BLAST/PSIBLAST alignment of GI: 254780755 and GI: 86356521 at iteration 1
>gi|86356521|ref|YP_468413.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CFN 42] Length = 346
>gi|86280623|gb|ABC89686.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CFN 42] Length = 346
 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/322 (59%), Positives = 247/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A + +YR
Sbjct: 25  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASLFDYR 84

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 85  GDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 144

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 145 MVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVG 204

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 205 PIVAEAGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 264

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  S  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 265 AYRRGTEDERAFWRDAIEAGNSSDANLEKALGLITKYGTLADTIGRAIHYGTIARDALAP 324

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK +LMEV+DFC++R+N
Sbjct: 325 LPDTVWKSALMEVIDFCIERVN 346