HHsearch results for GI: 254780755 and protein with PDBid: 1rqj_A

>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A*
Probab=100.00  E-value=0  Score=448.91  Aligned_cols=279  Identities=28%  Similarity=0.433  Sum_probs=238.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCC---CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999986077---8758999999999679822799999999997089857866665578999999987
Q gi|254780755|r    4 LEDLTLKDMEKVNFLILKRICS---DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLL   80 (322)
Q Consensus         4 l~~~~~~~l~~v~~~i~~~~~~---~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iEliH~asLi   80 (322)
                      +.+.+....++|++.+.+.+..   ..+++.++++|.+.+||||+||++++++++++|++.+.++++|+++|++|+||||
T Consensus         3 ~~~~l~~~~~~i~~~l~~~~~~~~~~~~~l~e~~~y~~~~gGKrlRp~l~l~~~~~~g~~~~~~~~~A~aiEllH~asLI   82 (299)
T 1rqj_A            3 FPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLI   82 (299)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTSSSTTSHHHHHHHHHHHSSCCCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             49999999999999999987626788807999999987179751889999999988099867899999999999999999


Q ss_pred             HHHHHC--HHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCC-----CHHHH-----HHHHHHHHHHHHHH
Q ss_conf             521101--1220011012101001102343124578888764210243110-----00123-----45677777754565
Q gi|254780755|r   81 HDDVVD--DSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA-----LEALS-----LVACTLAEGELRQL  148 (322)
Q Consensus        81 HDDI~D--~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~-----~~~~~-----~~~~~l~~Gq~~d~  148 (322)
                      ||||+|  ++++|||+||+|++||++.||++||++++.++..++..+++.+     +..+.     ..+..+++||.+|+
T Consensus        83 hDDI~D~d~~~~RRG~pt~h~~~G~~~AIl~Gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GQ~lDl  162 (299)
T 1rqj_A           83 HDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDL  162 (299)
T ss_dssp             HHTSTTTTCCCEETTEECHHHHHCHHHHHHHHHHHHHHHHHHHHHSCCTTCCHHHHHHHHHHHHHHHSTTTHHHHHHHHH
T ss_pred             HHCCCCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             80560245221003698501131620666651177889999998578953337899999999999875999999999999


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHH
Q ss_conf             5421322103578989986433555544321000112-222101579999973111689887641123670003840123
Q gi|254780755|r  149 SLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG-VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGE  227 (322)
Q Consensus       149 ~~~~~~~~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag-~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~  227 (322)
                      .+..+ ..++++|++|+++|||+||.+++.+|++++| .+++..+.+++||.++|+||||+||++|++|+++.+|||.|+
T Consensus       163 ~~~~~-~~~~~~y~~i~~~KTa~l~~~~~~~~a~~~~~~~~~~~~~~~~~g~~lG~afQi~DD~lD~~~~~~~~GK~~g~  241 (299)
T 1rqj_A          163 DAEGK-HVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGA  241 (299)
T ss_dssp             HTTTT-CCCHHHHHHHHHHHTHHHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHSSCTTH
T ss_pred             HHCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCHHHHCCCHHH
T ss_conf             81178-99999999999999999999999988998454056899999998899999998510877622888660996514


Q ss_pred             HHHHCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCC-CHH
Q ss_conf             4542136532100110143110001343203689998999999999997496999999999999999998420899-989
Q gi|254780755|r  228 DFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD-SSW  306 (322)
Q Consensus       228 Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~-~~~  306 (322)
                      |+++||+|||+++++++                                      ++...+++.+++++.|+.+++ +..
T Consensus       242 Dl~egk~Tlp~i~ale~--------------------------------------a~~~~~~l~~~a~~~l~~l~~~~~~  283 (299)
T 1rqj_A          242 DQQLGKSTYPALLGLEQ--------------------------------------ARKKARDLIDDARQSLKQLAEQSLD  283 (299)
T ss_dssp             HHHHTCCCHHHHHCHHH--------------------------------------HHHHHHHHHHHHHHHHHHHHTTTCC
T ss_pred             HHHCCCCCHHHHHHHHH--------------------------------------HHHHHHHHHHHHHHHHHHHHCCCHH
T ss_conf             87759853999999998--------------------------------------5999999999999999861223421


Q ss_pred             HHHHHHHHHHHHCCC
Q ss_conf             999999999996037
Q gi|254780755|r  307 KKSLMEVVDFCLQRL  321 (322)
Q Consensus       307 k~~L~~L~~~ii~R~  321 (322)
                      ++.|..+++|+++|.
T Consensus       284 ~~~L~~l~~~i~~R~  298 (299)
T 1rqj_A          284 TSALEALADYIIQRN  298 (299)
T ss_dssp             CHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             899999999998678