BLAST/PSIBLAST alignment of GI: 254780755 and GI: 254701208 at iteration 1
>gi|254701208|ref|ZP_05163036.1| hypothetical protein Bsuib55_10162 [Brucella suis bv. 5 str. 513] Length = 338
 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 236/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 20  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 79

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 80  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 139

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 140 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 199

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 200 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 259

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++RA+ DT  RA  +G+ A+D+L  L  
Sbjct: 260 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHRAIADTVQRARHFGEIARDALAPLKA 319

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 320 SPQKDALIEVVDFCISRVN 338