HHsearch results for GI: 254780755 and protein with PDBid: 2q80_A

>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural genomics, structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1
Probab=100.00  E-value=0  Score=503.28  Aligned_cols=289  Identities=21%  Similarity=0.277  Sum_probs=268.4

Q ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHCCCCHHHCCCHH
Q ss_conf             87589999999996798227999999999970898578666655789999999875211011220011012101001102
Q gi|254780755|r   26 DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQT  105 (322)
Q Consensus        26 ~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iEliH~asLiHDDI~D~~~~RRg~~t~~~~~G~~~  105 (322)
                      ....+.++++|++.+||||+||.|++++++++|++.+.+..+|+++|++|+||||||||||+|++|||+||+|++||++.
T Consensus         9 ~~~~l~e~~~y~~~~gGKr~Rp~L~~~~~~~~~~~~~~~~~~a~aiEllH~asLIHDDI~D~s~~RRG~pt~h~~~G~~~   88 (301)
T 2q80_A            9 VQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPS   88 (301)
T ss_dssp             HHHHHTHHHHHHTTSSCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCSEETTEECHHHHHCHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHCCHHH
T ss_conf             02799999999985899629999999999881998899999999999999999982764679988899997120057388


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             34312457888876421024311000123456777777545655421322-10357898998643355554432100011
Q gi|254780755|r  106 SVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLD-VTEEDYLHVIKSKTAVLFSAALEVSSLIA  184 (322)
Q Consensus       106 Ail~GD~l~~~a~~~l~~~~~~~~~~~~~~~~~~l~~Gq~~d~~~~~~~~-~s~~~y~~ii~~KTa~Lf~~~~~~ga~la  184 (322)
                      |||+||||+++++..+++.+++++++.+++++.++++||.+|+.+..+.. .++++|++|+.+|||+||++||.+|++++
T Consensus        89 Ail~Gd~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~Gq~ld~~~~~~~~~~s~~~y~~~i~~KTa~Lf~~~~~~ga~~~  168 (301)
T 2q80_A           89 VINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFS  168 (301)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCTTHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998899988887641012489999999999998705045877640256676999999998726999999988877642


Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCH
Q ss_conf             22221015799999731116898876411236700038401234542136532100110143110001343203689998
Q gi|254780755|r  185 GVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISV  264 (322)
Q Consensus       185 g~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~~~~~~~  264 (322)
                      |.++    .+.+||+++|+||||+||++|++|+++.+|||+|+||++||+|||+++|++..+  ++..+..++.+...++
T Consensus       169 ~~~e----~l~~~g~~lG~afQi~DD~lD~~~~~~~~GK~~g~Dl~~gk~Tlpvi~al~~~~--~~~~l~~~l~~~~~~~  242 (301)
T 2q80_A          169 DYKE----DLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRP--ESTQVQNILRQRTENI  242 (301)
T ss_dssp             CCCS----CCHHHHHHHHHHHHHHHHHHHHHCC------CTTHHHHHTCCCHHHHHHHHHST--TCCHHHHHHHHTCCCH
T ss_pred             HHHH----HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHCCCCHHHHHHHHHCCC--CHHHHHHHHHCCCCCH
T ss_conf             3568----999999999999986588786018853348871118776983099999988298--3799999985667998


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHH-HHHHHHHCC
Q ss_conf             99999999999749699999999999999999842089998999999-999999603
Q gi|254780755|r  265 ENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM-EVVDFCLQR  320 (322)
Q Consensus       265 ~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k~~L~-~L~~~ii~R  320 (322)
                      +.+++++++++++|++++++.++..|.++|++.|+.+|.++.++.|. .|+.++..|
T Consensus       243 ~~~~~i~~~l~~~ga~~~~~~~~~~~~~~A~~~l~~l~~~~~~~~L~~~l~~~~~~r  299 (301)
T 2q80_A          243 DIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEE  299 (301)
T ss_dssp             HHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHTTCC--
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHC
T ss_conf             999999999998695999999999999999999970999989999999999999854