HHsearch alignment for GI: 254780755 and conserved domain: pfam00494

>pfam00494 SQS_PSY Squalene/phytoene synthase.
Probab=97.44  E-value=0.002  Score=40.77  Aligned_cols=141  Identities=23%  Similarity=0.228  Sum_probs=86.4

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             34567777775456554213221035789899864335555443210001122221015799999731116898876411
Q gi|254780755|r  134 SLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLD  213 (322)
Q Consensus       134 ~~~~~~l~~Gq~~d~~~~~~~~~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld  213 (322)
T Consensus        88 ~~~~~~li~g~~~Dl~~~~--~~t~~dL~~Y~~~vAg~Vg~l~~~i~----g~~~-~~~~~~~~A~~lG~AlQltNilRD  160 (262)
T pfam00494        88 REPFLELIDGMEMDLEKDR--YETLAELEEYCYRVAGVVGLLLLRLL----GVRD-DAEAADEAARHLGLALQLTNILRD  160 (262)
T ss_pred             HHHHHHHHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHH----CCCC-CHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999998736799--99999999999881689999999995----7789-458899999999999999999974


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             23670003840123454213653210011014311000134320368999899999999999749699999999999999
Q gi|254780755|r  214 YRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQK  293 (322)
Q Consensus       214 ~~g~~~~~GK~~g~Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~  293 (322)
T Consensus       161 i-----------~eD~~~gR~YLP~~~l~~~g~~-~----~~l~~-~~~~~-~~~~~---------~~~~~~~a~~~~~~  213 (262)
T pfam00494       161 V-----------GEDARRGRVYLPADWLARFGVS-P----EDLLR-GRASP-ELRAL---------IAELAARARAHLAE  213 (262)
T ss_pred             H-----------HHHHCCCCEECCHHHHHHCCCC-H----HHHHC-CCCCH-HHHHH---------HHHHHHHHHHHHHH
T ss_conf             6-----------9998399277888999885999-9----99736-67999-99999---------99999999999999


Q ss_pred             HHHHHHCCCCCHHHH
Q ss_conf             999842089998999
Q gi|254780755|r  294 AKDSLRCLPDSSWKK  308 (322)
Q Consensus       294 A~~~L~~lp~~~~k~  308 (322)
T Consensus       214 a~~~~~~l~p~~~r~  228 (262)
T pfam00494       214 ARALLALLPPRRARL  228 (262)
T ss_pred             HHHHHHHCCCHHHHH
T ss_conf             999885389876789