSTAY+ SA G ++ +L+TP+ P F+P ILP+ Sbjct: 281 ITKVQGDGLIVATPTGSTAYSASAGGSLVHPSVPAILVTPICPHSLSFRP-----IILPD 335 Query: 203 DVMIEIQV 210 + ++V Sbjct: 336 SSELRVEV 343 >gnl|CDD|39382 KOG4180, KOG4180, KOG4180, Predicted kinase [General function prediction only]. Length = 395 Score = 37.3 bits (86), Expect = 0.004 Identities = 39/177 (22%), Positives = 68/177 (38%), Gaps = 48/177 (27%) Query: 36 EADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNC---GSVGFLM----NEYCIENLVERLS 88 AD+++ +GGDG L + + + KP+ G+N GS G L + +L+ Sbjct: 105 WADMVISVGGDGTFLLAASRVIDDSKPVIGVNTDPTGSEGHLCLPDKYPSNPAGALCKLT 164 Query: 89 VA--------------VECTFHPLKMTVFDYDNSICAEN--------------------- 113 V P + + D S + Sbjct: 165 SGNFEWVLRQRIRGTVVGDDGIPDPIDLHDQQLSDNQRSSAKEIEETLLSHSEAVEIVAL 224 Query: 114 -ILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFS 169 +LA+NEV I G++ + + E+ +DD+ + + GLVV T GST++ F+ Sbjct: 225 PVLALNEVFI----GESLSARVSYYEISIDDKDGVKQ-KSSGLVVCTGTGSTSWTFN 276 >gnl|CDD|132848 cd07209, Pat_hypo_Ecoli_Z1214_like, Hypothetical patatin similar to Z1214 protein of Escherichia coli. Patatin-like phospholipase similar to Z1214 protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates. Length = 215 Score = 29.6 bits (67), Expect = 0.98 Identities = 16/72 (22%), Positives = 26/72 (36%), Gaps = 18/72 (25%) Query: 138 EVKVDDQVRLPELVCDGLVVS-TPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWH 196 V++D DG VV TP+ P + L + +++ +S R Sbjct: 130 PVEIDG-----RYYWDGGVVDNTPLS----------PAIDLGADEIIVVSLSD--KGRDD 172 Query: 197 GAILPNDVMIEI 208 P +IEI Sbjct: 173 RKGTPPTTLIEI 184 >gnl|CDD|153240 cd03146, GAT1_Peptidase_E, Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E. Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E. This group contains proteins similar to the aspartyl dipeptidases Salmonella typhimurium peptidase E and Xenopus laevis peptidase E. In bacteria peptidase E is believed to play a role in degrading peptides generated by intracellular protein breakdown or imported into the cell as nutrient sources. Peptidase E uniquely hydrolyses only Asp-X dipeptides (where X is any amino acid), and one tripeptide Asp-Gly-Gly. Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow. Xenopus PepE is developmentally regulated in response to thyroid hormone and, it is thought to play a role in apoptosis during tail reabsorption. Length = 212 Score = 29.6 bits (67), Expect = 1.1 Identities = 14/46 (30%), Positives = 19/46 (41%), Gaps = 10/46 (21%) Query: 35 EEADVIVVLGGDGF-MLQSFH---------QSKEYDKPIYGMNCGS 70 EADVI V GG+ F +L + + E G + GS Sbjct: 79 LEADVIYVGGGNTFNLLAQWREHGLDAILKAALERGVVYIGWSAGS 124 >gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors, non-NMDA ionotropic receptors which respond to the neurotransmitter glutamate. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Kainate receptors have five subunits, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeric receptor channels activated by kainate and glutamate when expressed in heterologous systems. Kainate receptors are involved in excitatory neurotransmission by activating postsynaptic receptors and in inhibitory neurotransmission by modulating release of the inhibitory neurotransmitter GABA through a presynaptic mechanism. Kainate receptors are closely related to AMAP receptors. In contrast of AMPA receptors, kainate receptors play only a minor role in signaling at synapses and their function is not well defined. Length = 327 Score = 27.6 bits (62), Expect = 3.5 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 101 TVFDYDNSICAENIL--AINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCD 153 +FD D+ E AI+ ++ ++ N ++ VK DD + VCD Sbjct: 4 AIFDDDDDSGEELAFRYAIDRINREKELLANTTLEYDIKRVKPDDSFETTKKVCD 58 >gnl|CDD|143508 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE. This subfamily is composed of uncharacterized proteins with similarity to Escherichia coli MccE, a hypothetical protein that is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Most members of this subfamily share the same domain architecture as ODC and DapDC. A few members, including Escherichia coli MccE, contain an additional acetyltransferase domain at the C-terminus. Length = 379 Score = 27.6 bits (62), Expect = 3.6 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Query: 186 PVSPFKPRRWHGAILPNDVM----IEIQVLEHKQR-PVIATADRLAIEPVSRINVTQSSD 240 P+ +P + DV +E VL P + D LAI V N+TQS+ Sbjct: 305 PILVLRPGKEDPTSKNYDVYGFNCMESDVLFPNVPLPPLNVGDILAIRNVGAYNMTQSNQ 364 Query: 241 IT 242 Sbjct: 365 FI 366 >gnl|CDD|33539 COG3744, COG3744, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 130 Score = 26.4 bits (58), Expect = 8.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 223 DRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQ 261 D L + + +T + I R L H+ DRI+ AQ Sbjct: 67 DALRRNGIELLPITPAHAIAARALPLHHKDPFDRIIIAQ 105 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0730 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,091,306 Number of extensions: 158761 Number of successful extensions: 383 Number of sequences better than 10.0: 1 Number of HSP's gapped: 376 Number of HSP's successfully gapped: 14 Length of query: 264 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 172 Effective length of database: 4,275,709 Effective search space: 735421948 Effective search space used: 735421948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.3 bits)