HHsearch alignment for GI: 254780755 and conserved domain: pfam07307

>pfam07307 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1. This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (EC:2.5.1.30) (approximately 230 residues long). The enzyme consists of two subunits, both of which are required for catalysis of heptaprenyl diphosphate synthesis.
Probab=96.98  E-value=0.018  Score=34.87  Aligned_cols=109  Identities=18%  Similarity=0.238  Sum_probs=74.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHH
Q ss_conf             89857866665578999999987521101122001101210100110234312457888876421024311000123456
Q gi|254780755|r   58 EYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVA  137 (322)
Q Consensus        58 ~~~~~~~~~~a~~iEliH~asLiHDDI~D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~~~~~~~  137 (322)
T Consensus        29 ~~~~~~~~~~i~t~mLvq~aLDTHd~V~~~~~~~~~---~~k~--RQLtVLAGDyyS~lYY~lLa~~~~i~lIr~la~~I  103 (212)
T pfam07307        29 ELTPEQAERYILTAMLVQIALDTHDKVSNANAETQE---TKKN--RQLTVLAGDYYSGLYYYLLSESGDIALIRLLAEAI  103 (212)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCH---HHHH--HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             999899999999999999998778764542312103---5563--10320110233189999998379869999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             7777775456554213221035789899864335555
Q gi|254780755|r  138 CTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFS  174 (322)
Q Consensus       138 ~~l~~Gq~~d~~~~~~~~~s~~~y~~ii~~KTa~Lf~  174 (322)
T Consensus       104 ~eiNe~Ki~lY---q~~~~~~e~~~~sv~~iESaL~~  137 (212)
T pfam07307       104 KEINEHKIRLY---QKKVETFEELMESVKTIESALFA  137 (212)
T ss_pred             HHHHHHHHHHH---HHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999999---84038899999999999999999