HHsearch results for GI: 254780755 and protein with PDBid: 3llw_A

>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori}
Probab=100.00  E-value=0  Score=391.37  Aligned_cols=253  Identities=24%  Similarity=0.363  Sum_probs=211.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH---CCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC------CHHHHHHHHHHHH
Q ss_conf             479999999999999999986---0778758999999999679822799999999997089------8578666655789
Q gi|254780755|r    2 KMLEDLTLKDMEKVNFLILKR---ICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY------RGDNHVLLACAIE   72 (322)
Q Consensus         2 ~~l~~~~~~~l~~v~~~i~~~---~~~~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~------~~~~~~~~a~~iE   72 (322)
                      +++ ....++.+++++.+.+.   +.+.+|.+.++++|++.+||||+||.+|++++.++++      +.+.++++|+++|
T Consensus         6 ~~~-~~~~~~~~~~~~~l~~~~~~~~~~~p~l~~~~~~~~~~GGKr~Rp~l~l~~~~al~g~~~~~~~~~~~~~lA~aiE   84 (311)
T 3llw_A            6 PNL-SFYYNECERFESFLKNHHLHLESFHPYLEKAFFEMVLNGGKRFRPKLFLAVLCALVGQKDYSNQQTEYFKIALSIE   84 (311)
T ss_dssp             HHH-HHHHHHHHHHHHHHHTCCCCCCSSCSSHHHHHHHHHHSCCCCHHHHHHHHHHHHHSCHHHHHHSHHHHHHHHHHHH
T ss_pred             CCH-HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             546-8999999999999997366405778179999999985898513499999999986487645765799999999999


Q ss_pred             HHHHHHHHHHHH--HCHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH-------HHHHHHHHH
Q ss_conf             999999875211--01122001101210100110234312457888876421024311000123-------456777777
Q gi|254780755|r   73 FIHTATLLHDDV--VDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALS-------LVACTLAEG  143 (322)
Q Consensus        73 liH~asLiHDDI--~D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~~~~-------~~~~~l~~G  143 (322)
                      ++|+||||||||  ||+|++|||+||+|++||+..||++||++++.++.++....+........       .....+..|
T Consensus        85 LlH~asLIhDDI~~mD~s~~RRG~pt~h~~~g~~~ai~~gd~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (311)
T 3llw_A           85 CLHTYSLIHDDLPCMDNAALRRNHPTLHAKYDETTAVLIGDALNTYSFELLSNALLESHIIVELIKILSANGGIKGMILG  164 (311)
T ss_dssp             HHHHHHHHHHTSTTTTCCSEETTEECHHHHTCHHHHHHHHHHHHHHHHHHHHHSCSCHHHHHHHHHHHHHHHSTTTHHHH
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999808602466545799876545432289998652888889999873132047899999999999999999889


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             54565542132210357898998643355554432100011222-21015799999731116898876411236700038
Q gi|254780755|r  144 ELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQ-NSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMG  222 (322)
Q Consensus       144 q~~d~~~~~~~~~s~~~y~~ii~~KTa~Lf~~~~~~ga~lag~~-~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~G  222 (322)
                      |..+..+.. ...+++.|..++..||+++|.+++.+|+++++.. ++..+.+++||.++|+||||+||++|++|+++.+|
T Consensus       165 ~~~~~~~~~-~~~~~~~~~~~~~~Kt~~l~~~~~~~~~~~~~~~~~~~~~~l~~~g~~lGiaFQi~DD~lD~~gd~~~~G  243 (311)
T 3llw_A          165 QALDCYFEN-TPLNLEQLTFLHEHKTAKLISASLIMGLVASGIKDEELFKWLQAFGLKMGLCFQVLDDIIDVTQDEEESG  243 (311)
T ss_dssp             HHHHHHTTT-SCCCHHHHHHHHHHHTHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------
T ss_pred             HHHHHHCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHC
T ss_conf             998874125-7899999999998588999899999999886354378999999999998998973798885348888868


Q ss_pred             CHHHHHHHHCCCCCCCCHHHHCCCCCCCHHHHHHCC
Q ss_conf             401234542136532100110143110001343203
Q gi|254780755|r  223 KNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTIN  258 (322)
Q Consensus       223 K~~g~Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~  258 (322)
                      |+.+.|  +||+|||++++++++++..++.+.++++
T Consensus       244 K~~~~D--~gK~T~~~i~a~~~a~~~~~~~l~~~~~  277 (311)
T 3llw_A          244 KTTHLD--SAKNSFVNLLGLERANNYAQTLKTEVLN  277 (311)
T ss_dssp             ---------CCSCHHHHHCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             886877--8727799999999728999999999998