HHsearch alignment for GI: 254780755 and conserved domain: CHL00151

>CHL00151 preA prenyl transferase; Reviewed.
Probab=100.00  E-value=0  Score=515.04  Aligned_cols=280  Identities=32%  Similarity=0.482  Sum_probs=260.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHH---HHHHHHHHHHHHHHHHH
Q ss_conf             799999999999999999860778758999999999679822799999999997089857---86666557899999998
Q gi|254780755|r    3 MLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD---NHVLLACAIEFIHTATL   79 (322)
Q Consensus         3 ~l~~~~~~~l~~v~~~i~~~~~~~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~---~~~~~a~~iEliH~asL   79 (322)
T Consensus         6 ~i~~~i~~~l~~ve~~l~~~l~s~~~~l~~a~~y~~~~gGKRlRP~L~ll~~~~~g~~~~~~~~~~~~A~avEliH~aSL   85 (288)
T CHL00151          6 KLLAPVEEDLESVEKNLKKLIGTRHPILSAAARHLFSAGGKRIRPAIVLLVAKATGGNQEIAPPQRRLAEITEMIHTASL   85 (288)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88999999999999999988279966999999999865997286999999999819980010668999999999999999


Q ss_pred             HHHHHHCHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             75211011220011012101001102343124578888764210243110001234567777775456554213221035
Q gi|254780755|r   80 LHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEE  159 (322)
Q Consensus        80 iHDDI~D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~~~~~~~~~l~~Gq~~d~~~~~~~~~s~~  159 (322)
T Consensus        86 IHDDi~D~s~~RRG~pt~h~~~G~~~AIL~GD~L~~~a~~~la~~~~~~~~~~~~~~i~~l~~g~~~~~~~~~~~~~~~~  165 (288)
T CHL00151         86 VHDDVVDEDSTRRGVPTVHKRFGTKIAVLAGDFLFAQSSWYLANLNNLEVVKLISKVITDLAEGEIRQGLVQFDTTLSTL  165 (288)
T ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
T ss_conf             84677899866689865324414389999988999999999760463256899999999999888987764258887899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             78989986433555544321000112222101579999973111689887641123670003840123454213653210
Q gi|254780755|r  160 DYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI  239 (322)
Q Consensus       160 ~y~~ii~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~Dl~egk~Tlpii  239 (322)
T Consensus       166 ~y~~~~~~KTa~Lf~~a~~~gailaga~~~~~~~l~~~G~~lG~AFQI~DDlLD~~gd~~~~GK~~g~Dl~eGK~Tlp~l  245 (288)
T CHL00151        166 EYIEKSFYKTASLLAASCKAAALLSDADEELLNDLYLYGKHLGLAFQIIDDILDITGSTESLGKPAGSDLKNGNLTAPVL  245 (288)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCHHHHCCCCCHHHHCCCCCHHHH
T ss_conf             99999985207999999999999809999999999998641311455349754035898997899114777598419999


Q ss_pred             HHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHC
Q ss_conf             01101431100013432036899989999999999974969999999999999999984208999899999999999960
Q gi|254780755|r  240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQ  319 (322)
Q Consensus       240 ~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k~~L~~L~~~ii~  319 (322)
T Consensus       246 ~ale~~--------------------------------------~~~~~~l~~~a~~~l~--~~~~~~~~L~~l~~~i~~  285 (288)
T CHL00151        246 FALEQS--------------------------------------SKLAELIEREFCEGIL--PPSEAKDALLALADFIIN  285 (288)
T ss_pred             HHHHHH--------------------------------------HHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHHH
T ss_conf             999985--------------------------------------9999999999999765--147306999999999985


Q ss_pred             CCC
Q ss_conf             379
Q gi|254780755|r  320 RLN  322 (322)
Q Consensus       320 R~~  322 (322)
T Consensus       286 R~~  288 (288)
T CHL00151        286 RLS  288 (288)
T ss_pred             CCC
T ss_conf             679