HHsearch alignment for GI: 254780755 and conserved domain: TIGR02749

>TIGR02749 prenyl_cyano solanesyl diphosphate synthase; InterPro: IPR014120 This entry contains solanesyl diphosphate synthases from cyanobacteria or plastid-containing eukaryotes. A member from Arabidopsis (where both plastoquinone and ubiquinone contain the C(45) prenyl moiety) was characterised by heterologous expression as a solanesyl diphosphate synthase..
Probab=100.00  E-value=0  Score=594.10  Aligned_cols=316  Identities=33%  Similarity=0.476  Sum_probs=303.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---C---CCHHHHHHHHHHHHHHH
Q ss_conf             47999999999999999998607787589999999996798227999999999970---8---98578666655789999
Q gi|254780755|r    2 KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALML---E---YRGDNHVLLACAIEFIH   75 (322)
Q Consensus         2 ~~l~~~~~~~l~~v~~~i~~~~~~~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~---~---~~~~~~~~~a~~iEliH   75 (322)
T Consensus         4 ~~l~~pVe~dL~~l~~NLk~lvGa~HPiL~AAAEHLF~AGGKR~RPaiVLLvSrAT~~~~GlkElt~~HRRLAEITEmIH   83 (325)
T TIGR02749         4 TSLFAPVEDDLELLTDNLKSLVGARHPILYAAAEHLFSAGGKRLRPAIVLLVSRATAEEQGLKELTARHRRLAEITEMIH   83 (325)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHH
T ss_conf             78889999999999987787314568678999999871589654068999999998873666357610353133686775


Q ss_pred             HHHHHHHHHHCHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99987521101122001101210100110234312457888876421024311000123456777777545655421322
Q gi|254780755|r   76 TATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLD  155 (322)
Q Consensus        76 ~asLiHDDI~D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~~~~~~~~~l~~Gq~~d~~~~~~~~  155 (322)
T Consensus        84 TASLVHDDV~DEsd~RRG~~TVhs~F~trvAVLAGDFLFAQaSWYLANLenLEVVKLls~VI~DFAEGEI~Qg~~~FD~d  163 (325)
T TIGR02749        84 TASLVHDDVIDESDVRRGVETVHSLFGTRVAVLAGDFLFAQASWYLANLENLEVVKLLSKVITDFAEGEIKQGLNRFDSD  163 (325)
T ss_pred             HHHHHCCCEECCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             23222022003543448885534568481676204067899999986167721001454787564117888655525788


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCC
Q ss_conf             10357898998643355554432100011222210157999997311168988764112367000384012345421365
Q gi|254780755|r  156 VTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPT  235 (322)
Q Consensus       156 ~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~Dl~egk~T  235 (322)
T Consensus       164 ~~le~YleKSyYKTASL~AaSskaAAvLS~~~~~v~n~LY~yGkhLGLAFQvvDDiLDFTgsTe~LGKPagsDL~~GNlT  243 (325)
T TIGR02749       164 LSLEDYLEKSYYKTASLVAASSKAAAVLSDVDSKVANDLYEYGKHLGLAFQVVDDILDFTGSTEQLGKPAGSDLKKGNLT  243 (325)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCC
T ss_conf             78887665644678999999989988851143899999877656616335445545157788511567514343057851


Q ss_pred             CCCCHHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             32100110143110001343203689998999999999997496999999999999999998420899989999999999
Q gi|254780755|r  236 LPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVD  315 (322)
Q Consensus       236 lpii~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k~~L~~L~~  315 (322)
T Consensus       244 APvLfALE~~p~-----L~~LIer~F~~~~DLe~AL~lv~~~~aI~k~rELA~~~A~~A~~~L~~Lp~S~~r~aL~eLv~  318 (325)
T TIGR02749       244 APVLFALEEEPK-----LSELIEREFSQKGDLEQALELVRKSGAIKKARELAKEQAQLALQSLSVLPPSASREALKELVE  318 (325)
T ss_pred             HHHHHHHCCCCC-----CCHHHCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             579986237887-----201201113781457999999982372157899999999999986422789712578887331


Q ss_pred             HHHCCCC
Q ss_conf             9960379
Q gi|254780755|r  316 FCLQRLN  322 (322)
Q Consensus       316 ~ii~R~~  322 (322)
T Consensus       319 f~l~RL~  325 (325)
T TIGR02749       319 FVLERLY  325 (325)
T ss_pred             HEECCCC
T ss_conf             1001369