HHsearch alignment for GI: 254780755 and conserved domain: KOG0777

>KOG0777 consensus.
Probab=100.00  E-value=4.3e-43  Score=284.51  Aligned_cols=280  Identities=22%  Similarity=0.320  Sum_probs=246.7

Q ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHCCCCHHHCCCHHH
Q ss_conf             75899999999967982279999999999708985786666557899999998752110112200110121010011023
Q gi|254780755|r   27 VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTS  106 (322)
Q Consensus        27 ~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iEliH~asLiHDDI~D~~~~RRg~~t~~~~~G~~~A  106 (322)
T Consensus        20 ~~ill~Py~yilq~PGKqfR~~L~~afNhwl~~P~dkLaii~~ivemLHNsSLLIDDIEDNs~LRRG~pvaHsIyGvpSt   99 (322)
T KOG0777          20 ESILLKPYNYILQKPGKQFRLNLIVAFNHWLNLPKDKLAIISQIVEMLHNSSLLIDDIEDNSPLRRGQPVAHSIYGVPST   99 (322)
T ss_pred             HHHHHCHHHHHHHCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCEEECCCCCCCHHHCCCCCHHHHCCCCCH
T ss_conf             89985528899847408899999999999982979899999999999822430211123364221687221120167421


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4312457888876421024311000123456777777545655421322-103578989986433555544321000112
Q gi|254780755|r  107 VLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLD-VTEEDYLHVIKSKTAVLFSAALEVSSLIAG  185 (322)
Q Consensus       107 il~GD~l~~~a~~~l~~~~~~~~~~~~~~~~~~l~~Gq~~d~~~~~~~~-~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag  185 (322)
T Consensus       100 INtANY~yFlalekV~qLdhP~a~kifteqLleLHrGQGldIYWRD~~tcPtee~Yk~Mv~~KTGGLF~La~rLMqlfS~  179 (322)
T KOG0777         100 INTANYMYFLALEKVSQLDHPNAIKIFTEQLLELHRGQGLDIYWRDFLTCPTEEMYKNMVMNKTGGLFRLALRLMQLFSH  179 (322)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             10357999999999972378118899999999985278850562113758878999999887415679999999999876


Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCHH
Q ss_conf             22210157999997311168988764112367000384012345421365321001101431100013432036899989
Q gi|254780755|r  186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVE  265 (322)
Q Consensus       186 ~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~~~~~~~~  265 (322)
T Consensus       180 ----~kedl~pl~n~LGl~fQIRDDY~NL~~keysenKsFaEDlTEGKfsFP~iHA~~t--~~q~~Qvl~ILrqRT~did  253 (322)
T KOG0777         180 ----HKEDLVPLINLLGLIFQIRDDYLNLKDKEYSENKSFAEDLTEGKFSFPIIHALKT--KGQTEQVLRILRQRTSDID  253 (322)
T ss_pred             ----CCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHCCCCHHHHHCCCCCCCCCHHHHHC--CCCHHHHHHHHHHHHCCCH
T ss_conf             ----3424788999876863004444031055411122066662047667711044650--7740999999998612403


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             99999999997496999999999999999998420899989999999
Q gi|254780755|r  266 NLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLME  312 (322)
Q Consensus       266 ~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k~~L~~  312 (322)
T Consensus       254 iKkyci~~LEd~gSf~YTrn~l~~L~a~a~~~i~~~g~Npyl~~L~~  300 (322)
T KOG0777         254 IKKYCIQILEDTGSFAYTRNFLNQLVAEARSMIKNDGENPYLPDLAS  300 (322)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             99999999997341798999999999999999982699955599998