HHsearch results for GI: 254780755 and protein with PDBid: 1rtr_A

>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1
Probab=100.00  E-value=0  Score=451.21  Aligned_cols=276  Identities=29%  Similarity=0.411  Sum_probs=243.3

Q ss_pred             HHHHHHHHHHHHHHHCCCC--CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999860778--75899999999967982279999999999708985786666557899999998752110
Q gi|254780755|r    8 TLKDMEKVNFLILKRICSD--VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVV   85 (322)
Q Consensus         8 ~~~~l~~v~~~i~~~~~~~--~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iEliH~asLiHDDI~   85 (322)
                      +.+.+++|++.|...+...  ++.+.+++.|++.+||||+||.||+++++++|++.+.++++|+++||+|+||||||||+
T Consensus         6 ~~~~~~~i~~~l~~~~~~~~~~~~l~~~~~y~l~~GGKr~Rp~L~l~~~~~~~~~~~~~~~~A~aiEllH~asLIhDDI~   85 (301)
T 1rtr_A            6 MNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTEYELGMKSAIALEMIHTYSLIHDDLP   85 (301)
T ss_dssp             HHHHHHHHHHHHHTSSCCCSSCCSHHHHHHHHHTSCCCCHHHHHHHHHHHHTTSCGGGGHHHHHHHHHHHHHHHHHHHST
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999861135887899999988739974786999999998849975889999999999999999972773


Q ss_pred             C--HHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCH--------HHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             1--122001101210100110234312457888876421024311000--------123456777777545655421322
Q gi|254780755|r   86 D--DSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE--------ALSLVACTLAEGELRQLSLSKNLD  155 (322)
Q Consensus        86 D--~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~--------~~~~~~~~l~~Gq~~d~~~~~~~~  155 (322)
                      |  ++..|||+||+|.+||++.||++||++++.++.+++...+.....        .++.....+++||++|+.+.. ..
T Consensus        86 D~d~~~~RRg~~~~~~~~g~~~ail~gd~l~~~a~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~GQ~lDl~~~~-~~  164 (301)
T 1rtr_A           86 AMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAFELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEG-QP  164 (301)
T ss_dssp             TTTCCSEETTEECHHHHHCHHHHHHHHHHHHHHHHHHHHTCTTSCHHHHHHHHHHHHHHHSTTTHHHHHHHHHHTTT-SC
T ss_pred             CCCCCCCCCCCCCHHHHHHCCCHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CC
T ss_conf             35877422456547887521312653771788999999853430278999999999998659999876999998248-99


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCC
Q ss_conf             10357898998643355554432100011222210157999997311168988764112367000384012345421365
Q gi|254780755|r  156 VTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPT  235 (322)
Q Consensus       156 ~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~Dl~egk~T  235 (322)
                      +++++|+.|+++|||+||++|+.+||+++|++++..+.+.+||.++|+||||+||++|++|+++.+|||+|+||++||+|
T Consensus       165 ~~~~~y~~i~~~KT~~l~~~~~~~ga~l~~~~~~~~~~l~~~g~~lGiafQi~DD~lD~~gd~~~~GK~~g~Dl~egK~T  244 (301)
T 1rtr_A          165 IDLETLEMIHKTKTGALLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLENNKST  244 (301)
T ss_dssp             CCHHHHHHHHHHHTHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-------------CC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCHHHHCCCHHHHHHCCCCC
T ss_conf             99999999999999999999999999871573777999999998722101223088773488888599842387759862


Q ss_pred             CCCCHHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             32100110143110001343203689998999999999997496999999999999999998420899989999999999
Q gi|254780755|r  236 LPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVD  315 (322)
Q Consensus       236 lpii~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k~~L~~L~~  315 (322)
                      ||++++++.                                      +.+.+..+.+++.+.|..+++....+.|.++++
T Consensus       245 l~~i~a~~~--------------------------------------a~~~~~~~~~~a~~~l~~~~~~~~~~~l~el~~  286 (301)
T 1rtr_A          245 YVSLLGKDG--------------------------------------AEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVD  286 (301)
T ss_dssp             HHHHHHHHH--------------------------------------HHHHHHHHHHHHHHHHHTSCTTSCCHHHHHHHH
T ss_pred             HHHHHHHHH--------------------------------------HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             999999999--------------------------------------999999999999999986757255999999999


Q ss_pred             HHHCCCC
Q ss_conf             9960379
Q gi|254780755|r  316 FCLQRLN  322 (322)
Q Consensus       316 ~ii~R~~  322 (322)
                      |+++|-|
T Consensus       287 ~i~~R~~  293 (301)
T 1rtr_A          287 LFYSRDH  293 (301)
T ss_dssp             HHHCC--
T ss_pred             HHHHHHC
T ss_conf             9996426