HHsearch results for GI: 254780755 and protein with PDBid: 2h8o_A

>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str}
Probab=100.00  E-value=0  Score=453.67  Aligned_cols=281  Identities=26%  Similarity=0.408  Sum_probs=244.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCC--------CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             94799999999999999999860778--------7589999999996798227999999999970898578666655789
Q gi|254780755|r    1 MKMLEDLTLKDMEKVNFLILKRICSD--------VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIE   72 (322)
Q Consensus         1 ~~~l~~~~~~~l~~v~~~i~~~~~~~--------~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iE   72 (322)
                      |..+...+++...+|++.+.+.+...        ++.+.++++|.+.+||||+||+||+++++++|++.+.++++|+++|
T Consensus        36 ~~~~~~~l~~~~~~ve~~l~~~l~~~~~~~~~~~p~~l~~a~~y~~~~GGKrlRp~L~l~~~~~~g~~~~~~~~~AaaiE  115 (335)
T 2h8o_A           36 MTNFETRLRENAAKTEALLGHLLSGEARADEITRPQNLLEAMRHGVLNGGKRLRPFLVIESVALLGGDAEAGLHVGAALE  115 (335)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTCSSCCTTCCCCCHHHHHHHHHHHHTSCSCHHHHHHHHHHHHTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             76799999999999999999866752344445798789999999862684109999999999982998789999999999


Q ss_pred             HHHHHHHHHHHHH--CHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH---------HH
Q ss_conf             9999998752110--112200110121010011023431245788887642102431100012345677---------77
Q gi|254780755|r   73 FIHTATLLHDDVV--DDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACT---------LA  141 (322)
Q Consensus        73 liH~asLiHDDI~--D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~~~~~~~~~---------l~  141 (322)
                      |||+||||||||+  |+|++|||+||+|++||+++|||+||+|++.+|++++..++..........+..         ++
T Consensus       116 liH~aSLIHDDI~~mD~~~~RRG~pt~h~~~G~~~AIlaGD~L~~~a~~~l~~~~~~~~~~~~~~~i~~l~~~~~~~g~~  195 (335)
T 2h8o_A          116 CLHCYSLVHDDLPAMDDDDLRRGQPTVHRKFDEATAILAGDSLLTLAFDIIASDDNPLAAERKAALVISLARAAGIGGMA  195 (335)
T ss_dssp             HHHHHHHHHHTSTTTTCCSEETTEECHHHHSCHHHHHHHHHHHHHHHHHHHHSTTSCSCHHHHHHHHHHHHHHHSTTSHH
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999779876887633389865030518599999999999988899885122046788899999999999998886


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             77545655421322103578989986433555544321000112222101579999973111689887641123670003
Q gi|254780755|r  142 EGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEM  221 (322)
Q Consensus       142 ~Gq~~d~~~~~~~~~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~  221 (322)
                      .||..+.. ..+...++++|++|+++|||+||++||.+|++++|++++..+.+.+||+++|+||||+||++|++|+++.+
T Consensus       196 ~~~~~~~~-~~~~~~~~~~~~~i~~~KTg~L~~~a~~~ga~l~~~~~~~~~~l~~~g~~lGlAFQI~DDilD~~gd~~~~  274 (335)
T 2h8o_A          196 GGQALDLA-AEKKAPDEDGIITLQAMKTGALLRFACEAGAIIAGSNQAERQRLRLFGEKIGLSFQLADDLLDLTADAATM  274 (335)
T ss_dssp             HHHHHHHH-HHHSCCCHHHHHHHHHHHTHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC------
T ss_pred             HHHHHHHH-HCCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             46888876-30454248999876202477989989998898804616799999999986302677555766511898886


Q ss_pred             CCHHHHHHHHCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             84012345421365321001101431100013432036899989999999999974969999999999999999984208
Q gi|254780755|r  222 GKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL  301 (322)
Q Consensus       222 GK~~g~Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~l  301 (322)
                      |||+|+|+++||+|||++++++                                      .+++.++++.++|++.|+.+
T Consensus       275 GK~~g~Dl~~gK~T~~~l~gle--------------------------------------~a~~~~~~~~~~a~~~l~~~  316 (335)
T 2h8o_A          275 GKATGKDAARGKGTLVALRGEA--------------------------------------WAREKLQEQVAEASELLAPY  316 (335)
T ss_dssp             -----------CCCHHHHHCHH--------------------------------------HHHHHHHHHHHHHHHHTGGG
T ss_pred             CCCHHHHHHCCCCCHHHHHHHH--------------------------------------HHHHHHHHHHHHHHHHHHHC
T ss_conf             9862278875985399999899--------------------------------------99999999999999988756


Q ss_pred             CCCHHHHHHHHHHHHHHCCCC
Q ss_conf             999899999999999960379
Q gi|254780755|r  302 PDSSWKKSLMEVVDFCLQRLN  322 (322)
Q Consensus       302 p~~~~k~~L~~L~~~ii~R~~  322 (322)
                      +..  .+.|.++++|+++|.|
T Consensus       317 ~~~--~~~L~~l~~~i~~R~~  335 (335)
T 2h8o_A          317 GEK--AAILIAAARFIAERKS  335 (335)
T ss_dssp             GGG--GHHHHHHHHHHHC---
T ss_pred             CHH--HHHHHHHHHHHHHCCC
T ss_conf             735--8999999999987679