HHsearch results for GI: 254780755 and protein with PDBid: 3lom_A

>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp}
Probab=100.00  E-value=0  Score=419.82  Aligned_cols=279  Identities=27%  Similarity=0.371  Sum_probs=229.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHC---CCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999860---778758999999999679822799999999997089857866665578999999987
Q gi|254780755|r    4 LEDLTLKDMEKVNFLILKRI---CSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLL   80 (322)
Q Consensus         4 l~~~~~~~l~~v~~~i~~~~---~~~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iEliH~asLi   80 (322)
                      ..+.+.+..++++..+.+.+   ....|.+.+++.|.+.+||||+||.+++++++++|++.+.++.+|+|+|++|+||||
T Consensus         9 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~y~~~~GGKr~Rp~l~l~~~~~~~~~~~~~~~~A~aiEllH~asLI   88 (313)
T 3lom_A            9 NKQVIDKYTQRHELYLEQLLNEIIIPAPQIRSALHYALFSGGKRIRPILVYLAGDLIDVDQGVLDIIAAALELTHCYSLI   88 (313)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTSCCCCHHHHHHHHHHHCCSSCCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999987635798478999999887079641999999999998598888999999999999999997


Q ss_pred             HHHH--HCHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC--------CCCHHHH--HHHHHHHHHHHHHH
Q ss_conf             5211--0112200110121010011023431245788887642102431--------1000123--45677777754565
Q gi|254780755|r   81 HDDV--VDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ--------EALEALS--LVACTLAEGELRQL  148 (322)
Q Consensus        81 HDDI--~D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~--------~~~~~~~--~~~~~l~~Gq~~d~  148 (322)
                      ||||  ||+|++|||+||+|.+||+..||++||++++.++..+......        .....+.  .....+++||..|+
T Consensus        89 HDDI~~mD~s~~RRG~pt~h~~~g~~~Ai~~gd~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~g~~~d~  168 (313)
T 3lom_A           89 HDDLPAMDNDDLRRGKPSCHKAFDEATAILVGDGMQALAIEVLLMRLSPLLPAAQVVAITQVLVNASGISGMVSGQSLDL  168 (313)
T ss_dssp             HHHSTTTTCCSEETTEECHHHHSCHHHHHHHHHHHHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHHSTTTHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             47740358764456797577886548889875568899988753310122538889999999999730034214404677


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHH
Q ss_conf             542132210357898998643355554432-1000112222101579999973111689887641123670003840123
Q gi|254780755|r  149 SLSKNLDVTEEDYLHVIKSKTAVLFSAALE-VSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGE  227 (322)
Q Consensus       149 ~~~~~~~~s~~~y~~ii~~KTa~Lf~~~~~-~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~  227 (322)
                      .+..+...+.++|++|+++|||+||.++|. +|+++++.+++..+.+.+||+++|+||||+||++|++|+++.+|||+|+
T Consensus       169 ~~~~~~~~~~~~y~~i~~~KT~~l~~~~~~~~~~~~~~~~~~~~~~l~~~g~~lG~aFQi~DD~lD~~gd~~~~GK~~g~  248 (313)
T 3lom_A          169 SELAKSSVTEEQLREIHLLKTGKLILACFEMVLAAQHEVSEQIKSALRTYGKHIGLVFQMQDDYLDLYAPTQILGKGRSS  248 (313)
T ss_dssp             HTTTSSCCCHHHHHHHHHHHTHHHHHHHHHHHHTTCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----------
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCHHHHCCCCCH
T ss_conf             77740468899999999985377988779999998443227899999999999998802321421024898886998112


Q ss_pred             HHHHCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             45421365321001101431100013432036899989999999999974969999999999999999984208999899
Q gi|254780755|r  228 DFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWK  307 (322)
Q Consensus       228 Dl~egk~Tlpii~al~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k  307 (322)
                      |+++||+|||++++++.+.                                      +....+.+++.+.++.++..  .
T Consensus       249 Di~egK~T~~~i~~~~~a~--------------------------------------~~~~~~~~~~~~~l~~~~~~--~  288 (313)
T 3lom_A          249 DQANQKTTFATLFNKQQLE--------------------------------------EEIAVHYQIAMDSLRLFGSK--A  288 (313)
T ss_dssp             -----CCCHHHHSCHHHHH--------------------------------------HHHHHHHHHHHHTTTTTGGG--G
T ss_pred             HHHCCCCHHHHHHHHHHHH--------------------------------------HHHHHHHHHHHHHHHHCCCC--H
T ss_conf             7775971699999999879--------------------------------------99999999999987757821--8


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             999999999960379
Q gi|254780755|r  308 KSLMEVVDFCLQRLN  322 (322)
Q Consensus       308 ~~L~~L~~~ii~R~~  322 (322)
                      ..|.++++++.+|.|
T Consensus       289 ~~L~el~~~i~~R~n  303 (313)
T 3lom_A          289 AALIELTKQLQNRSN  303 (313)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             999999999997207