BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780755|ref|YP_003065168.1| octaprenyl-diphosphate
synthase protein [Candidatus Liberibacter asiaticus str. psy62]
         (322 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780755|ref|YP_003065168.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040432|gb|ACT57228.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 322

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/322 (100%), Positives = 322/322 (100%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR
Sbjct: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM
Sbjct: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS
Sbjct: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL
Sbjct: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC
Sbjct: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPDSSWKKSLMEVVDFCLQRLN
Sbjct: 301 LPDSSWKKSLMEVVDFCLQRLN 322


>gi|315121918|ref|YP_004062407.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495320|gb|ADR51919.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 322

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/322 (83%), Positives = 296/322 (91%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           MKMLE LT+KDM KVN LI+ RICS+V +IPDVVKYLIFSGGKRLRPMLT+ATALMLEYR
Sbjct: 1   MKMLEALTVKDMNKVNLLIMDRICSNVTIIPDVVKYLIFSGGKRLRPMLTVATALMLEYR 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NHVLLACAIEFIHTATLLHDDVVDDSALRRGK AARLVWGNQ SVLVGDFLLSQAF M
Sbjct: 61  GNNHVLLACAIEFIHTATLLHDDVVDDSALRRGKAAARLVWGNQASVLVGDFLLSQAFSM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           VIETKSQEAL+ LSLVACTL+EGELRQLS+SKNL+VTEEDYL+VIKSKTA LF AALEVS
Sbjct: 121 VIETKSQEALKVLSLVACTLSEGELRQLSISKNLNVTEEDYLYVIKSKTAALFVAALEVS 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           SLI+G Q+SVR ALKSYG NLGIAFQLVDD LDYRGEVNEMGKNIG+DFRNGKPTLPVIL
Sbjct: 181 SLISGAQDSVRDALKSYGTNLGIAFQLVDDALDYRGEVNEMGKNIGDDFRNGKPTLPVIL 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AFQR T +EKNFW+STI DG+ISVENL+KA I+++E  ALVDT+ +AY YGQKAKDSL+ 
Sbjct: 241 AFQRATNQEKNFWRSTIGDGEISVENLQKALIMIQECNALVDTKSQAYYYGQKAKDSLQD 300

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP++ WK SL+EVVDFCLQRL+
Sbjct: 301 LPNNPWKASLIEVVDFCLQRLD 322


>gi|222085054|ref|YP_002543583.1| octaprenyl-diphosphate synthase protein [Agrobacterium radiobacter
           K84]
 gi|221722502|gb|ACM25658.1| octaprenyl-diphosphate synthase protein [Agrobacterium radiobacter
           K84]
          Length = 455

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/322 (59%), Positives = 250/322 (77%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V ++LI SGGKRLRPMLT+A+A +  Y+
Sbjct: 134 IKPLVDLTKADMERVNQLILSKAGSDVQMIPEVAEHLISSGGKRLRPMLTIASAALYNYQ 193

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 194 GDNHIKLATSVEFLHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 253

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S EAL+ LS  AC +AEGE+ QLS+SKN++ TE+DYL VI++KTA LFSAA EV 
Sbjct: 254 MVEVGSLEALDVLSSAACVIAEGEVLQLSVSKNMETTEDDYLSVIRAKTAALFSAAAEVG 313

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYG NLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 314 PIVANAGKAERNALKSYGTNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 373

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT++E+ FW+  I  G  S ENL+KA  ++ +  AL DT  RA  YG  A+D+L  
Sbjct: 374 AYRRGTEKERAFWREAIETGNNSDENLEKALGLITKYGALNDTIARAVHYGTIARDALAP 433

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP++ WK +LMEV+DFC++R+N
Sbjct: 434 LPETPWKSALMEVIDFCIERVN 455


>gi|86356521|ref|YP_468413.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CFN 42]
 gi|86280623|gb|ABC89686.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CFN 42]
          Length = 346

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/322 (59%), Positives = 247/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A + +YR
Sbjct: 25  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASLFDYR 84

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 85  GDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 144

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 145 MVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVG 204

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 205 PIVAEAGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 264

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  S  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 265 AYRRGTEDERAFWRDAIEAGNSSDANLEKALGLITKYGTLADTIGRAIHYGTIARDALAP 324

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK +LMEV+DFC++R+N
Sbjct: 325 LPDTVWKSALMEVIDFCIERVN 346


>gi|327192818|gb|EGE59745.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CNPAF512]
          Length = 338

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/322 (59%), Positives = 247/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A + +YR
Sbjct: 17  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASLFDYR 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NHV LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GENHVKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVAEAGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  S  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 AYRRGTEDERAFWRDAIEAGNSSDANLEKALGLITKYGTLADTIGRAVHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK +LMEV+DFC++R+N
Sbjct: 317 LPDTVWKSALMEVIDFCIERVN 338


>gi|190890586|ref|YP_001977128.1| octaprenyl-diphosphate synthase [Rhizobium etli CIAT 652]
 gi|190695865|gb|ACE89950.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CIAT 652]
          Length = 346

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/322 (59%), Positives = 247/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A + +YR
Sbjct: 25  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASLFDYR 84

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NHV LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 85  GENHVKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 144

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 145 MVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLAVIRAKTAALFAAAAEVG 204

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 205 PIVAEAGKSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 264

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  S  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 265 AYRRGTEDERAFWRDAIEAGNSSDANLEKALGLITKYGTLADTIGRAVHYGTIARDALAP 324

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK +LMEV+DFC++R+N
Sbjct: 325 LPDTVWKSALMEVIDFCIERVN 346


>gi|116250711|ref|YP_766549.1| octaprenyl-diphosphate synthase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255359|emb|CAK06434.1| putative octaprenyl-diphosphate synthase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 338

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 249/322 (77%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA+A + +YR
Sbjct: 17  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASASLFDYR 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GENHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A V  S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVAEVGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  +  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 AYRRGTEDERAFWRDAIEAGNSTDANLEKALGLITKYGTLSDTIGRAIHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK +LMEV+DFC++R+N
Sbjct: 317 LPDTVWKSALMEVIDFCIERVN 338


>gi|209548129|ref|YP_002280046.1| polyprenyl synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533885|gb|ACI53820.1| Polyprenyl synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 338

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/322 (59%), Positives = 247/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A + +YR
Sbjct: 17  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASLFDYR 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NHV LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GENHVKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSSAACIIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVAEAGKSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  +  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 AYRRGTEDERAFWRDAIEAGNSTDANLEKALGLITKYGTLSDTIGRAVHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK SLMEV+DFC++R+N
Sbjct: 317 LPDTVWKSSLMEVIDFCIERVN 338


>gi|254701208|ref|ZP_05163036.1| hypothetical protein Bsuib55_10162 [Brucella suis bv. 5 str. 513]
          Length = 338

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 236/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 20  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 79

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 80  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 139

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 140 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 199

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 200 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 259

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++RA+ DT  RA  +G+ A+D+L  L  
Sbjct: 260 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHRAIADTVQRARHFGEIARDALAPLKA 319

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 320 SPQKDALIEVVDFCISRVN 338


>gi|241203314|ref|YP_002974410.1| Farnesyltranstransferase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857204|gb|ACS54871.1| Farnesyltranstransferase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 338

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 248/322 (77%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA+A + +YR
Sbjct: 17  IKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASASLFDYR 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NHV LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GENHVKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  AC +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    S R ALKSYGMNLG+AFQLVDD LDY G+  ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVAEAGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGT+ E+ FW+  I  G  +  NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 AYRRGTEDERAFWRDAIEAGNSTDANLEKALGLITKYGTLSDTIGRAIHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD+ WK +LMEV+DFC++R+N
Sbjct: 317 LPDTVWKSALMEVIDFCIERVN 338


>gi|261751747|ref|ZP_05995456.1| polyprenyl synthetase [Brucella suis bv. 5 str. 513]
 gi|261741500|gb|EEY29426.1| polyprenyl synthetase [Brucella suis bv. 5 str. 513]
          Length = 340

 Score =  384 bits (986), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 236/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 22  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 81

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 82  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 141

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 142 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 201

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 202 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 261

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++RA+ DT  RA  +G+ A+D+L  L  
Sbjct: 262 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHRAIADTVQRARHFGEIARDALAPLKA 321

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 322 SPQKDALIEVVDFCISRVN 340


>gi|159184398|ref|NP_353656.2| octaprenyl-diphosphate synthase [Agrobacterium tumefaciens str.
           C58]
 gi|159139711|gb|AAK86441.2| octaprenyl-diphosphate synthase [Agrobacterium tumefaciens str.
           C58]
          Length = 338

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/322 (59%), Positives = 246/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL R  SDV+MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 17  VKPLVDLTRPDMERVNQLILSRAGSDVQMIPEVANHLISSGGKRLRPMLTLASASMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYGMNLG+AFQLVDDVLDY G+  ++GKN G+DFR GK TLPVIL
Sbjct: 197 PIVAKTDKASRSALKSYGMNLGLAFQLVDDVLDYGGKSADLGKNTGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT+ E+ FW++ I  G+ S ENL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 SYRRGTQDERAFWRNAIEKGESSDENLEKALGLITKYNGLGDTIGRATHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S WK +L+EV+DFC++RLN
Sbjct: 317 LPQSPWKNALLEVIDFCIERLN 338


>gi|325292016|ref|YP_004277880.1| octaprenyl-diphosphate synthase [Agrobacterium sp. H13-3]
 gi|325059869|gb|ADY63560.1| octaprenyl-diphosphate synthase [Agrobacterium sp. H13-3]
          Length = 338

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 248/322 (77%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL R  SDV+MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 17  VKPLVDLTRADMERVNQLILSRAGSDVQMIPEVANHLISSGGKRLRPMLTLASASMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDHHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYGMNLG+AFQLVDDVLDY G+  ++GKN G+DFR GK TLPVIL
Sbjct: 197 PIVAKTDKASRSALKSYGMNLGLAFQLVDDVLDYGGKSADLGKNTGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT+ E+ FW++ I +G+ S ENL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 SYRRGTQDERAFWRNAIENGESSDENLEKALGLIAKYNGLGDTIGRATHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP+S WK +L+EV+DFC++RLN
Sbjct: 317 LPESPWKNALLEVIDFCIERLN 338


>gi|294851781|ref|ZP_06792454.1| octaprenyl-diphosphate synthase [Brucella sp. NVSL 07-0026]
 gi|294820370|gb|EFG37369.1| octaprenyl-diphosphate synthase [Brucella sp. NVSL 07-0026]
          Length = 340

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 236/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 22  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 81

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 82  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 141

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 142 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 201

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 202 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 261

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 262 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 321

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           SS K +L+EVVDFC+ R+N
Sbjct: 322 SSQKDALIEVVDFCISRVN 340


>gi|112950409|gb|ABI26723.1| decaprenyl diphosphate synthase [Agrobacterium tumefaciens]
          Length = 358

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 246/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 37  VKPLVDLTRPDMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASASMFGYE 96

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 97  GDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 156

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 157 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAAAEVG 216

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYGMNLG+AFQLVDDVLDY G+  ++GKN G+DFR GK TLPVIL
Sbjct: 217 PIVAKTDKATRSALKSYGMNLGLAFQLVDDVLDYGGKSADLGKNTGDDFREGKITLPVIL 276

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT+ E+ FW++ I  G+ S ENL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 277 SYRRGTQDERAFWRTAIEKGESSDENLEKALGLITKYNGLGDTIGRATHYGTIARDALAP 336

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S WK +L+EV+DFC++RLN
Sbjct: 337 LPQSPWKDALLEVIDFCIERLN 358


>gi|37903500|gb|AAP56240.1| decaprenyl diphosphate synthase [Agrobacterium tumefaciens]
          Length = 358

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 246/322 (76%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 37  VKPLVDLTRPDMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASASMFGYE 96

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 97  GDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 156

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 157 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAAAEVG 216

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYGMNLG+AFQLVDDVLDY G+  ++GKN G+DFR GK TLPVIL
Sbjct: 217 PIVAKTDKATRSALKSYGMNLGLAFQLVDDVLDYGGKSADLGKNTGDDFREGKITLPVIL 276

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT+ E+ FW++ I  G+ S ENL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 277 SYRRGTQDERAFWRTAIEKGESSDENLEKALGLITKYNGLGDTIGRATHYGTIARDALAP 336

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S WK +L+EV+DFC++RLN
Sbjct: 337 LPQSPWKDALLEVIDFCIERLN 358


>gi|306842306|ref|ZP_07474966.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella sp. BO2]
 gi|306287563|gb|EFM59019.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella sp. BO2]
          Length = 322

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 236/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+ L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y 
Sbjct: 1   MQPLVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYE 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 61  GDGHVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV 
Sbjct: 121 MVDVGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL
Sbjct: 181 PIIAGAQRSDRAALRDYGLNLGLAFQLVDDALDYSGSAADLGKNTGDDFREGKITLPVIL 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  
Sbjct: 241 SYRRGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAP 300

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
              S  K +L+EVVDFC+ R+N
Sbjct: 301 FKASPQKDALIEVVDFCISRVN 322


>gi|67866738|gb|AAY82368.1| decaprenyl diphosphate synthase [Agrobacterium tumefaciens]
          Length = 358

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 248/322 (77%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL R  SDV+MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 37  VKPLVDLTRADMEQVNQLILSRAGSDVQMIPEVANHLISSGGKRLRPMLTLASASMFGYE 96

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 97  GDHHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 156

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 157 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAAAEVG 216

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYGMNLG+AFQLVDDVLDY G+  ++GKN G+DFR GK TLPVIL
Sbjct: 217 PIVAKTDKASRSALKSYGMNLGLAFQLVDDVLDYGGKSADLGKNTGDDFREGKITLPVIL 276

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT+ E+ FW++ I +G+ S ENL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 277 SYRRGTQDERAFWRNAIENGESSDENLEKALGLITKYNGLGDTIGRATHYGTIARDALAP 336

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP+S WK +L+EV+DFC++RLN
Sbjct: 337 LPESPWKNALLEVIDFCIERLN 358


>gi|153007864|ref|YP_001369079.1| polyprenyl synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151559752|gb|ABS13250.1| Polyprenyl synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 356

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/319 (57%), Positives = 236/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN +IL R  SDVEMIP+V  +LI SGGKRLRPM+TLA A M  Y GD 
Sbjct: 38  LVDLTKADMARVNEMILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLAAARMFGYEGDG 97

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA A+EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M+++
Sbjct: 98  HVRLATAVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFKMMVD 157

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 158 VGSLDALDVLATSASVIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAGEVGPII 217

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 218 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 277

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I DG     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 278 RGTDDERAFWKHAIEDGASDDASLEKAIGLMTKHGAIADTVQRARHFGEIARDALAPLKA 337

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           +  K +L+EV+DFC+ R+N
Sbjct: 338 TPQKDALIEVIDFCISRVN 356


>gi|62289388|ref|YP_221181.1| polyprenyl synthetase family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|189023639|ref|YP_001934407.1| polyprenyl synthetase [Brucella abortus S19]
 gi|254693184|ref|ZP_05155012.1| hypothetical protein Babob3T_00652 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696828|ref|ZP_05158656.1| hypothetical protein Babob28_03708 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254707866|ref|ZP_05169694.1| hypothetical protein BpinM_13091 [Brucella pinnipedialis
           M163/99/10]
 gi|254709549|ref|ZP_05171360.1| hypothetical protein BpinB_04602 [Brucella pinnipedialis B2/94]
 gi|254713033|ref|ZP_05174844.1| hypothetical protein BcetM6_06634 [Brucella ceti M644/93/1]
 gi|254716613|ref|ZP_05178424.1| hypothetical protein BcetM_09363 [Brucella ceti M13/05/1]
 gi|256031043|ref|ZP_05444657.1| hypothetical protein BpinM2_10374 [Brucella pinnipedialis
           M292/94/1]
 gi|256060537|ref|ZP_05450705.1| hypothetical protein Bneo5_09318 [Brucella neotomae 5K33]
 gi|256254446|ref|ZP_05459982.1| hypothetical protein BcetB_09183 [Brucella ceti B1/94]
 gi|256256948|ref|ZP_05462484.1| hypothetical protein Babob9C_06236 [Brucella abortus bv. 9 str.
           C68]
 gi|260168175|ref|ZP_05754986.1| polyprenyl synthetase family protein [Brucella sp. F5/99]
 gi|306839902|ref|ZP_07472700.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella sp. NF 2653]
 gi|306845036|ref|ZP_07477617.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella sp. BO1]
 gi|62195520|gb|AAX73820.1| polyprenyl synthetase family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|189019211|gb|ACD71933.1| Polyprenyl synthetase [Brucella abortus S19]
 gi|306274668|gb|EFM56457.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella sp. BO1]
 gi|306405088|gb|EFM61369.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella sp. NF 2653]
 gi|326408435|gb|ADZ65500.1| Polyprenyl synthetase [Brucella melitensis M28]
 gi|326538151|gb|ADZ86366.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 338

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 20  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 79

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 80  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 139

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 140 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 199

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 200 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 259

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 260 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 319

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 320 SPQKDALIEVVDFCISRVN 338


>gi|237814874|ref|ZP_04593872.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella abortus str. 2308 A]
 gi|237789711|gb|EEP63921.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella abortus str. 2308 A]
          Length = 363

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 45  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 104

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 105 HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 164

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 165 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 224

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 225 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 284

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 285 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 344

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 345 SPQKDALIEVVDFCISRVN 363


>gi|82699315|ref|YP_413889.1| polyprenyl synthetase [Brucella melitensis biovar Abortus 2308]
 gi|225851937|ref|YP_002732170.1| hypothetical protein BMEA_A0432 [Brucella melitensis ATCC 23457]
 gi|254688701|ref|ZP_05151955.1| hypothetical protein Babob68_00654 [Brucella abortus bv. 6 str.
           870]
 gi|254718581|ref|ZP_05180392.1| hypothetical protein Bru83_03399 [Brucella sp. 83/13]
 gi|254729734|ref|ZP_05188312.1| hypothetical protein Babob42_00662 [Brucella abortus bv. 4 str.
           292]
 gi|256044121|ref|ZP_05447028.1| hypothetical protein Bmelb1R_06464 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112919|ref|ZP_05453832.1| hypothetical protein Bmelb3E_09565 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159107|ref|ZP_05456928.1| hypothetical protein BcetM4_09356 [Brucella ceti M490/95/1]
 gi|256368857|ref|YP_003106363.1| polyprenyl synthetase family protein [Brucella microti CCM 4915]
 gi|260545860|ref|ZP_05821601.1| polyprenyl synthetase [Brucella abortus NCTC 8038]
 gi|260563478|ref|ZP_05833964.1| polyprenyl synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260754179|ref|ZP_05866527.1| polyprenyl synthetase [Brucella abortus bv. 6 str. 870]
 gi|260757399|ref|ZP_05869747.1| polyprenyl synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761223|ref|ZP_05873566.1| polyprenyl synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883204|ref|ZP_05894818.1| polyprenyl synthetase [Brucella abortus bv. 9 str. C68]
 gi|261213426|ref|ZP_05927707.1| polyprenyl synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|261218414|ref|ZP_05932695.1| polyprenyl synthetase [Brucella ceti M13/05/1]
 gi|261221617|ref|ZP_05935898.1| polyprenyl synthetase [Brucella ceti B1/94]
 gi|261315356|ref|ZP_05954553.1| polyprenyl synthetase [Brucella pinnipedialis M163/99/10]
 gi|261317077|ref|ZP_05956274.1| polyprenyl synthetase [Brucella pinnipedialis B2/94]
 gi|261320737|ref|ZP_05959934.1| polyprenyl synthetase [Brucella ceti M644/93/1]
 gi|261324532|ref|ZP_05963729.1| polyprenyl synthetase [Brucella neotomae 5K33]
 gi|261757634|ref|ZP_06001343.1| polyprenyl synthetase [Brucella sp. F5/99]
 gi|265983557|ref|ZP_06096292.1| polyprenyl synthetase [Brucella sp. 83/13]
 gi|265988115|ref|ZP_06100672.1| polyprenyl synthetase [Brucella pinnipedialis M292/94/1]
 gi|265990531|ref|ZP_06103088.1| polyprenyl synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994359|ref|ZP_06106916.1| polyprenyl synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|265997580|ref|ZP_06110137.1| polyprenyl synthetase [Brucella ceti M490/95/1]
 gi|265999601|ref|ZP_05467084.2| polyprenyl synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|297247801|ref|ZP_06931519.1| octaprenyl-diphosphate synthase [Brucella abortus bv. 5 str. B3196]
 gi|82615416|emb|CAJ10385.1| Polyprenyl synthetase [Brucella melitensis biovar Abortus 2308]
 gi|225640302|gb|ACO00216.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999015|gb|ACU47414.1| polyprenyl synthetase family protein [Brucella microti CCM 4915]
 gi|260097267|gb|EEW81142.1| polyprenyl synthetase [Brucella abortus NCTC 8038]
 gi|260153494|gb|EEW88586.1| polyprenyl synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260667717|gb|EEX54657.1| polyprenyl synthetase [Brucella abortus bv. 4 str. 292]
 gi|260671655|gb|EEX58476.1| polyprenyl synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674287|gb|EEX61108.1| polyprenyl synthetase [Brucella abortus bv. 6 str. 870]
 gi|260872732|gb|EEX79801.1| polyprenyl synthetase [Brucella abortus bv. 9 str. C68]
 gi|260915033|gb|EEX81894.1| polyprenyl synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260920201|gb|EEX86854.1| polyprenyl synthetase [Brucella ceti B1/94]
 gi|260923503|gb|EEX90071.1| polyprenyl synthetase [Brucella ceti M13/05/1]
 gi|261293427|gb|EEX96923.1| polyprenyl synthetase [Brucella ceti M644/93/1]
 gi|261296300|gb|EEX99796.1| polyprenyl synthetase [Brucella pinnipedialis B2/94]
 gi|261300512|gb|EEY04009.1| polyprenyl synthetase [Brucella neotomae 5K33]
 gi|261304382|gb|EEY07879.1| polyprenyl synthetase [Brucella pinnipedialis M163/99/10]
 gi|261737618|gb|EEY25614.1| polyprenyl synthetase [Brucella sp. F5/99]
 gi|262552048|gb|EEZ08038.1| polyprenyl synthetase [Brucella ceti M490/95/1]
 gi|262765472|gb|EEZ11261.1| polyprenyl synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|263001315|gb|EEZ13890.1| polyprenyl synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094886|gb|EEZ18624.1| polyprenyl synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660312|gb|EEZ30573.1| polyprenyl synthetase [Brucella pinnipedialis M292/94/1]
 gi|264662149|gb|EEZ32410.1| polyprenyl synthetase [Brucella sp. 83/13]
 gi|297174970|gb|EFH34317.1| octaprenyl-diphosphate synthase [Brucella abortus bv. 5 str. B3196]
          Length = 340

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 22  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 81

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 82  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 141

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 142 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 201

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 202 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 261

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 262 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 321

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 322 SPQKDALIEVVDFCISRVN 340


>gi|17987815|ref|NP_540449.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|17983542|gb|AAL52713.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella melitensis bv. 1 str. 16M]
          Length = 362

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 237/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y 
Sbjct: 41  VQPLVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYE 100

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 101 GDGHVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKM 160

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV 
Sbjct: 161 MVDVGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVG 220

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL
Sbjct: 221 PIIAGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVIL 280

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  
Sbjct: 281 SYRRGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAP 340

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           L  S  K +L+EVVDFC+ R+N
Sbjct: 341 LKASPQKDALIEVVDFCISRVN 362


>gi|225626910|ref|ZP_03784949.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella ceti str. Cudo]
 gi|225618567|gb|EEH15610.1| farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Brucella ceti str. Cudo]
          Length = 363

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 45  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 104

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 105 HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 164

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 165 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 224

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 225 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 284

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 285 RGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 344

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 345 SPQKDALIEVVDFCISRVN 363


>gi|163842683|ref|YP_001627087.1| hypothetical protein BSUIS_A0427 [Brucella suis ATCC 23445]
 gi|163673406|gb|ABY37517.1| Hypothetical protein BSUIS_A0427 [Brucella suis ATCC 23445]
          Length = 340

 Score =  381 bits (978), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 22  LVDLTRADMARVNELILSRAASDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 81

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 82  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 141

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 142 VGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 201

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 202 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 261

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 262 RGTDEERAFWKGAIEGGASYDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 321

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 322 SPQKDALIEVVDFCISRVN 340


>gi|163761016|ref|ZP_02168094.1| octaprenyl-diphosphate synthase protein [Hoeflea phototrophica
           DFL-43]
 gi|162281797|gb|EDQ32090.1| octaprenyl-diphosphate synthase protein [Hoeflea phototrophica
           DFL-43]
          Length = 338

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 238/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L D T  DME+VN LIL +  SDV MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 17  VKPLVDKTRGDMERVNQLILSKAGSDVAMIPEVANHLISSGGKRLRPMLTLASATMFGYS 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ LA ++EF+HTATLLHDDVVD+S LRRG+  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDFHIKLATSVEFMHTATLLHDDVVDESDLRRGRSTARMIWGNQASVLVGDFLLGQAFKM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S EAL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LFSAA EV 
Sbjct: 137 MVEVGSLEALDVLSTAAAVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFSAACEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IA    + R AL+SYG+NLG+AFQL+DDVLDY G  N++GKN+G+DFR GK TLPV+L
Sbjct: 197 PIIAETSKAERSALRSYGINLGLAFQLIDDVLDYGGSANDLGKNVGDDFREGKITLPVVL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RG++ E+ FW+  I  GK     L+KA  ++ +  +L DT  RA  Y   A+D+L  
Sbjct: 257 AYRRGSEAERAFWREAIEGGKNDDAALEKALGLITKYGSLKDTMARAEHYASIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPDS  K +L+EV+ FCL R N
Sbjct: 317 LPDSDEKAALLEVIAFCLNRAN 338


>gi|23501305|ref|NP_697432.1| polyprenyl synthetase family protein [Brucella suis 1330]
 gi|161618375|ref|YP_001592262.1| hypothetical protein BCAN_A0405 [Brucella canis ATCC 23365]
 gi|254703754|ref|ZP_05165582.1| hypothetical protein Bsuib36_07492 [Brucella suis bv. 3 str. 686]
 gi|260566991|ref|ZP_05837461.1| polyprenyl synthetase [Brucella suis bv. 4 str. 40]
 gi|261754401|ref|ZP_05998110.1| polyprenyl synthetase [Brucella suis bv. 3 str. 686]
 gi|23347194|gb|AAN29347.1| polyprenyl synthetase family protein [Brucella suis 1330]
 gi|161335186|gb|ABX61491.1| Hypothetical protein BCAN_A0405 [Brucella canis ATCC 23365]
 gi|260156509|gb|EEW91589.1| polyprenyl synthetase [Brucella suis bv. 4 str. 40]
 gi|261744154|gb|EEY32080.1| polyprenyl synthetase [Brucella suis bv. 3 str. 686]
          Length = 340

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L DLT  DM +VN LIL R  SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y GD 
Sbjct: 22  LVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDG 81

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M+++
Sbjct: 82  HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVD 141

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV  +I
Sbjct: 142 VGSFDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPII 201

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL+++
Sbjct: 202 AGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYR 261

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RGT  E+ FWK  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  L  
Sbjct: 262 RGTDEERAFWKGAIEGGASYDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKA 321

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L+EVVDFC+ R+N
Sbjct: 322 SPQKDALIEVVDFCISRVN 340


>gi|15964599|ref|NP_384952.1| putative octaprenyl-diphosphate synthase protein [Sinorhizobium
           meliloti 1021]
 gi|307309345|ref|ZP_07589008.1| Dimethylallyltranstransferase [Sinorhizobium meliloti BL225C]
 gi|307320081|ref|ZP_07599502.1| Dimethylallyltranstransferase [Sinorhizobium meliloti AK83]
 gi|15073777|emb|CAC45418.1| Putative octaprenyl-diphosphate synthase [Sinorhizobium meliloti
           1021]
 gi|306894296|gb|EFN25061.1| Dimethylallyltranstransferase [Sinorhizobium meliloti AK83]
 gi|306900214|gb|EFN30832.1| Dimethylallyltranstransferase [Sinorhizobium meliloti BL225C]
          Length = 338

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 241/322 (74%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLTL DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  VKPLVDLTLSDMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDGHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSIDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAASEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   + R ALKSYG NLG+AFQLVDDVLDY G  +++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVAGGSKADRNALKSYGTNLGLAFQLVDDVLDYGGTSSDLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT +++ FW+  I  G     NL+KA  ++R    L DT  RA  YG  A+D+L  
Sbjct: 257 SYRRGTPQDRAFWREAIEGGASDAANLEKALGLIRRYGGLTDTIARAKHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S WK +L+EV+DFC+ R++
Sbjct: 317 LPASPWKSALVEVIDFCIDRVS 338


>gi|239831276|ref|ZP_04679605.1| polyprenyl synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239823543|gb|EEQ95111.1| polyprenyl synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 356

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 238/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DLT  DM +VN +IL R  SDVEMIP+V  +LI SGGKRLRPM+TLA A M  Y 
Sbjct: 35  VQPLVDLTKADMARVNEMILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLAAARMFGYE 94

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA A+EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 95  GDGHVRLATAVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFKM 154

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV 
Sbjct: 155 MVDVGSLDALDVLATSASVIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAGEVG 214

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG + + R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL
Sbjct: 215 PIIAGARPADRVALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVIL 274

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT  E+ FWK  I +G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  
Sbjct: 275 SYRRGTDDERAFWKHAIEEGASDDASLQKAIGLMTKHGAIADTVQRARHFGEIARDALAP 334

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           L  +  K +L+EV+DFC+ R+N
Sbjct: 335 LKATPQKDALIEVIDFCISRVN 356


>gi|260460355|ref|ZP_05808607.1| Polyprenyl synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259034000|gb|EEW35259.1| Polyprenyl synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 338

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/322 (56%), Positives = 237/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DM +VN LIL +  SDVEMIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  IKDLIDLTAADMGRVNELILSKAGSDVEMIPEVANHLISSGGKRLRPMLTLAAAQMFGYS 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV LA A+EF+HTATLLHDDVVD+S +RRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GEGHVKLATAVEFMHTATLLHDDVVDESGMRRGKKTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL+ LS  A  +AEGE+ QL+ +KNL+ TE+++  VIK+KTA LFSAA EV 
Sbjct: 137 MVDVGSLEALDILSSAASIIAEGEVMQLAAAKNLETTEDEHFAVIKAKTAALFSAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IA    + R AL+SYGMNLG+AFQL+DD LDY G   ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PVIAQATRNDRAALRSYGMNLGLAFQLIDDALDYGGTSKDLGKNVGDDFREGKVTLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RG+K E+ FWK  I D  +    L+KA  +M  + A+ DT  RA  +G+ A+D+L  
Sbjct: 257 AYRRGSKAERTFWKRAIEDNVVDDAGLEKAIGLMTRHGAIADTIGRARHFGEIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           L ++  K +L++V+DFC+ R+N
Sbjct: 317 LEETPQKSALIDVIDFCISRVN 338


>gi|13476175|ref|NP_107745.1| octaprenyl-diphosphate synthase [Mesorhizobium loti MAFF303099]
 gi|14026935|dbj|BAB53531.1| octaprenyl-diphosphate synthase [Mesorhizobium loti MAFF303099]
          Length = 338

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/322 (56%), Positives = 237/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DM +VN LIL +  SDVEMIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  IKDLIDLTAADMGRVNELILSKAGSDVEMIPEVANHLISSGGKRLRPMLTLAAAQMFGYA 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV LA ++EF+HTATLLHDDVVD+S +RRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GEGHVKLATSVEFMHTATLLHDDVVDESGMRRGKKTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL+ LS  A  +AEGE+ QL+ +KNL+ TE+++  VIK+KTA LFSAA EV 
Sbjct: 137 MVDVGSLEALDILSSAASIIAEGEVMQLAAAKNLETTEDEHFAVIKAKTAALFSAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IA    + R AL+SYGMNLG+AFQL+DD LDY G   ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PVIAQATRNDRAALRSYGMNLGLAFQLIDDALDYGGTSKDLGKNVGDDFREGKVTLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGTK E+ FWK  I D  +    L+KA  +M  + A+ DT  RA  +G+ A+D+L  
Sbjct: 257 AYRRGTKAERTFWKRAIEDNVVDDAGLEKAIGLMTRHGAIADTIGRARHFGEIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           L ++  K +L++V+DFC+ R+N
Sbjct: 317 LEETRQKSALIDVIDFCISRVN 338


>gi|319784751|ref|YP_004144227.1| polyprenyl synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170639|gb|ADV14177.1| Polyprenyl synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 338

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/322 (56%), Positives = 235/322 (72%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DM +VN LIL +  SDVEMIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  IKDLIDLTAADMGRVNELILSKAGSDVEMIPEVANHLISSGGKRLRPMLTLAAAQMFGYA 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV LA ++EF+HTATLLHDDVVD+S +RRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GEGHVKLATSVEFMHTATLLHDDVVDESGMRRGKKTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL+ LS  A  +AEGE+ QL+ +KNL+ TE+++  VIK+KTA LFSAA EV 
Sbjct: 137 MVDVGSLEALDILSSAASIIAEGEVMQLAAAKNLETTEDEHFAVIKAKTAALFSAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IA    + R AL+SYGMNLG+AFQL+DD LDY G   ++GKN+G+DFR GK TLPVIL
Sbjct: 197 PVIAQATRNDRAALRSYGMNLGLAFQLIDDALDYGGTSKDLGKNVGDDFREGKVTLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RGTK E+ FWK  I D       L+KA  +M  + A+ DT  RA  +G+ A+D+L  
Sbjct: 257 AYRRGTKAERTFWKRAIEDNVADDAGLEKATGLMTRHGAIADTIGRARHFGEIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           L  +  K +L++V+DFC+ R+N
Sbjct: 317 LEATPQKSALIDVIDFCISRVN 338


>gi|227821037|ref|YP_002825007.1| octaprenyl-diphosphate synthase [Sinorhizobium fredii NGR234]
 gi|227340036|gb|ACP24254.1| octaprenyl-diphosphate synthase [Sinorhizobium fredii NGR234]
          Length = 338

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/322 (57%), Positives = 237/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L  LT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  VKPLVGLTAADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDAHVKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYGMNLG+AFQLVDDVLDY G  +++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVASASRADRNALKSYGMNLGLAFQLVDDVLDYGGSSSDLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT  ++ FW+  I  G     NL KA  ++R    L DT  RA  YG  A+D+L  
Sbjct: 257 SYRRGTPEDRAFWREAIEGGVTDAANLDKALGLIRRYGGLTDTIARAQHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S WK +L+EV+DFC+ R++
Sbjct: 317 LPASPWKSALVEVIDFCIDRVS 338


>gi|148559082|ref|YP_001258425.1| polyprenyl synthetase family protein [Brucella ovis ATCC 25840]
 gi|148370339|gb|ABQ60318.1| polyprenyl synthetase family protein [Brucella ovis ATCC 25840]
          Length = 328

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/322 (56%), Positives = 235/322 (72%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DLT  DM +VN LIL    SDVEMIP+V  +LI SGGKRLRPM+TLA+A M  Y 
Sbjct: 7   VQPLVDLTRADMARVNELILSCAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGYE 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 67  GDGHVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ L+  A  +AEGE+ QL+ +KN++ TE++YL VIK+KTA LFSAA EV 
Sbjct: 127 MVDVGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVG 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG Q S R AL+ YG+NLG+AFQLVDD LDY G   ++GKN G+DFR GK TLPVIL
Sbjct: 187 PIIAGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSATDLGKNTGDDFREGKITLPVIL 246

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT  E+ F K  I  G     +L+KA  +M ++ A+ DT  RA  +G+ A+D+L  
Sbjct: 247 SYRRGTDEERAFCKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAP 306

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           L  S  K +L+EVVDFC+ R+N
Sbjct: 307 LKASPQKDALIEVVDFCISRVN 328


>gi|222147711|ref|YP_002548668.1| octaprenyl-diphosphate synthase [Agrobacterium vitis S4]
 gi|221734699|gb|ACM35662.1| octaprenyl-diphosphate synthase [Agrobacterium vitis S4]
          Length = 338

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/322 (56%), Positives = 241/322 (74%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DLT   ME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA+A M  Y 
Sbjct: 17  VQPLVDLTRNGMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASAAMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ H+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 77  GEGHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S EAL+ LS  A  +AEGE+ QLS++KN++ TE+DY  VI++KTA LF+AA EV 
Sbjct: 137 MVEVGSLEALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYQAVIRAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   + R ALKSYGMNLG+AFQLVDD LDY G+V ++GKN G+DFR GK TLPVIL
Sbjct: 197 PIVAGTDKAARNALKSYGMNLGLAFQLVDDALDYGGKVADLGKNTGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RG + E+ FW+  +  G+    NL+KA  ++ +   L DT  RA  YG  A+D+L  
Sbjct: 257 AYRRGNEAERGFWREALEGGRHDDANLEKAMGLITKYNGLSDTVARAIHYGDVARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           +PD  WK +LM+V+DFC++R++
Sbjct: 317 VPDGVWKDALMDVIDFCIERVS 338


>gi|82395324|gb|ABB72030.1| decaprenyl diphosphate synthase [Sinorhizobium meliloti]
          Length = 338

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 237/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLTL DME+VN  IL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  VKPLVDLTLSDMERVNQPILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ LA ++EF+HTATLLHDDVVD+S LRRGK  AR  WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDGHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTFWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL V ++KTA LF+AA EV 
Sbjct: 137 MVDVGSIDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLRVNRAKTAALFAAASEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   + R ALKSYG NLG+AFQLVDDVLDY G  +++GKN+G+DFR  K TLPVIL
Sbjct: 197 PIVAGGSKADRNALKSYGTNLGLAFQLVDDVLDYGGTSSDLGKNVGDDFRESKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT +++ FW+  I  G     NL+KA  ++R    L DT  RA  YG  A+D+L  
Sbjct: 257 SYRRGTPQDRAFWREAIEGGASDAANLEKALGLIRRYGGLTDTIARAKHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S WK +L+EV+DFC+ R++
Sbjct: 317 LPASPWKSALVEVIDFCIDRVS 338


>gi|217977299|ref|YP_002361446.1| Polyprenyl synthetase [Methylocella silvestris BL2]
 gi|217502675|gb|ACK50084.1| Polyprenyl synthetase [Methylocella silvestris BL2]
          Length = 337

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/314 (55%), Positives = 228/314 (72%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLATA +  YRG  HV 
Sbjct: 22  LVSADMERVNQTILSRTASDVSMIPEVANHLISSGGKRLRPMLTLATAGLCNYRGAGHVK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK+AAR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 82  LAASVEFMHTATLLHDDVVDESDMRRGKLAARMLWGNEASVLVGDFLLGQAFKMMVEVGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ LS  A  +AEGE+ QLS +K+ + +E+DYL VI++KTA LF AA EV  L+AG 
Sbjct: 142 LPCLDVLSAAAAVIAEGEVMQLSAAKDTETSEDDYLAVIRAKTAALFGAAAEVGPLLAGR 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A + YG+NLG+AFQL+DD LDY G   ++GKN+G+DFR GK TLPV+L+F+RGT
Sbjct: 202 PKAEIAACRGYGLNLGVAFQLIDDALDYGGASAKLGKNVGDDFREGKITLPVVLSFRRGT 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +++FW+ T+  G+I+  +L+ A   M ++RAL DT  RA  YG  A+D+L   P S W
Sbjct: 262 AEQRDFWRRTLERGEIADSDLEIAIATMHKHRALEDTVERARHYGAMARDALELFPASPW 321

Query: 307 KKSLMEVVDFCLQR 320
           K +L  VVDFC+ R
Sbjct: 322 KFALSNVVDFCVSR 335


>gi|304393457|ref|ZP_07375385.1| octaprenyl pyrophosphate synthetase [Ahrensia sp. R2A130]
 gi|303294464|gb|EFL88836.1| octaprenyl pyrophosphate synthetase [Ahrensia sp. R2A130]
          Length = 338

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 233/316 (73%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM  VN LIL +  SDVEMIP+V K+LI SGGKRLRPMLTL+ A ML Y GD+HV 
Sbjct: 23  LTADDMAAVNTLILSKCGSDVEMIPEVAKHLIDSGGKRLRPMLTLSAARMLGYTGDHHVT 82

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK +AR+VWGNQ SVLVGDFLL QAF M+++  S
Sbjct: 83  LAASVEFMHTATLLHDDVVDESDMRRGKQSARMVWGNQASVLVGDFLLGQAFRMMVDAGS 142

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            EAL+ LS  +  +AEGE+ QLS +++++ TE+DY+ VI+ KTA LFSAA EV  ++A  
Sbjct: 143 MEALDVLSTASMVIAEGEVMQLSAAQSMETTEDDYMAVIRGKTAALFSAACEVGPILADA 202

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
               R AL+SYG+NLG+AFQLVDD LDY G   ++GKN+G+DF  GK TLPV+LA++RG+
Sbjct: 203 GKPARDALRSYGLNLGLAFQLVDDALDYGGSKADLGKNVGDDFHEGKITLPVLLAYRRGS 262

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E++FW++ +         L  A ++++++ A+ DT  RA  YG+ A+D+L  LP    
Sbjct: 263 DEERDFWRTNMEADNAGEGALDDAMVLLKKHGAIDDTVARARHYGEMARDALAPLPAGEH 322

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L++VVDFC+ R++
Sbjct: 323 KSALLDVVDFCIARVS 338


>gi|150395683|ref|YP_001326150.1| polyprenyl synthetase [Sinorhizobium medicae WSM419]
 gi|150027198|gb|ABR59315.1| Polyprenyl synthetase [Sinorhizobium medicae WSM419]
          Length = 338

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 237/322 (73%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L DLT  DME+VN LIL +  SDV+MIP+V  +LI SGGKRLRPMLTLA A M  Y 
Sbjct: 17  VKPLVDLTQSDMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLAAASMFGYE 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF M
Sbjct: 77  GDGHVKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFRM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S +AL+ LS  A  +AEGE+ QLS++KN++ TE+DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDYLQVIRAKTAALFAAASEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A    + R ALKSYG NLG+AFQLVDDVLDY G  +++GKN+G+DFR GK TLPVIL
Sbjct: 197 PIVASASKADRNALKSYGTNLGLAFQLVDDVLDYGGSSSDLGKNVGDDFREGKITLPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           +++RGT +++ FW+  I  G     NL+KA  ++     L DT  RA  YG  A+D+L  
Sbjct: 257 SYRRGTPQDRAFWREAIEGGASDEANLEKALSLIHRYGGLTDTIARAKHYGTIARDALAP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S  K +L+EV+DFC+ R++
Sbjct: 317 LPVSPCKSALVEVIDFCIDRVS 338


>gi|146339069|ref|YP_001204117.1| octaprenyl diphosphate synthase [Bradyrhizobium sp. ORS278]
 gi|146191875|emb|CAL75880.1| octaprenyl diphosphate synthase [Bradyrhizobium sp. ORS278]
          Length = 336

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/314 (56%), Positives = 229/314 (72%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A + EY GD HV 
Sbjct: 21  LVTADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMAHLTEYAGDGHVK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S +RRGK++AR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 81  LAAAVEFMHTATLLHDDVVDESEMRRGKLSARMLWGNEASVLVGDFLLGQAFRMMVEVGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  ++A  
Sbjct: 141 LRALDILSAAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVLADR 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +S+GMNLGIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+RG+
Sbjct: 201 PKAEQTASRSFGMNLGIAFQLVDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFRRGS 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW  ++  G+I+  +L  A  +M ++RAL DT  RA+ YG  A D+L   P S  
Sbjct: 261 DSERAFWIKSLERGEINDSDLDHAIGLMNKHRALEDTISRAHHYGAMAVDALALFPASPM 320

Query: 307 KKSLMEVVDFCLQR 320
           K +L +VV FCL R
Sbjct: 321 KTALEQVVAFCLAR 334


>gi|148253842|ref|YP_001238427.1| octaprenyl diphosphate synthase [Bradyrhizobium sp. BTAi1]
 gi|146406015|gb|ABQ34521.1| octaprenyl diphosphate synthase [Bradyrhizobium sp. BTAi1]
          Length = 336

 Score =  362 bits (928), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 178/314 (56%), Positives = 228/314 (72%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y GD HV 
Sbjct: 21  LVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMAHLTGYAGDGHVK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S +RRGK++AR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 81  LAAAVEFMHTATLLHDDVVDESEMRRGKLSARMLWGNEASVLVGDFLLGQAFRMMVEVGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  ++A  
Sbjct: 141 LRALDILSAAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVLADR 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +S+GMNLGIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+RG+
Sbjct: 201 PKAEQTASRSFGMNLGIAFQLVDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFRRGS 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW  ++  G+IS  +L  A  +M ++RAL DT  RA+ YG  A D+L   P S  
Sbjct: 261 DSERAFWIKSLERGEISDSDLDHAIGLMNKHRALEDTISRAHHYGAMAVDALALFPASPM 320

Query: 307 KKSLMEVVDFCLQR 320
           K +L +VV FCL R
Sbjct: 321 KTALEQVVAFCLAR 334


>gi|158422531|ref|YP_001523823.1| farnesyltranstransferase [Azorhizobium caulinodans ORS 571]
 gi|158329420|dbj|BAF86905.1| farnesyltranstransferase [Azorhizobium caulinodans ORS 571]
          Length = 335

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 226/312 (72%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DME+VN LIL R  SDV MIP+V  +LI SGGKRLRPMLT+A A +  Y GD H+ LA +
Sbjct: 24  DMERVNALILSRTGSDVAMIPEVANHLISSGGKRLRPMLTIACAALSSYEGDGHIKLAAS 83

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EF+HTATLLHDDVVD+S +RRGK+AAR +WGN+ SVLVGDFLL QAF M++E    E L
Sbjct: 84  VEFMHTATLLHDDVVDESDMRRGKLAARKLWGNEASVLVGDFLLGQAFKMMVEVGILECL 143

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS  ACT+AEGE+ QL+ +KN + +E+DYL VI+ KTA LF+AA EV +++     + 
Sbjct: 144 DILSTAACTIAEGEVMQLAAAKNTETSEDDYLAVIRGKTAELFAAACEVGAVLNARPKAE 203

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           + A +S+GMNLGIAFQLVDD LDY G   ++GKN+G+DFR GK TLPV+LAF+RG   E+
Sbjct: 204 QAACRSFGMNLGIAFQLVDDALDYGGSQAKLGKNVGDDFREGKITLPVLLAFRRGDAEER 263

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FWK  +  G+ + ENL  A  ++ ++RAL DT  RA  YG  AKD+L   P S  K +L
Sbjct: 264 AFWKRCLETGETTDENLAHAVGLLTKHRALADTIERARHYGAMAKDALALFPASHAKDAL 323

Query: 311 MEVVDFCLQRLN 322
            E VDFC+ R +
Sbjct: 324 AEAVDFCISRAH 335


>gi|182677848|ref|YP_001831994.1| polyprenyl synthetase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633731|gb|ACB94505.1| Polyprenyl synthetase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 336

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 228/316 (72%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y G+ H+ 
Sbjct: 21  LVTPDMERVNQTILSRAASDVTMIPEVANHLISSGGKRLRPMLTLAAAGLCGYGGNGHIK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK+AAR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 81  LAASVEFMHTATLLHDDVVDESDMRRGKLAARMLWGNEASVLVGDFLLGQAFKMMVEVGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              LE LS  A  +AEGE+ QL+ +K+ +  E+DYL VI++KTA LF AA EV +L+A  
Sbjct: 141 LACLEVLSTAAAVIAEGEVMQLAAAKDTETGEDDYLAVIRAKTAALFGAAAEVGALLAER 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A +SYG+NLGIAFQL+DD LDY G   ++GKN+G+DFR GK TLPV+L F+RGT
Sbjct: 201 PKAEIAACRSYGLNLGIAFQLIDDALDYGGTSAKLGKNVGDDFREGKITLPVVLCFRRGT 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FW+ T+  G+I   +L  A   MR++RA+ DT  RA  YG  A+D+L   P S W
Sbjct: 261 QDERIFWRRTLEKGEIEEGDLDIAIATMRKHRAIEDTVERARHYGAMARDALELFPASPW 320

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L +VVDFC+ R++
Sbjct: 321 KIALNDVVDFCVNRIS 336


>gi|296447427|ref|ZP_06889352.1| Geranyltranstransferase [Methylosinus trichosporium OB3b]
 gi|296255047|gb|EFH02149.1| Geranyltranstransferase [Methylosinus trichosporium OB3b]
          Length = 338

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 228/311 (73%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
            D+++VN LIL+R  SDV  IP+V  +LI +GGKRLRPML LATA M  YRGD H+  A 
Sbjct: 26  PDLQRVNQLILQRTGSDVTTIPEVANHLISAGGKRLRPMLVLATAGMCGYRGDGHIKFAA 85

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEF+HTATLLHDDVVD+S +RRGK+AAR++WGN+T VLVGDFLL  AF M++E      
Sbjct: 86  GIEFMHTATLLHDDVVDESDMRRGKIAARMLWGNETCVLVGDFLLGHAFKMMVEPGVLPC 145

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  +S  A  +AEGE+ QL+ +K+   TE+ Y+ VI+SKTA LF+AA EV  +++G   +
Sbjct: 146 LSVVSQAAAVIAEGEILQLNSAKDTQTTEDAYMAVIRSKTAELFAAAAEVGPMLSGRPKA 205

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A +SYGMNLGIAFQL+DD LDY G+  ++GKN+G+DFR GK TLPV+LAF+RG++ E
Sbjct: 206 DEAACRSYGMNLGIAFQLIDDALDYGGQSAKLGKNVGDDFREGKITLPVVLAFRRGSENE 265

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW+ T+  G+I+  +++ A  +M+++ AL DT  RA  YG  A+D+L   P S WK +
Sbjct: 266 REFWRRTLEKGEIADGDVETACALMKKHDALKDTVERASHYGAIARDALEIFPASPWKSA 325

Query: 310 LMEVVDFCLQR 320
           L+EVVDFC+QR
Sbjct: 326 LLEVVDFCVQR 336


>gi|75676776|ref|YP_319197.1| polyprenyl synthetase [Nitrobacter winogradskyi Nb-255]
 gi|74421646|gb|ABA05845.1| polyprenyl synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 336

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 226/317 (71%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y G+ 
Sbjct: 18  LVELVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLAGYAGEG 77

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRG+++AR+VWGN+ SVLVGDFLL QAF M++E
Sbjct: 78  HVKLAASVEFMHTATLLHDDVVDESELRRGRLSARMVWGNEASVLVGDFLLGQAFRMMVE 137

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  ++
Sbjct: 138 VGSLRALDILSSAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVL 197

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
            G   + + A  S+GMNLGIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 198 GGRPKAEQTAAASFGMNLGIAFQLVDDVLDYGGKSAKLGKNVGDDFREGKITLPVVLAFR 257

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW   +  GKI   +L  A  +M ++RAL DT  RA+ YG  A D+L   P 
Sbjct: 258 RGNDVEREFWVRALEQGKIGDNDLNHAIGLMTKHRALEDTLNRAHHYGAMAVDALALFPP 317

Query: 304 SSWKKSLMEVVDFCLQR 320
           S  K +L +VV FCL R
Sbjct: 318 SPMKGALEQVVAFCLAR 334


>gi|85714244|ref|ZP_01045232.1| polyprenyl synthetase [Nitrobacter sp. Nb-311A]
 gi|85698691|gb|EAQ36560.1| polyprenyl synthetase [Nitrobacter sp. Nb-311A]
          Length = 336

 Score =  358 bits (918), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 225/317 (70%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y G+ 
Sbjct: 18  LVELVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLAGYSGEG 77

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA ++EF+HTATLLHDDVVD+S LRRGK++AR+VWGN+ SVLVGDFLL QAF M++E
Sbjct: 78  HVKLAASVEFMHTATLLHDDVVDESELRRGKLSARMVWGNEASVLVGDFLLGQAFRMMVE 137

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  ++
Sbjct: 138 VGSLRALDILSSAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVL 197

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
            G   +   A  S+GMNLGIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 198 GGRPKAEETAAASFGMNLGIAFQLVDDVLDYGGKSAKLGKNVGDDFREGKITLPVVLAFR 257

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW   + +G+I   +L  A  +M ++RAL DT  RA  YG  A D+L   P 
Sbjct: 258 RGNDVEREFWVRALEEGRIGDSDLNHAIGLMTKHRALEDTLNRAQHYGAMAVDALALFPP 317

Query: 304 SSWKKSLMEVVDFCLQR 320
           S  K +L +VV FCL R
Sbjct: 318 SPMKSALEQVVAFCLMR 334


>gi|154245320|ref|YP_001416278.1| polyprenyl synthetase [Xanthobacter autotrophicus Py2]
 gi|154159405|gb|ABS66621.1| Polyprenyl synthetase [Xanthobacter autotrophicus Py2]
          Length = 335

 Score =  358 bits (918), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 225/316 (71%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  YRGD HV 
Sbjct: 20  LVKADMERVNATILARTGSDVAMIPEVANHLISSGGKRLRPMLTLACASLSGYRGDGHVK 79

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK+AAR +WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 80  LAASVEFMHTATLLHDDVVDESDMRRGKLAARKLWGNEASVLVGDFLLGQAFKMMVEVGS 139

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ L+  AC +AEGE+ QL+ +KN   +E+DYL VI+ KTA LF+AA EV +++   
Sbjct: 140 MTCLDILATAACVIAEGEVMQLAAAKNTATSEDDYLAVIRGKTAELFAAACEVGAVLGQR 199

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +SYGMNLGIAFQLVDD LDY G   ++GKN+G+DFR GK TLPV+LAF+RG 
Sbjct: 200 PKAEQAACRSYGMNLGIAFQLVDDALDYGGSQAKLGKNVGDDFREGKITLPVLLAFRRGD 259

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW+  +  G+ +  +L +A  +M  +RA+ DT  RA  YG  AKD+L   P+   
Sbjct: 260 ASERAFWQRCLEKGEGNDADLDQAIGLMTRHRAIADTVERARHYGAIAKDALALFPNGQA 319

Query: 307 KKSLMEVVDFCLQRLN 322
           K +LME VDFCL R +
Sbjct: 320 KDALMEAVDFCLSRAH 335


>gi|316932581|ref|YP_004107563.1| polyprenyl synthetase [Rhodopseudomonas palustris DX-1]
 gi|315600295|gb|ADU42830.1| Polyprenyl synthetase [Rhodopseudomonas palustris DX-1]
          Length = 336

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 176/317 (55%), Positives = 227/317 (71%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y GD 
Sbjct: 18  LVELVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLTGYTGDG 77

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA A+EF+HTATLLHDDVVD+S +RRGK +AR++WGN+ SVLVGDFLL QAF M++E
Sbjct: 78  HIKLAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVGDFLLGQAFRMMVE 137

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  + T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV   I
Sbjct: 138 VGSLRALDILSSASATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPAI 197

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A      + A +S+GMN+GIAFQL+DDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 198 ANRPKPEQSACRSFGMNIGIAFQLIDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFR 257

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW  ++  G+IS  +L +A  +M ++RAL DT  RA+ YG  A D+L   P 
Sbjct: 258 RGNDAEREFWIKSLERGEISDADLDQAIKLMTKHRALEDTIQRAHHYGAMAVDALALFPS 317

Query: 304 SSWKKSLMEVVDFCLQR 320
           S  K +L +VV FCL R
Sbjct: 318 SPMKTALEQVVAFCLAR 334


>gi|39934115|ref|NP_946391.1| farnesyltranstransferase [Rhodopseudomonas palustris CGA009]
 gi|192289642|ref|YP_001990247.1| polyprenyl synthetase [Rhodopseudomonas palustris TIE-1]
 gi|39647963|emb|CAE26483.1| octaprenyl-diphosphate synthase [Rhodopseudomonas palustris CGA009]
 gi|192283391|gb|ACE99771.1| Polyprenyl synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 336

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/317 (55%), Positives = 227/317 (71%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y GD 
Sbjct: 18  LVELVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLTGYTGDG 77

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA A+EF+HTATLLHDDVVD+S +RRGK +AR++WGN+ SVLVGDFLL QAF M++E
Sbjct: 78  HIKLAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVGDFLLGQAFRMMVE 137

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  + T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV   I
Sbjct: 138 VGSLRALDILSSASATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPAI 197

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A      + A +S+GMN+GIAFQL+DDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 198 ANRPKPEQSACRSFGMNIGIAFQLIDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFR 257

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW  ++  G+IS  +L +A  +M ++RAL DT  RA+ YG  A D+L   P 
Sbjct: 258 RGNDAEREFWIKSLERGEISDADLDQAIKLMTKHRALDDTIQRAHHYGAMAVDALALFPS 317

Query: 304 SSWKKSLMEVVDFCLQR 320
           S  K +L +VV FCL R
Sbjct: 318 SPMKTALEQVVAFCLAR 334


>gi|90425826|ref|YP_534196.1| farnesyltranstransferase [Rhodopseudomonas palustris BisB18]
 gi|90107840|gb|ABD89877.1| Farnesyltranstransferase [Rhodopseudomonas palustris BisB18]
          Length = 336

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/317 (55%), Positives = 228/317 (71%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L   DME+VN +IL R  S+V MIP+V  +LI SGGKRLRP LTLA A +  Y G+ 
Sbjct: 18  LVELVAADMERVNAVILSRTGSEVTMIPEVANHLISSGGKRLRPNLTLAMAQLTGYSGEG 77

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA A+EF+HTATLLHDDVVD+S +RRGK +AR++WGN+ SVLVGDFLL QAF M++E
Sbjct: 78  HIKLAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVGDFLLGQAFRMMVE 137

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV   I
Sbjct: 138 VGSLRALDILSSAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPAI 197

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   + + A +S+GMNLGIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 198 AGRPKAEQSACRSFGMNLGIAFQLVDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFR 257

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW   +  G+I+  +L +A  +M ++RAL DT  RA+ YG  A D+L   P 
Sbjct: 258 RGNDAERAFWIKALERGEITEPDLDQAIGLMTKHRALEDTIQRAHHYGAMAVDALALFPT 317

Query: 304 SSWKKSLMEVVDFCLQR 320
           S  K +L +VV FCL R
Sbjct: 318 SPMKAALEQVVAFCLAR 334


>gi|92118681|ref|YP_578410.1| farnesyltranstransferase [Nitrobacter hamburgensis X14]
 gi|91801575|gb|ABE63950.1| Farnesyltranstransferase [Nitrobacter hamburgensis X14]
          Length = 336

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 223/315 (70%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y G+ H+
Sbjct: 20  ELVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMAHLAGYSGEGHI 79

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA ++EF+HTATLLHDDVVD+S LRRGK++AR+VWGN+ SVLVGDFLL QAF M++E  
Sbjct: 80  KLAASVEFMHTATLLHDDVVDESELRRGKLSARMVWGNEASVLVGDFLLGQAFRMMVEVG 139

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S  AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  ++ G
Sbjct: 140 SLRALDILSAAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVLGG 199

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +   A  S+GMNLGIAFQLVDDVLDY G+  ++GKNIG+DFR GK TLPV+LAF+RG
Sbjct: 200 RPKAEEMAAASFGMNLGIAFQLVDDVLDYGGKSAKLGKNIGDDFREGKITLPVVLAFRRG 259

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
              E+ FW   +  G+I   +L  A  +M ++RAL DT  RA  YG  A D+L   P S 
Sbjct: 260 NDIEREFWVRALEQGEIGDNDLNHAIGLMTKHRALEDTLNRAQHYGAMAVDALALFPPSP 319

Query: 306 WKKSLMEVVDFCLQR 320
            K +L +VV FCL R
Sbjct: 320 MKSALEQVVAFCLAR 334


>gi|86748213|ref|YP_484709.1| farnesyltranstransferase [Rhodopseudomonas palustris HaA2]
 gi|86571241|gb|ABD05798.1| Farnesyltranstransferase [Rhodopseudomonas palustris HaA2]
          Length = 336

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 175/314 (55%), Positives = 225/314 (71%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y GD H+ 
Sbjct: 21  LVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLTGYAGDGHIK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S +RRGK +AR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 81  LAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVGDFLLGQAFRMMVEVGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  + T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV   IA  
Sbjct: 141 LRALDILSAASATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPAIADR 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +S+GMN+GIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+RG 
Sbjct: 201 PKAEQSACRSFGMNIGIAFQLVDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFRRGN 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW   +  G+I+  +L +A  +M ++RAL DT  RA+ YG  A D+L   P S  
Sbjct: 261 DSERAFWIKALERGEITEADLDQAIKLMTKHRALEDTIQRAHHYGAMAVDALALFPSSPM 320

Query: 307 KKSLMEVVDFCLQR 320
           K +L +VV FCL R
Sbjct: 321 KTALEQVVAFCLAR 334


>gi|319406067|emb|CBI79697.1| octaprenyl-diphosphate synthase [Bartonella sp. AR 15-3]
          Length = 337

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 230/316 (72%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT +DM++VN LI+    S+V MIP++  YLI SGGKR+RPM+TLATA M EY+GD H+ 
Sbjct: 22  LTKEDMKRVNQLIISMAKSNVTMIPEISNYLISSGGKRIRPMITLATAHMFEYQGDEHIK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ S+LVGDFLL QAF M+++  S
Sbjct: 82  LATAVEFMHTATLLHDDVVDESELRRGKSTARILWGNQASILVGDFLLGQAFKMMVDVGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            EAL  LS  A  +AEGE+ QLS +KN++    DYL +IK+KTA LFSAA E+  +IAG 
Sbjct: 142 LEALSVLSNAAAIIAEGEVMQLSAAKNIETNVSDYLKIIKAKTAALFSAAAEIGPIIAGY 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            +  R AL  YG++LG+AFQL+DDVLDY      +GKNIG+DFR GK T+PVIL++ RG 
Sbjct: 202 GHEERSALHQYGLSLGLAFQLIDDVLDYSSNTQYLGKNIGDDFREGKITMPVILSYTRGN 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             EK FWK  + +   + E+LK A  ++ +   L+DT  +A  YG++A D+L  + ++  
Sbjct: 262 DTEKTFWKQALENNHNNDESLKHAQHLIEKYNGLIDTIEQARIYGKRAIDALSSIKENPA 321

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L++++DFC++R+N
Sbjct: 322 KNALIDIIDFCIERVN 337


>gi|299134682|ref|ZP_07027874.1| Polyprenyl synthetase [Afipia sp. 1NLS2]
 gi|298590492|gb|EFI50695.1| Polyprenyl synthetase [Afipia sp. 1NLS2]
          Length = 336

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/316 (55%), Positives = 226/316 (71%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN  IL R  S+V MIP+V  +LI SGGKRLRPMLTLA A +  Y GD H+ 
Sbjct: 21  LVADDMAGVNTTILSRTGSEVTMIPEVANHLISSGGKRLRPMLTLAMAQLAGYTGDGHIK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S LRRGK++AR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 81  LAAAVEFMHTATLLHDDVVDESELRRGKLSARMLWGNEASVLVGDFLLGQAFRMMVEVGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  +IA  
Sbjct: 141 LRALDILSSAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAASEVGPVIANR 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +S+GMNLGIAFQL+DDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+RG 
Sbjct: 201 PKAEQTASRSFGMNLGIAFQLIDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFRRGN 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E++FW  T+  G+++  +L  A  +M ++RAL DT  RA  YG  A D+L   P S  
Sbjct: 261 DVERDFWIRTLERGEVADADLDHAIGLMTKHRALDDTMQRAQHYGAMAVDALALFPSSPM 320

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L +VV FCL R N
Sbjct: 321 KSALEQVVAFCLARSN 336


>gi|298293858|ref|YP_003695797.1| trans-hexaprenyltranstransferase [Starkeya novella DSM 506]
 gi|296930369|gb|ADH91178.1| Trans-hexaprenyltranstransferase [Starkeya novella DSM 506]
          Length = 340

 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 229/315 (72%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM++VN LIL R  SDV MIP+V ++LI SGGKRLRPMLTLATA +  Y GD  V 
Sbjct: 25  LVRADMDRVNALILSRTGSDVTMIPEVAQHLISSGGKRLRPMLTLATAALSGYEGDGAVK 84

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVDDS +RRGK+AAR++WGN+ SVLVGDFLL QAF M+IE  S
Sbjct: 85  LAASVEFMHTATLLHDDVVDDSEMRRGKLAARMLWGNEASVLVGDFLLGQAFRMMIEVGS 144

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  A  +AEGE+ QL+ +KN+   E+ YL VI+ KTA LF+AA EV  ++AG 
Sbjct: 145 MRALDILSTAAVVIAEGEVAQLAAAKNIATDEDAYLAVIRGKTAELFAAACEVGPVLAGR 204

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A ++YGMNLGIAFQLVDD LDY G   ++GKN+G+DFR GK TLP++LA +R  
Sbjct: 205 PEAEMAAARAYGMNLGIAFQLVDDALDYGGSGADLGKNVGDDFREGKITLPIVLAVRRAN 264

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FW+  + +G+I   +L++A  ++  + AL +T  RA  YG++AK +L  LP  + 
Sbjct: 265 EDERGFWRRCLEEGEIGEGDLERALALLTRHGALAETVERARFYGEEAKAALVALPAGTA 324

Query: 307 KKSLMEVVDFCLQRL 321
           K +L++VVDFC+ R+
Sbjct: 325 KSALIDVVDFCISRV 339


>gi|91975694|ref|YP_568353.1| farnesyltranstransferase [Rhodopseudomonas palustris BisB5]
 gi|91682150|gb|ABE38452.1| Farnesyltranstransferase [Rhodopseudomonas palustris BisB5]
          Length = 336

 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 225/314 (71%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A +  Y GD H+ 
Sbjct: 21  LVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPILTLAMANLTGYAGDGHIK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S +RRGK +AR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 81  LAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVGDFLLGQAFRMMVEVGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  + T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV   IA  
Sbjct: 141 LRALDILSAASATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPTIADR 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +S+GMN+GIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+RG 
Sbjct: 201 PKAEQSACRSFGMNIGIAFQLVDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFRRGN 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW   +  G+I+  +L +A  +M ++RAL DT  RA+ YG  A D+L   P S  
Sbjct: 261 DAERAFWIKALERGEITETDLDQAIALMAKHRALEDTIQRAHHYGAMAVDALALFPSSPM 320

Query: 307 KKSLMEVVDFCLQR 320
           K +L +VV FCL R
Sbjct: 321 KTALEQVVAFCLAR 334


>gi|110633068|ref|YP_673276.1| polyprenyl synthetase [Mesorhizobium sp. BNC1]
 gi|110284052|gb|ABG62111.1| Polyprenyl synthetase [Chelativorans sp. BNC1]
          Length = 338

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 231/316 (73%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM +VN LIL +  SDVE+IP + ++LI SGGKRLRPM+TLA A M  Y G+ HV 
Sbjct: 23  LTKDDMARVNDLILSKAGSDVELIPQLARHLISSGGKRLRPMITLAAAQMFGYSGEGHVK 82

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK  AR +WGNQ SVLVGD+LL QAF M+++  S
Sbjct: 83  LATSVEFMHTATLLHDDVVDESDMRRGKKTARTIWGNQASVLVGDYLLGQAFRMMVDVGS 142

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            EAL+ LS  A  +AEGE+ QL +SKNL+ TE++YL VIK+KTA LFSAA EV  +IA  
Sbjct: 143 LEALDVLSSAASIIAEGEVMQLGVSKNLETTEDEYLSVIKAKTAALFSAAAEVGPIIAEA 202

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + R AL+S+G+NLG+AFQLVDD LDY G   ++GKN+G+DFR GK TLPVIL+++RG+
Sbjct: 203 SRNDRAALRSFGINLGLAFQLVDDALDYGGSSRDLGKNVGDDFREGKVTLPVILSYRRGS 262

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FWK  I + +   + L KA  +M  + ++ DT  RA  +G+ A+D+L  L  +  
Sbjct: 263 EEERLFWKRAIEENQNDDDALAKAIGLMNRHGSIGDTIARARHFGEIARDALAPLKSTPQ 322

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L +V+DFC+ R++
Sbjct: 323 KAALFDVIDFCISRVS 338


>gi|209886074|ref|YP_002289931.1| octaprenyl-diphosphate synthase [Oligotropha carboxidovorans OM5]
 gi|209874270|gb|ACI94066.1| octaprenyl-diphosphate synthase [Oligotropha carboxidovorans OM5]
          Length = 336

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 178/319 (55%), Positives = 226/319 (70%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L  L   DM  VN  IL R  S+V MIP+V  +LI SGGKRLRPMLTLA A +  Y GD 
Sbjct: 18  LVSLVADDMAGVNTTILARTGSEVTMIPEVANHLISSGGKRLRPMLTLAMAQLAGYVGDG 77

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA A+EF+HTATLLHDDVVD+S LRRGK++AR++WGN+ SVLVGDFLL QAF M++E
Sbjct: 78  HIKLAAAVEFMHTATLLHDDVVDESELRRGKLSARMLWGNEASVLVGDFLLGQAFRMMVE 137

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  +I
Sbjct: 138 VGSLRALDILSSAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVI 197

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A    + + A ++ GMNLGIAFQLVDDVLDY G   ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 198 AERPKAEQTACRAVGMNLGIAFQLVDDVLDYGGTAAKLGKNVGDDFREGKITLPVVLAFR 257

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E++FW  T+  G+++  +L  A  +M ++RAL DT  RA  YG KA D+L   P 
Sbjct: 258 RGNDVERDFWIRTLERGEVADADLDHAIGLMAKHRALEDTMQRAEHYGAKAVDALALFPS 317

Query: 304 SSWKKSLMEVVDFCLQRLN 322
           S  K +L +VV FCL R N
Sbjct: 318 SPMKSALEQVVAFCLARSN 336


>gi|163867858|ref|YP_001609062.1| octaprenyl-diphosphate synthase [Bartonella tribocorum CIP 105476]
 gi|161017509|emb|CAK01067.1| octaprenyl-diphosphate synthase [Bartonella tribocorum CIP 105476]
          Length = 338

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 227/322 (70%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DLT KDME+VN  IL    S++EMIP++  +LI SGGKRLRPM+TLA+A M  Y+
Sbjct: 17  LQSLFDLTQKDMERVNQFILSMAKSEIEMIPEISNHLISSGGKRLRPMITLASAHMFGYQ 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H+ LA A+EF+HTATLLHDDV+D+S LRRGK  AR++WGNQ S+LVGDFLL QAF M
Sbjct: 77  SDGHIKLATAVEFMHTATLLHDDVIDESDLRRGKSTARMIWGNQASILVGDFLLGQAFKM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL  L+  A  +AEGE+ QLS +KN+  +  DYL +I +KTA LFSAA EV 
Sbjct: 137 MVDVGSIEALSVLANAAAIIAEGEVMQLSAAKNIKTSSSDYLKIINAKTAALFSAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG  +  R AL+ YG +LG+AFQL+DD LDY G    +GKNIG+DFR GK T+PVIL
Sbjct: 197 PIVAGYGHKERSALREYGTSLGLAFQLIDDALDYSGSAQNLGKNIGDDFREGKITMPVIL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RG   EK FWK  + DG  S E    A  +M +  ++ DT  +A  YG++A D+L  
Sbjct: 257 AYERGNMDEKAFWKQALEDGNNSNEAFAHAQHLMEKYNSITDTIEQARVYGKRAIDALIP 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           + ++    +L+E V+FC+ R+N
Sbjct: 317 MNENPAYNALVETVEFCIARIN 338


>gi|170740966|ref|YP_001769621.1| polyprenyl synthetase [Methylobacterium sp. 4-46]
 gi|168195240|gb|ACA17187.1| Polyprenyl synthetase [Methylobacterium sp. 4-46]
          Length = 345

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 175/320 (54%), Positives = 226/320 (70%), Gaps = 6/320 (1%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG----- 61
           L    ME+VN +IL R  SDV MIP+V  +LI SGGKRLRP+LTLATA +  YR      
Sbjct: 24  LVASGMERVNAMILSRTGSDVAMIPEVANHLIASGGKRLRPILTLATAQLCGYRAGEAGR 83

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           D  V LA ++EF+HTATLLHDDVVD+S +RRG+VAAR+ WGNQ SVLVGDFLL QAF M+
Sbjct: 84  DGDVKLAASVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNQASVLVGDFLLGQAFKMM 143

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +E  S  AL+ LS  A  +AEGE+ QL  +KN + TE++YL VI++KTA LF+AA EV  
Sbjct: 144 VEVGSLRALDILSSAAAVIAEGEVMQLGAAKNTETTEDEYLAVIRAKTAELFAAACEVGP 203

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++A    S   A +SYGMNLG+AFQL+DD LDY G    +GKN+G+DFR GK TLPV+L+
Sbjct: 204 VLAERPKSEAAACRSYGMNLGVAFQLIDDALDYGGTSAALGKNVGDDFREGKITLPVVLS 263

Query: 242 FQRGTKREKNFWKSTINDGKI-SVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           F+RG+  E+ FW+ T+  G+I    +L  A  IMR +RAL DT  RA  YG  A+D+L  
Sbjct: 264 FRRGSAEERAFWRRTLEQGEIDEARDLDTAIGIMRRHRALEDTVERARHYGAIARDALAL 323

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            PD+  K++L++ VDFC+ R
Sbjct: 324 FPDAPMKRALLQAVDFCIAR 343


>gi|27377642|ref|NP_769171.1| octaprenyl-diphosphate synthase [Bradyrhizobium japonicum USDA 110]
 gi|27350787|dbj|BAC47796.1| octaprenyl-diphosphate synthase [Bradyrhizobium japonicum USDA 110]
          Length = 335

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 222/314 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DME+VN  IL R  SDV MIP+V  +LI SGGKRLRPMLTLA A +  Y GD H+ 
Sbjct: 20  LVAGDMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLAGYTGDGHIK 79

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK++AR++WGN+ SVLVGDFLL QAF M++E  S
Sbjct: 80  LAASVEFMHTATLLHDDVVDESEMRRGKLSARMLWGNEASVLVGDFLLGQAFRMMVEVGS 139

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  A T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV  +IA  
Sbjct: 140 LRALDILSAAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPVIANR 199

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + + A +S GMNLGIAFQLVDDVLDY G+  ++GKN G+DFR GK TLPV+LAF+RG 
Sbjct: 200 PKAEQTACRSVGMNLGIAFQLVDDVLDYGGKSAKLGKNTGDDFREGKITLPVVLAFRRGN 259

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW   +  G+I   +L  A  +M ++RAL DT  RA  YG  A D+L   P S  
Sbjct: 260 DTERAFWIKALERGEIGDTDLDHAIGLMNKHRALEDTLSRAQHYGAMAVDALALFPSSPM 319

Query: 307 KKSLMEVVDFCLQR 320
           K +L +VV FCL R
Sbjct: 320 KSALEQVVAFCLAR 333


>gi|115526409|ref|YP_783320.1| farnesyltranstransferase [Rhodopseudomonas palustris BisA53]
 gi|115520356|gb|ABJ08340.1| Farnesyltranstransferase [Rhodopseudomonas palustris BisA53]
          Length = 341

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 174/317 (54%), Positives = 227/317 (71%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L   DM++VN  IL R  S+V MIP+V  +LI SGGKRLRPMLTLA A +  Y GD 
Sbjct: 23  LVELVAADMKRVNATILSRTGSEVTMIPEVANHLISSGGKRLRPMLTLAMANLTGYTGDG 82

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA A+EF+HTATLLHDDVVD+S +RRGK +AR++WGN+ SVLVGDFLL QAF M++E
Sbjct: 83  HIKLAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVGDFLLGQAFRMMVE 142

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S  AL+ LS  + T+AEGE+ QL+ +KN   TE++YL VI+ KTA LF+AA EV   I
Sbjct: 143 VGSLRALDILSAASATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELFAAACEVGPAI 202

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A      + A +S+GMN+GIAFQLVDDVLDY G+  ++GKN+G+DFR GK TLPV+LAF+
Sbjct: 203 AERPKPEQSACRSFGMNIGIAFQLVDDVLDYGGKAAKLGKNVGDDFREGKITLPVVLAFR 262

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW  ++  G+I+  +L +A  +M ++RAL DT  RA+ YG  A D+L   P 
Sbjct: 263 RGNDSERAFWIKSLERGEITDTDLDQAIGLMTKHRALEDTIQRAHHYGAMAVDALALFPQ 322

Query: 304 SSWKKSLMEVVDFCLQR 320
           S  K +L +VV FCL R
Sbjct: 323 SPMKTALEQVVAFCLAR 339


>gi|323136700|ref|ZP_08071781.1| Polyprenyl synthetase [Methylocystis sp. ATCC 49242]
 gi|322398017|gb|EFY00538.1| Polyprenyl synthetase [Methylocystis sp. ATCC 49242]
          Length = 336

 Score =  351 bits (900), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 226/311 (72%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+E+ N LI++R  SDV  IP+V  +LI +GGKRLRPML LATA M  Y+GD H+  A  
Sbjct: 25  DLERTNQLIIQRTGSDVTTIPEVANHLISAGGKRLRPMLVLATAGMCGYKGDGHLKFAAG 84

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD+S +RRGK+AAR++WGNQT VLVGDFLL  AF M++E      L
Sbjct: 85  IEFMHTATLLHDDVVDESNMRRGKIAARMLWGNQTCVLVGDFLLGHAFKMMVEPGMVPPL 144

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             +S  A  +AEGE+ QL+ +K+   TE+ Y+ VI+ KTA LF+AA EV  ++A    + 
Sbjct: 145 TVVSQAAAVIAEGEILQLNAAKDTTTTEDAYMAVIRRKTAELFAAAAEVGVMLANKPKAD 204

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             A +SYGMNLGIAFQL+DD LDY G   ++GKN+G+DFR GK TLPV+LAF+RG ++E+
Sbjct: 205 EAAARSYGMNLGIAFQLIDDALDYGGSSAKLGKNVGDDFREGKITLPVVLAFRRGNEKER 264

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW+ T+  G+I+  +++ A  +M++++AL DT  RA  YG  A+D++   P S WK +L
Sbjct: 265 EFWRRTLEKGEINDGDVETACGLMKKHKALDDTIERAAHYGAIARDAMEIFPASPWKSAL 324

Query: 311 MEVVDFCLQRL 321
           +EVVDFC++R+
Sbjct: 325 LEVVDFCIERV 335


>gi|220924250|ref|YP_002499552.1| polyprenyl synthetase [Methylobacterium nodulans ORS 2060]
 gi|219948857|gb|ACL59249.1| Polyprenyl synthetase [Methylobacterium nodulans ORS 2060]
          Length = 345

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 175/315 (55%), Positives = 224/315 (71%), Gaps = 6/315 (1%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG-----DNHVL 66
           ME+VN +IL R  SDV MIP+V  +LI SGGKRLRP+LTLATA +  YR      D  V 
Sbjct: 29  MERVNAMILSRTGSDVAMIPEVANHLIASGGKRLRPILTLATAQLCGYRSAEGGRDGDVK 88

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRG+VAAR+ WGNQ SVLVGDFLL QAF M++E  S
Sbjct: 89  LAASVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNQASVLVGDFLLGQAFKMMVEVGS 148

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  A  +AEGE+ QL  +KN + TE++YL VI++KTA LF+AA EV  ++A  
Sbjct: 149 LRALDILSSAAAVIAEGEVMQLGAAKNTETTEDEYLAVIRAKTAELFAAACEVGPVLAER 208

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             S   A +SYGMNLGIAFQLVDD LDY G    +GKN+G+DFR GK TLP++L+F+RG 
Sbjct: 209 PKSEAAACRSYGMNLGIAFQLVDDALDYGGTSAALGKNVGDDFREGKITLPIVLSFRRGN 268

Query: 247 KREKNFWKSTINDGKI-SVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
             E+ FW+ T+  G+I    +L  A  IMR +RAL DT  RA  YG  A+D+L   PD+ 
Sbjct: 269 AEERAFWRRTLEQGEIDESRDLDTAIGIMRRHRALEDTIERARHYGAIARDALALFPDAP 328

Query: 306 WKKSLMEVVDFCLQR 320
            K++L++ VDFC+ R
Sbjct: 329 MKRALLQAVDFCISR 343


>gi|46203612|ref|ZP_00051268.2| COG0142: Geranylgeranyl pyrophosphate synthase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 312

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 171/312 (54%), Positives = 229/312 (73%), Gaps = 1/312 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR-GDNHVLLACA 70
           ME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A +  Y  GD  V LA A
Sbjct: 1   MERVNATILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACADLCGYGDGDGAVKLAAA 60

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++E  S  AL
Sbjct: 61  VEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMVEVGSLRAL 120

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS  A  +AEGE+ QL+ +KN + +E++YL VI+ KTA LF+AA EV  ++AG   + 
Sbjct: 121 DILSAAATVIAEGEVMQLTAAKNTETSEDEYLAVIRGKTAELFAAACEVGPVLAGRPEAE 180

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           + A ++YGMNLGIAFQL+DDVLDY G    +GKN+G+DFR GK TLP++LA +RGT  E+
Sbjct: 181 QVACRAYGMNLGIAFQLIDDVLDYGGTSAALGKNVGDDFREGKITLPIVLALRRGTDEER 240

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW+ T+   ++   +L++A  I+R NRAL DT  RA+ YG  A+++L  LP+ + K +L
Sbjct: 241 AFWRRTLEREELEDGDLEQALAILRRNRALEDTITRAHHYGTMAREALAPLPNGAMKSAL 300

Query: 311 MEVVDFCLQRLN 322
           ++VVDFC+ R +
Sbjct: 301 LQVVDFCIARAH 312


>gi|319404558|emb|CBI78164.1| octaprenyl-diphosphate synthase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 337

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 223/316 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT +DME VN L +    S+V MIP++  YLI SGGKR+RPM+TLATA M  Y+GD H+ 
Sbjct: 22  LTKEDMECVNQLTISMAKSNVAMIPEISNYLISSGGKRIRPMITLATAHMFGYQGDKHIK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+SALRRGK  AR++WGNQ S+LVGDFLL QAF M+++  S
Sbjct: 82  LATAVEFMHTATLLHDDVVDESALRRGKSTARIIWGNQASILVGDFLLGQAFKMMVDVGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            +AL  LS  A  +AEGE+ QLS +KN++    DYL +I +KTA LFSAA EV  +IAG 
Sbjct: 142 LDALSVLSNAAAIIAEGEVMQLSAAKNIETNVSDYLKIINAKTAALFSAAAEVGPIIAGY 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
               R AL  YG++LG+AFQL+DDVLDY      +GKNIG+DFR GK T+PVIL++ RG 
Sbjct: 202 GPEERSALHQYGLSLGLAFQLIDDVLDYSSSAQYLGKNIGDDFREGKITMPVILSYTRGN 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             EK FWK  + +     E LK A  ++ +   L DT  +A  YG++A D+L  + D+  
Sbjct: 262 DIEKIFWKQALENNHNDDEALKHAQQLIEKYDGLTDTIEQARIYGKRAIDALSSIKDNPA 321

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L++++DFC++R+N
Sbjct: 322 KNALIDIIDFCIERVN 337


>gi|240139858|ref|YP_002964335.1| octaprenyl diphosphate synthase [Methylobacterium extorquens AM1]
 gi|240009832|gb|ACS41058.1| octaprenyl diphosphate synthase [Methylobacterium extorquens AM1]
          Length = 340

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 227/317 (71%), Gaps = 1/317 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGDNHV 65
           L    ME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A + +Y  GD  V
Sbjct: 24  LVAAGMERVNATILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACADLCDYGSGDGAV 83

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA A+EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++E  
Sbjct: 84  KLAAAVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMVEVG 143

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S  AL+ LS  A  +AEGE+ QL+ +KN++ +E++YL VI+ KTA LF+AA EV  ++AG
Sbjct: 144 SLRALDILSAAATVIAEGEVMQLTAAKNIETSEDEYLAVIRGKTAELFAAACEVGPVLAG 203

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              S + A ++YGMNLGIAFQL+DDVLDY G    +GKN+G+DFR GK TLP++LA +RG
Sbjct: 204 RPESEQAACRAYGMNLGIAFQLIDDVLDYGGSSAALGKNVGDDFREGKITLPIVLALRRG 263

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +  E+ FW+ T+     +  +L++A  I+  +RAL DT  RA+ YG +A+ +L   P   
Sbjct: 264 SDEERAFWRRTLEREDRAEGDLQQALAILSRHRALDDTIERAHHYGDQARAALEPFPPGP 323

Query: 306 WKKSLMEVVDFCLQRLN 322
            K +L++VVDFC+ R +
Sbjct: 324 MKAALLQVVDFCIARAH 340


>gi|319408199|emb|CBI81852.1| octaprenyl-diphosphate synthase [Bartonella schoenbuchensis R1]
          Length = 338

 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 170/321 (52%), Positives = 229/321 (71%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           + L +LT  +ME+VN LI+  + +DVEMIP++  YLI SGGKRLRPM+TLA A M  Y+G
Sbjct: 18  QTLINLTKDNMERVNQLIISMVQADVEMIPEICNYLISSGGKRLRPMITLAAADMFGYQG 77

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           D H+ LA AIEF+HTATLLHDDVVD+S LRRGK  AR++WGN+ SVLVGDFLL QAF M+
Sbjct: 78  DGHIKLATAIEFMHTATLLHDDVVDESNLRRGKSTARMIWGNKASVLVGDFLLGQAFKMI 137

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           ++  S EAL  L+  A  +AEGE+ QL+ ++N++ T  DYL +I +KTA LFSAA EV  
Sbjct: 138 VDVGSMEALTILANAAAIIAEGEVMQLAAAQNIETTASDYLKIINAKTAALFSAAAEVGP 197

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           +IAG  +  R AL+ YG +LG+AFQLVDD LDY G    +GKNIG+DFR GK T+PVIL+
Sbjct: 198 IIAGYGHEERLALREYGTSLGLAFQLVDDALDYSGNAEHLGKNIGDDFREGKITMPVILS 257

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
           + RG   EK FWK  + +   + E+L  A  +M +  +L DT  +A  YG++A D+L  +
Sbjct: 258 YTRGNATEKAFWKQALENNNNNDESLVHAQHLMEKYDSLTDTIEQARIYGKQAIDALSPI 317

Query: 302 PDSSWKKSLMEVVDFCLQRLN 322
            ++  K + +E+VDFC+ R+N
Sbjct: 318 KENPQKNAFIEIVDFCIARIN 338


>gi|254562277|ref|YP_003069372.1| octaprenyl diphosphate synthase [Methylobacterium extorquens DM4]
 gi|254269555|emb|CAX25521.1| octaprenyl diphosphate synthase [Methylobacterium extorquens DM4]
          Length = 340

 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 227/317 (71%), Gaps = 1/317 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGDNHV 65
           L    ME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A + +Y  GD  V
Sbjct: 24  LVAAGMERVNATILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACADLCDYGSGDGAV 83

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA A+EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++E  
Sbjct: 84  KLAAAVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMVEVG 143

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S  AL+ LS  A  +AEGE+ QL+ +KN++ +E++YL VI+ KTA LF+AA EV  ++AG
Sbjct: 144 SLRALDILSAAATVIAEGEVMQLTAAKNIETSEDEYLAVIRGKTAELFAAACEVGPVLAG 203

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              S + A ++YGMNLGIAFQL+DDVLDY G    +GKN+G+DFR GK TLP++LA +RG
Sbjct: 204 RPESEQAACRAYGMNLGIAFQLIDDVLDYGGTSAALGKNVGDDFREGKITLPIVLALRRG 263

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +  E+ FW+ T+     +  +L++A  I+  +RAL DT  RA+ YG +A+ +L   P   
Sbjct: 264 SDEERAFWRRTLEREDRAEGDLQQALAILSRHRALDDTIERAHHYGDQARAALEPFPQGP 323

Query: 306 WKKSLMEVVDFCLQRLN 322
            K +L++VVDFC+ R +
Sbjct: 324 MKAALLQVVDFCIARAH 340


>gi|319899203|ref|YP_004159296.1| octaprenyl-diphosphate synthase [Bartonella clarridgeiae 73]
 gi|319403167|emb|CBI76726.1| octaprenyl-diphosphate synthase [Bartonella clarridgeiae 73]
          Length = 338

 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 164/317 (51%), Positives = 225/317 (70%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DME +N LI+    S+VEMIP++  +LI SGGKR+RPM+TLA A M  Y+GD H+
Sbjct: 22  NLTKGDMESINQLIISMAKSNVEMIPEISNHLISSGGKRIRPMITLAAAHMFGYQGDKHI 81

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA A+EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF M+++  
Sbjct: 82  KLATAVEFMHTATLLHDDVVDESELRRGKSTARMIWGNQASVLVGDFLLGQAFKMMVDVG 141

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S EAL  L+  A  +AEGE+ QLS +KN++    +YL +I +KTA LFSAA EV  +IAG
Sbjct: 142 SLEALSVLANAAAIIAEGEVMQLSAAKNIETNVSNYLKIINAKTAALFSAAAEVGPIIAG 201

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             +  R AL  YG++LG+AFQL+DDVLDY      +GKNIG+DFR GK T+PVIL++ R 
Sbjct: 202 YGHEERSALHQYGLSLGVAFQLIDDVLDYSSSAQYLGKNIGDDFREGKITMPVILSYTRS 261

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
              EK FWK  + +   + E LK A  ++ +   L+DT  +A  YG++A D+L  + ++ 
Sbjct: 262 NDIEKTFWKQALENNHNNDEALKHAQQLIEKYDGLIDTIEQARIYGKRAIDALSSIKENP 321

Query: 306 WKKSLMEVVDFCLQRLN 322
            K +L++++DFC++R+N
Sbjct: 322 AKNALIDIIDFCIERVN 338


>gi|240850066|ref|YP_002971459.1| octaprenyl-diphosphate synthase [Bartonella grahamii as4aup]
 gi|240267189|gb|ACS50777.1| octaprenyl-diphosphate synthase [Bartonella grahamii as4aup]
          Length = 358

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 166/322 (51%), Positives = 227/322 (70%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L +LT KDME+VN  IL    S+VEMIP++  +LI SGGKRLRPM+TLA+A M  Y+
Sbjct: 37  LQSLVNLTQKDMERVNQFILSMAKSEVEMIPEISNHLISSGGKRLRPMITLASAHMFGYQ 96

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H+ LA A+EF+HTATLLHDDV+D+S LRRGK  AR++WGNQ SVLVGDFLL QAF M
Sbjct: 97  SDGHIKLATAVEFMHTATLLHDDVIDESNLRRGKSTARMIWGNQASVLVGDFLLGQAFKM 156

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL  L+  A  +AEGE+ QLS +KN+  +  DYL +I +KTA LFSAA EV 
Sbjct: 157 MVDVGSIEALSVLANAAAIIAEGEVMQLSAAKNIKTSPSDYLKIINAKTAALFSAAAEVG 216

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG  +  R +L+ YG +LG+AFQL+DD LDY G    +GKNIG+DFR GK T+PVI+
Sbjct: 217 PIVAGYGHKERSSLREYGTSLGLAFQLIDDALDYSGSAQNLGKNIGDDFREGKITMPVII 276

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A++RG   EKNFWK  + DG  + E    A  ++ +  ++ DT  +A  YG+ A D+L  
Sbjct: 277 AYERGNIVEKNFWKQALEDGNNNNEAFAYAQHLIEKYDSITDTIEQARIYGKHAIDALIP 336

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           + ++    +L+E V+FC+ R+N
Sbjct: 337 MNENLAYNALVETVEFCIARVN 358


>gi|163852524|ref|YP_001640567.1| polyprenyl synthetase [Methylobacterium extorquens PA1]
 gi|163664129|gb|ABY31496.1| Polyprenyl synthetase [Methylobacterium extorquens PA1]
          Length = 340

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 227/317 (71%), Gaps = 1/317 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGDNHV 65
           L    ME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A + +Y  GD  V
Sbjct: 24  LVAAGMERVNATILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACADLCDYGSGDGAV 83

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA A+EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++E  
Sbjct: 84  KLAAAVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMVEVG 143

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S  AL+ LS  A  +AEGE+ QL+ +KN++ +E++YL VI+ KTA LF+AA EV  ++AG
Sbjct: 144 SLRALDILSAAATVIAEGEVMQLTAAKNIETSEDEYLAVIRGKTAELFAAACEVGPVLAG 203

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              S + A ++YGMNLGIAFQL+DDVLDY G    +GKN+G+DFR GK TLP++LA +RG
Sbjct: 204 RPESEQAACRAYGMNLGIAFQLIDDVLDYGGTSAALGKNVGDDFREGKITLPIVLALRRG 263

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +  E+ FW+ T+     +  +L++A  I+  +RAL DT  RA+ YG +A+ +L   P   
Sbjct: 264 SDEERAFWRRTLEREDRAEGDLQEALAILSRHRALDDTIERAHHYGDQARAALEPFPQGP 323

Query: 306 WKKSLMEVVDFCLQRLN 322
            K +L++VVDFC+ R +
Sbjct: 324 MKAALLQVVDFCIARAH 340


>gi|319407551|emb|CBI81201.1| octaprenyl-diphosphate synthase [Bartonella sp. 1-1C]
          Length = 337

 Score =  345 bits (885), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 167/316 (52%), Positives = 223/316 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT +DME VN LI+    S+V +IP++  YLI SGGKR+RPM+TLATA M  Y+GD H+ 
Sbjct: 22  LTKEDMECVNQLIISMAQSNVAIIPEISNYLISSGGKRIRPMITLATAHMFGYQGDKHIK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ S+LVGDFLL QAF M+++  S
Sbjct: 82  LATAVEFMHTATLLHDDVVDESELRRGKSTARIIWGNQASILVGDFLLGQAFKMMVDVGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            +AL  LS  A  +AEGE+ QLS +KN++    DYL +I +KTA LFSAA EV  +IAG 
Sbjct: 142 LDALSVLSNAAAIIAEGEIMQLSAAKNIETNVSDYLKIINAKTAALFSAAAEVGPIIAGY 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
               R AL  YG++LG+AFQL+DDVLDY      +GKNIG+DFR GK T+PVIL++ RG 
Sbjct: 202 GPEERSALHQYGLSLGLAFQLIDDVLDYSSSAQYLGKNIGDDFREGKITMPVILSYTRGN 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             EK FWK  + +     E LK A  ++ +   L DT  +A  YG++A D+L  + D+  
Sbjct: 262 DIEKIFWKQALENNHNDDEALKHAQQLIEKYDGLTDTIEQARIYGKRAIDALSSIKDNPA 321

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L++++DFC++R+N
Sbjct: 322 KNALIDIIDFCIERIN 337


>gi|218531359|ref|YP_002422175.1| polyprenyl synthetase [Methylobacterium chloromethanicum CM4]
 gi|218523662|gb|ACK84247.1| Polyprenyl synthetase [Methylobacterium chloromethanicum CM4]
          Length = 340

 Score =  345 bits (885), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 227/320 (70%), Gaps = 1/320 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGD 62
           L  L    ME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A + +Y  GD
Sbjct: 21  LVSLVAAGMERVNATILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACADLCDYGSGD 80

Query: 63  NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVI 122
             V LA A+EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++
Sbjct: 81  GAVKLAAAVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMV 140

Query: 123 ETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSL 182
           E  S  AL+ LS  A  +AEGE+ QL+ +KN++ +E +YL VI+ KTA LF+AA EV  +
Sbjct: 141 EVGSLRALDILSAAATVIAEGEVMQLTAAKNIETSENEYLAVIRGKTAELFAAACEVGPV 200

Query: 183 IAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAF 242
           +AG   S + A ++YGMNLGIAFQL+DDVLDY G    +GKN+G+DFR GK TLP++LA 
Sbjct: 201 LAGRPESEQAACRAYGMNLGIAFQLIDDVLDYGGTSAALGKNVGDDFREGKITLPIVLAL 260

Query: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
           +RG+  E+ FW+ T+     +  +L++A  I+  +RAL DT  RA+ YG +A+ +L   P
Sbjct: 261 RRGSDEERAFWRRTLEREDRAEGDLQQALAILSRHRALDDTIERAHHYGDQARAALEPFP 320

Query: 303 DSSWKKSLMEVVDFCLQRLN 322
               K +L++VVDFC+ R +
Sbjct: 321 QGPMKAALLQVVDFCIARAH 340


>gi|121602666|ref|YP_988702.1| polyprenyl synthetase [Bartonella bacilliformis KC583]
 gi|120614843|gb|ABM45444.1| polyprenyl synthetase [Bartonella bacilliformis KC583]
          Length = 338

 Score =  344 bits (883), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 222/322 (68%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L +LT  DME+ N LI+  I S++EMIP++  +LI SGGKRLRPM+TLA A M  Y+
Sbjct: 17  LQPLINLTKDDMERANQLIISMIKSNIEMIPEICNHLISSGGKRLRPMITLAAAHMFGYQ 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ LA A+EF+HTATLLHDDVVD+S LRRGK  AR++WGNQ SVLVGDFLL QAF +
Sbjct: 77  GDEHIKLATAVEFMHTATLLHDDVVDESNLRRGKSTARMIWGNQASVLVGDFLLGQAFKI 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++ +S EAL  LS  A  +AEGE+ QL+ + N++    +YL +I +KTA LFSAA EV 
Sbjct: 137 MVDARSMEALAILSNAAAVIAEGEVMQLAAANNIENDISNYLKIINAKTAALFSAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG     R AL+ YG +LG+AFQL+DD LDY G+   +GKNIG+DFR  K T+PVI 
Sbjct: 197 PIIAGYGCEERSALRKYGTSLGLAFQLIDDALDYSGDAQHLGKNIGDDFREKKITMPVIF 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           ++ RG   EK FWK T  +   S E    A  +M +   + DT   A  YGQ A D+L  
Sbjct: 257 SYMRGNAVEKEFWKQTFKESNHSDEAFIHAQYLMEKYGCITDTIKHARIYGQHAIDALSS 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           + DS  K +L+EV+DFC+ R+N
Sbjct: 317 IKDSPAKSALIEVIDFCIARVN 338


>gi|49473966|ref|YP_032008.1| octaprenyl-diphosphate synthase [Bartonella quintana str. Toulouse]
 gi|49239469|emb|CAF25820.1| Octaprenyl-diphosphate synthase [Bartonella quintana str. Toulouse]
          Length = 356

 Score =  344 bits (883), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 166/322 (51%), Positives = 226/322 (70%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L +LT  DME+VN  IL    SD+EMIP++  +LI SGGKRLRPM+TLA+A M +Y+
Sbjct: 35  LQSLINLTKDDMERVNKFILSMAKSDIEMIPEISNHLISSGGKRLRPMITLASAHMFDYQ 94

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H+ LA A+EF+HTATLLHDDV+D+S LRRGK  AR++WGNQ S+LVGDFLL QAF +
Sbjct: 95  NDGHIKLATAVEFMHTATLLHDDVIDESNLRRGKSTARMIWGNQASILVGDFLLGQAFKL 154

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL  L+  A  +AEGE+ QLS  KN++ +  DYL +I +KTA LFSAA EV 
Sbjct: 155 MVDVGSIEALSVLANAAAIIAEGEVMQLSAVKNIETSTSDYLKIINAKTAALFSAAAEVG 214

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG +   R AL+ YG  LG+AFQL+DDVLDY G    +GKNIG+DFR GK T+PVIL
Sbjct: 215 PIIAGYKYKERFALREYGTLLGLAFQLIDDVLDYGGTAKHLGKNIGDDFREGKITMPVIL 274

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A+ RG   EK FWK  + +   + E    A  ++ +  +L DT  +A +YG++A ++L  
Sbjct: 275 AYARGNTAEKAFWKQALENCNNNDETFAHAQHLIEKYDSLTDTIEQARAYGKRATNALAS 334

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           + +S    +L+E VDFC+ R+N
Sbjct: 335 MNESPAHSALIETVDFCIARVN 356


>gi|300024374|ref|YP_003756985.1| polyprenyl synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526195|gb|ADJ24664.1| Polyprenyl synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 342

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/314 (52%), Positives = 222/314 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   D+E +N +IL +  SDVEMIP++  +LI SGGKRLRPML LA+A +  Y G+ H+ 
Sbjct: 27  LVADDLEAINRIILDKAVSDVEMIPELAHHLIDSGGKRLRPMLALASAKLCGYGGNGHIR 86

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
            A A+EF+HTATLLHDDVVD+SA RRG+  AR++WGNQ SVLVGDFLL QAF M ++  S
Sbjct: 87  TASAVEFMHTATLLHDDVVDESATRRGRKTARMIWGNQASVLVGDFLLGQAFKMFVDVGS 146

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L  +S  A T+AEGE+ QL+ +KN   TE+DYL +I +KTA LFSAA E  + +   
Sbjct: 147 LPVLRIMSNAAATIAEGEVMQLAAAKNTSTTEDDYLAIINAKTAALFSAAAESGAALTQR 206

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
               + AL+SYG NLG+AFQLVDD LDY G+ + +GK++G+DFR GK TLPVIL+F+RG+
Sbjct: 207 PPEEQSALRSYGKNLGLAFQLVDDALDYAGDSSRLGKSVGDDFREGKITLPVILSFRRGS 266

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW  TI DG I+  +L++A   MR+++A+  T  RA SYG  A+D+L   PDS  
Sbjct: 267 PEERQFWNRTIADGDINDGDLEQAVGFMRKHKAIEATFERARSYGAIARDALAIFPDSRE 326

Query: 307 KKSLMEVVDFCLQR 320
           K +L +V+ FC+ R
Sbjct: 327 KDALEQVIAFCIGR 340


>gi|49475216|ref|YP_033257.1| octaprenyl-diphosphate synthase [Bartonella henselae str.
           Houston-1]
 gi|49238021|emb|CAF27227.1| Octaprenyl-diphosphate synthase [Bartonella henselae str.
           Houston-1]
          Length = 356

 Score =  341 bits (875), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 221/322 (68%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L +LT  DME VN  I     SDVE+IP++  +LI SGGKRLRPMLTLA+A M  Y+
Sbjct: 35  LQSLVNLTKDDMEHVNQCIFSMAKSDVEIIPEISNHLISSGGKRLRPMLTLASARMFGYQ 94

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H+ LA A+EF+HTATLLHDDV+D+S LRRGK  AR++WGNQ S+LVGDFLL QAF M
Sbjct: 95  NDGHIKLATAVEFMHTATLLHDDVIDESNLRRGKSTARMIWGNQASILVGDFLLGQAFKM 154

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL  L+  A  +AEGE+ QLS +KN++ +  DYL +I +KTA LFSAA EV 
Sbjct: 155 MVDVGSIEALSVLANAAAIIAEGEVMQLSATKNIETSISDYLKIINAKTAALFSAAAEVG 214

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG  +  R AL+ YG  LG+AFQL+DD LDY G    +GKNIG+DFR GK T+PVIL
Sbjct: 215 PIIAGYGHEERLALREYGTFLGLAFQLIDDALDYGGTAKYLGKNIGDDFREGKITMPVIL 274

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A+ R    EK FWK  + +G  + E    A  ++ +  +L DT  +A SYG+ A  +L  
Sbjct: 275 AYARSNAVEKTFWKQALENGNSNDETFAHAQHLIEKYDSLTDTIEQARSYGKNATHALAA 334

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           + +S    +L+E VDFC+ R+N
Sbjct: 335 ISESPIHNALIETVDFCIARVN 356


>gi|188582542|ref|YP_001925987.1| polyprenyl synthetase [Methylobacterium populi BJ001]
 gi|179346040|gb|ACB81452.1| Polyprenyl synthetase [Methylobacterium populi BJ001]
          Length = 351

 Score =  339 bits (870), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 166/317 (52%), Positives = 226/317 (71%), Gaps = 1/317 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGDNHV 65
           L    ME+VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A +  Y  GD  V
Sbjct: 35  LVADGMERVNATILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACADLCGYGSGDGAV 94

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA A+EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++E  
Sbjct: 95  KLAAAVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMVEVG 154

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S  AL+ LS  A  +AEGE+ QL+ +KN + +E++YL VI+ KTA LF+AA EV  +++ 
Sbjct: 155 SLRALDILSAAATVIAEGEVMQLTAAKNTETSEDEYLAVIRGKTAELFAAACEVGPVLSQ 214

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              + + A ++YGMNLGIAFQL+DDVLDY G    +GKN+G+DFR GK TLP++LA +RG
Sbjct: 215 RPEAEQAACRAYGMNLGIAFQLIDDVLDYGGTSAALGKNVGDDFREGKITLPIVLALRRG 274

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +  E+ FW+ T+    +   +L++A  I+R +RAL +T  RA+ YG  A+++L   P+  
Sbjct: 275 SDEERAFWRRTLEREDLGEGDLEQALAILRRHRALDETIERAHHYGMMAREALAPFPNGP 334

Query: 306 WKKSLMEVVDFCLQRLN 322
            K +L++VVDFC+ R +
Sbjct: 335 MKSALLQVVDFCIARAH 351


>gi|170751717|ref|YP_001757977.1| polyprenyl synthetase [Methylobacterium radiotolerans JCM 2831]
 gi|170658239|gb|ACB27294.1| Polyprenyl synthetase [Methylobacterium radiotolerans JCM 2831]
          Length = 339

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 223/316 (70%), Gaps = 2/316 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG--DNH 64
           L    M +VN  IL R  SDV MIP+V  +LI SGGKRLRP+LTLA A +  Y G  +  
Sbjct: 22  LVADGMARVNTTILSRTGSDVAMIPEVANHLIASGGKRLRPILTLACAQLCGYAGATEGD 81

Query: 65  VLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIET 124
           V LA ++EF+HTATLLHDDVVD+S +RRG+VAAR+ WGN+ SVLVGDFLL QAF M++E 
Sbjct: 82  VKLAASVEFMHTATLLHDDVVDESDMRRGRVAARIKWGNEASVLVGDFLLGQAFRMMVEV 141

Query: 125 KSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIA 184
            S  AL+ LS  A  +AEGE+ QL+ +KNL+  E  YL VI+ KTA LF+AA EV  ++A
Sbjct: 142 GSLRALDILSAAATVIAEGEVMQLTNAKNLETDEAAYLAVIRGKTAELFAAACEVGPVLA 201

Query: 185 GVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQR 244
           G   + + A +SYGMNLGIAFQL+DDVLDY G   E+GKN+G+DFR GK TLP++LA++R
Sbjct: 202 GRPEAEQAAARSYGMNLGIAFQLIDDVLDYGGTSAELGKNVGDDFREGKITLPIVLAYRR 261

Query: 245 GTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDS 304
            ++ E+ FW+ T+  G+I   +L+ A  +++ + AL +T  RA+ YG +A+ +L   PD 
Sbjct: 262 ASEGERGFWRRTLQQGEIGETDLETALDLLQRHGALEETVARAHHYGAEARAALDIFPDG 321

Query: 305 SWKKSLMEVVDFCLQR 320
             K +L+  V+FC+ R
Sbjct: 322 PVKAALIGAVEFCVAR 337


>gi|90420152|ref|ZP_01228060.1| polyprenyl synthetase family protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335486|gb|EAS49236.1| polyprenyl synthetase family protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 337

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 166/316 (52%), Positives = 223/316 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           +T  DM +VN LIL    S+VE+IP++ ++LI SGGKRLRPMLT+A+AL  +YRGD HV 
Sbjct: 22  VTAPDMARVNDLILAMAGSNVELIPEIAEHLISSGGKRLRPMLTIASALAHDYRGDAHVK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S LRRGK  AR +WGNQ SVLVGDFLL QAF  ++E  S
Sbjct: 82  LAASVEFMHTATLLHDDVVDESDLRRGKKTARTIWGNQASVLVGDFLLGQAFKTMVEVGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  +  +AEGE+ QLS +K++  +E DYL VI +KTA LF+AA EV  +IAG 
Sbjct: 142 LTALDILSTASSVIAEGEVWQLSAAKHMTTSEADYLAVIDAKTAALFAAAAEVGPVIAGA 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             + R A++ YG +LG+AFQLVDDVLDY G    +GKN G+DFR GK TLPVILA+Q G 
Sbjct: 202 GEAERTAMRDYGRSLGLAFQLVDDVLDYGGTAAALGKNTGDDFREGKITLPVILAYQAGD 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             EK FW+  +  G+   + L +A  ++ ++ AL +T  RA  YG+ A  +   LP S  
Sbjct: 262 DTEKAFWREAMEGGRNDDKALARATALIHQHGALEETVQRARQYGEAAYAAASGLPQSPS 321

Query: 307 KKSLMEVVDFCLQRLN 322
           + +++ VV+FC+ R++
Sbjct: 322 RDAMLGVVEFCIDRVS 337


>gi|154251178|ref|YP_001412002.1| polyprenyl synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154155128|gb|ABS62345.1| Polyprenyl synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 339

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 164/317 (51%), Positives = 225/317 (70%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L+ L  K+M+ VN  I +R+ SDV M+P++  +LI SGGKRLRPMLT+A + +  Y G +
Sbjct: 21  LQALVAKEMQAVNEFIRERMASDVPMVPELASHLINSGGKRLRPMLTIAASRLCGYNGTD 80

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA  +EF+HTATLLHDDVVD+S +RRG   AR++WGNQ SVLVGDFLL +AF +++E
Sbjct: 81  HIKLAATVEFLHTATLLHDDVVDESDMRRGAKTARMLWGNQASVLVGDFLLGRAFKLMVE 140

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
           TKS  ALE ++  A  +AEGE+ QL+ +K+   TE+ YL VI++KTA LF+AA E+ ++I
Sbjct: 141 TKSLRALEIIADAASVIAEGEVMQLAAAKDTGTTEDAYLRVIQAKTAALFAAATEIGAVI 200

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           +    S   AL+SYG NLGIAFQLVDD LDY G    +GKN+G+DFR GK TLPV+LAF+
Sbjct: 201 SEKNGSEAAALESYGRNLGIAFQLVDDALDYGGRAASLGKNVGDDFREGKITLPVVLAFR 260

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG   E+ FW+ T+  G     +L+ A  +M ++ AL DT  RA  YG  A D+L   PD
Sbjct: 261 RGNAEERAFWERTLQQGDRQEGDLEHAVDLMNKHAALEDTILRARHYGAIANDALAIFPD 320

Query: 304 SSWKKSLMEVVDFCLQR 320
           S ++++L ++VDFC+ R
Sbjct: 321 SPYRQALTDLVDFCINR 337


>gi|312115019|ref|YP_004012615.1| polyprenyl synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220148|gb|ADP71516.1| Polyprenyl synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 338

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 227/316 (71%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   +M +VN +IL +  SDV +IP++ ++LI SGGKRLRPMLT+  A M  Y G  H++
Sbjct: 23  LVHDEMGEVNNIILSQARSDVALIPELARHLINSGGKRLRPMLTIGAAKMCGYEGTGHIM 82

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++EF+HTATLLHDDVVD+S +RRGK +AR++WGNQ SVLVGDFLL QAF M+++  S
Sbjct: 83  LAASVEFMHTATLLHDDVVDESDMRRGKKSARMLWGNQASVLVGDFLLGQAFRMMVDVGS 142

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             AL+ LS  +  +AEGE+ QL+ SKNL  TEE+YL+VI SKTA LF+AA E+ +++   
Sbjct: 143 LGALKVLSEASSVIAEGEVWQLAASKNLATTEEEYLNVIISKTAALFAAAAEIGAILTNR 202

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
               + AL+ YG N+G+AFQL+DD LDY GE   +GK +G+DFR GK TLPV+L+++RGT
Sbjct: 203 GPEEQAALRLYGTNIGLAFQLIDDALDYSGEAASLGKCVGDDFREGKITLPVVLSYRRGT 262

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW+ T+ +G I   +L+ A  IMR + A+ +T  RA  YG++A+++L   P    
Sbjct: 263 PEERAFWRRTLQEGSIEDGDLEHAIQIMRRHNAIEETIQRAVYYGKEAREALAIFPAGEA 322

Query: 307 KKSLMEVVDFCLQRLN 322
           +K+L++ VDF + R++
Sbjct: 323 RKALIDAVDFSIARMH 338


>gi|254470016|ref|ZP_05083420.1| geranylgeranyl pyrophosphate synthase [Pseudovibrio sp. JE062]
 gi|211960327|gb|EEA95523.1| geranylgeranyl pyrophosphate synthase [Pseudovibrio sp. JE062]
          Length = 337

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 225/322 (69%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L +L   DMEKVN LIL +  S+VE+IP++ ++LI SGGKRLRPMLTLA A M  Y 
Sbjct: 16  IQGLVELVSGDMEKVNELILSKAGSNVELIPEIARHLIDSGGKRLRPMLTLAFAQMFGYE 75

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV+LA ++EF+HTATLLHDDVVD+S +RRGK+AAR +WGNQ SVLVGD+LL QAF M
Sbjct: 76  GEGHVILAASVEFMHTATLLHDDVVDESDMRRGKLAARKLWGNQASVLVGDYLLGQAFKM 135

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++ +S EAL  LS  +  +AEGE+ QL  +++   T + YL VI++KTA LF+AA EVS
Sbjct: 136 MVDVRSLEALRILSEASAIIAEGEVLQLGAAQDTTTTYDMYLRVIEAKTAALFAAACEVS 195

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
             IA   + +R A + +G+ LG AFQLVDD LDY G   ++GK++G+DF  GK TLPVI 
Sbjct: 196 PEIADKGDEMRAAARKFGLELGYAFQLVDDALDYGGATVDLGKDVGDDFHEGKITLPVIY 255

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A +RG+  +K FWK  + DG I   +L  A  ++ +  AL DT  RA  YG  A D+L  
Sbjct: 256 AMERGSDEDKAFWKRCLEDGDIKDGDLDHAIKLLNDTGALADTVQRARDYGASAIDALSV 315

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
            PD   K++L E VDFC+ R++
Sbjct: 316 FPDGPAKQALKEAVDFCIARVS 337


>gi|118593444|ref|ZP_01550824.1| putative octaprenyl-diphosphate synthase protein [Stappia aggregata
           IAM 12614]
 gi|118433923|gb|EAV40581.1| putative octaprenyl-diphosphate synthase protein [Stappia aggregata
           IAM 12614]
          Length = 338

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/322 (51%), Positives = 227/322 (70%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DL    M +VN LIL +  S+VE+IP++ K+LI SGGKRLRPMLTLA A M  Y+
Sbjct: 17  IQPLVDLVSGGMGEVNELILSKAGSNVELIPEIAKHLISSGGKRLRPMLTLACADMFGYQ 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV LA ++EF+HTATLLHDDVVD+S +RRGK+AAR +WGNQ SVLVGD+LL QAF M
Sbjct: 77  GDGHVTLAASVEFMHTATLLHDDVVDESDMRRGKLAARKLWGNQASVLVGDYLLGQAFKM 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL  LS  +  +AEGE+ QL  +KN+  TE DYL VI++KTA LF+AA EV 
Sbjct: 137 MVDVGSLEALRILSTASAVIAEGEVLQLGAAKNIATTEADYLRVIEAKTAALFAAAAEVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG    +++A ++YGM LG AFQLVDD LDY G   ++GK++G+DFR GK TLPV+L
Sbjct: 197 PVIAGQSAEMKRAARTYGMELGYAFQLVDDALDYGGSSADLGKDVGDDFREGKITLPVVL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  RGT  +++FW+  +   +I   +L++A  ++ +  AL +T  RA  YG KA  +L  
Sbjct: 257 AVARGTDADRDFWRRCLEGEEIQDGDLEQAIELLNKYDALSETIERAKDYGNKALAALDT 316

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP  +   +L + V FC+ R++
Sbjct: 317 LPSGAHSDALGDAVAFCISRVS 338


>gi|328543228|ref|YP_004303337.1| Farnesyl pyrophosphate synthetase / geranyltranstransferase
           [polymorphum gilvum SL003B-26A1]
 gi|326412974|gb|ADZ70037.1| Farnesyl pyrophosphate synthetase / geranyltranstransferase
           [Polymorphum gilvum SL003B-26A1]
          Length = 336

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 223/322 (69%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L DL  +DME VN LIL +  S+V++IP++ K+LI SGGKRLRPMLTLA A M  Y+
Sbjct: 15  IQSLVDLVARDMEAVNRLILSKAGSNVDLIPEIAKHLIDSGGKRLRPMLTLALADMFGYQ 74

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV L+ ++EF+HTATLLHDDVVD+S +RRGK+AAR +WGNQ SVLVGD+LL QAF M
Sbjct: 75  GSGHVTLSASVEFMHTATLLHDDVVDESDMRRGKLAARKLWGNQASVLVGDYLLGQAFKM 134

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S EAL  L+  +  +AEGE+ QL  +KNL  +E  Y+ VI++KTA LF+AA EV 
Sbjct: 135 MVDVGSLEALRVLAEASAVIAEGEVMQLGAAKNLATSEASYMKVIEAKTAALFAAAAEVG 194

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG       A + YGM LG+AFQLVDD LDY G   ++GK +G+DFR GK TLPV++
Sbjct: 195 PIIAGQSAETCAAARRYGMELGLAFQLVDDALDYGGSSADLGKQVGDDFREGKITLPVVV 254

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A +RG+  ++ FW+  +    I   +L+ A  ++R + A+ +T  RA  YG  A ++L  
Sbjct: 255 AVERGSDEDRAFWRRCLETDGIRDGDLEHAIGLLRRHGAIEETIARARHYGASAIEALAA 314

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP    + +L E V+FC+ R+N
Sbjct: 315 LPAGRHRDALHEAVEFCISRVN 336


>gi|144898411|emb|CAM75275.1| Polyprenyl synthetase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 346

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 220/314 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   D+EKVN  I+ R+ S VE+IP +  ++I +GGKRLRP+LTLA+A +  + G+ HV 
Sbjct: 31  LVKDDLEKVNRTIIDRMHSPVELIPQLAGHIIAAGGKRLRPVLTLASAKLAGHSGERHVK 90

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+ +A  ++GN+ SVLVGDFL S++F +++E  S
Sbjct: 91  LAACVEFIHTATLLHDDVVDESELRRGQASANALFGNKPSVLVGDFLFSRSFELMVEDGS 150

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L  LS  +  +AEGE+ QL  + + D +E+ YL VI+SKTA LF+AA  + +++A  
Sbjct: 151 LPVLAILSRASSVIAEGEVLQLITANDTDTSEDSYLEVIRSKTAALFAAACRIGAIVADR 210

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   AL SYG+NLGIAFQL+DDVLDY  +   +GK +G+DFR GK TLP+ILAF+RG 
Sbjct: 211 PKAEEDALDSYGLNLGIAFQLIDDVLDYSAKQAVLGKTVGDDFREGKITLPIILAFRRGN 270

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++ FW+ T+   +    +L++A  +M ++ AL DT  RA  YG+ A+D+L   PDS  
Sbjct: 271 DEQREFWRRTVERLEQQDGDLEQAIALMEKHGALADTIARARHYGEVARDALALFPDSPV 330

Query: 307 KKSLMEVVDFCLQR 320
           K+++++V+DFC+ R
Sbjct: 331 KQAMIDVIDFCIDR 344


>gi|254503516|ref|ZP_05115667.1| polyprenyl synthetase superfamily [Labrenzia alexandrii DFL-11]
 gi|222439587|gb|EEE46266.1| polyprenyl synthetase superfamily [Labrenzia alexandrii DFL-11]
          Length = 318

 Score =  315 bits (806), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 161/317 (50%), Positives = 226/317 (71%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL    M  VN LIL +  S+V++IP++ K+LI SGGKRLRPMLTLA A M  Y+G  HV
Sbjct: 2   DLVAPGMADVNELILSKAGSNVDLIPEIAKHLISSGGKRLRPMLTLAFADMFGYQGSGHV 61

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
           +LA ++EF+HTATLLHDDVVD+S +RRGK+AAR +WGNQ SVLVGD+LL QAF M+++T 
Sbjct: 62  ILAASVEFMHTATLLHDDVVDESDMRRGKLAARKLWGNQASVLVGDYLLGQAFKMMVDTG 121

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S EAL  LS  +  +AEGE+ QL  SKN++ TE +YL VI++KTA LF+AA EV   IAG
Sbjct: 122 SLEALRILSEASAIIAEGEVLQLGASKNIETTEAEYLRVIEAKTAALFAAAAEVGPEIAG 181

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             + +R+A ++YG+ LG AFQ+VDD LDY G   ++GK++G+DFR GK TLPV+LA  RG
Sbjct: 182 QNDVMRKAARTYGLELGYAFQMVDDALDYGGSSADLGKDVGDDFREGKITLPVVLAVARG 241

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T +++ FWK  +    ++ ++L +A  ++++  A+ +T  RA +YG  A  +L  LP  +
Sbjct: 242 TDQDRAFWKRCMEGDNVTDDDLAEAIELLKKFDAIAETVQRARTYGDNALKALDQLPACA 301

Query: 306 WKKSLMEVVDFCLQRLN 322
              +L + V FC+ R++
Sbjct: 302 HTDALADAVAFCIARVS 318


>gi|241912483|gb|ACS71955.1| putative geranylgeranyl pyrophosphate synthase [Azospirillum
           brasilense]
          Length = 338

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 223/320 (69%), Gaps = 3/320 (0%)

Query: 4   LEDLTL---KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           L+DLT     D+  VN +I++R+ S V+MIP +  YLI +GGKRLRP+LTLA A +  Y+
Sbjct: 17  LDDLTALVADDLSAVNEIIVQRMHSSVDMIPQLAGYLIAAGGKRLRPVLTLAAAELCGYK 76

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H +LA  +EFIHTATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL S++F +
Sbjct: 77  GEDHKMLAAVVEFIHTATLLHDDVVDESDLRRGLASANAVFGNKASVLVGDFLFSRSFEL 136

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S + L  LS  +  +AEGE+ QL  + + + +E+ YL VIK+KTA LF+AA  V 
Sbjct: 137 MVEVGSLDVLRILSKASAVIAEGEVLQLRTTNDTETSEQAYLEVIKAKTAELFAAACRVG 196

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +   AL  YGMNLGIAFQLVDDVLDY  +  ++GK +G+DFR GK TLPV+L
Sbjct: 197 AVVAARPQAEELALYDYGMNLGIAFQLVDDVLDYSAKQAKLGKTVGDDFREGKITLPVVL 256

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AF+RG   E+ FW+ T+ +      +L++A  +M ++ AL DT  RA  YG  A+D+L  
Sbjct: 257 AFRRGNDEERAFWRRTMEELDQQEGDLERAQELMAKHNALKDTVERARHYGSIARDALGL 316

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            PD+  K +L+EV+DF ++R
Sbjct: 317 FPDTPVKAALLEVLDFVIER 336


>gi|288960115|ref|YP_003450455.1| octaprenyl-diphosphate synthase [Azospirillum sp. B510]
 gi|288912423|dbj|BAI73911.1| octaprenyl-diphosphate synthase [Azospirillum sp. B510]
          Length = 342

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/320 (50%), Positives = 217/320 (67%), Gaps = 3/320 (0%)

Query: 4   LEDLTL---KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           L+DLT    +D+  VN +IL R+ S VEMIP +  YLI +GGKRLRP+LTLA A +  Y+
Sbjct: 21  LDDLTALVAEDLSAVNQIILDRMQSQVEMIPQLAGYLIAAGGKRLRPVLTLAAANLCGYQ 80

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H LLA  +EFIH+ATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL S+AF M
Sbjct: 81  GEHHRLLAAVVEFIHSATLLHDDVVDESDLRRGMASANAVFGNKASVLVGDFLFSRAFEM 140

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E +S + L  LS  +  +AEGE+ QL  + + + +E+ YL VIK KTA LF+AA  V 
Sbjct: 141 MVEVQSLDVLRILSGASAIIAEGEVLQLRTTNDTETSEQAYLEVIKGKTAELFAAACRVG 200

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +   AL  YGMNLGIAFQLVDDVLDY     ++GK +G+DFR GK TLPV+L
Sbjct: 201 AVVANRPQAEELALYDYGMNLGIAFQLVDDVLDYSALQAKLGKTVGDDFREGKITLPVVL 260

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AF+RG   E+ FW+  + D      +L+ A  +M  + AL DT  RA  YG  A+DSL  
Sbjct: 261 AFRRGNDEERAFWRRVMEDLDQKDGDLEHAQTLMARHNALKDTVERARHYGSIARDSLGL 320

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
             D   K++L+EV+DF + R
Sbjct: 321 FADGPIKQALLEVIDFVIDR 340


>gi|103486007|ref|YP_615568.1| trans-hexaprenyltranstransferase [Sphingopyxis alaskensis RB2256]
 gi|98976084|gb|ABF52235.1| Trans-hexaprenyltranstransferase [Sphingopyxis alaskensis RB2256]
          Length = 337

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/314 (48%), Positives = 213/314 (67%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM +VN +IL R+ S+V +IP++  +LI  GGKR+RPMLTLA   +L+Y G  H  
Sbjct: 22  LVAADMNEVNAVILDRMQSEVPLIPELAGHLIAGGGKRMRPMLTLACGRLLDYPGRRHCK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRG+  A ++WGN  SVLVGDFL S+AF +++E  S
Sbjct: 82  LAAAVEFIHTATLLHDDVVDKSDLRRGRKTANVIWGNSASVLVGDFLFSRAFEVMVEDGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ LS  +  +AEGE+ QLS  + ++ +E+ YL +I +KTA LF+AA ++++++A  
Sbjct: 142 LKVLKILSRASAVIAEGEVNQLSAQRRIETSEDQYLAIINAKTAELFAAACKIAAVVAER 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   AL +YG NLGIAFQLVDD +DY  +   MGK +G+DFR+GK TLPVILA+ RG+
Sbjct: 202 DEATEAALDAYGRNLGIAFQLVDDAIDYVSDAETMGKGVGDDFRDGKVTLPVILAYARGS 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E++FWK  I   K S E+L  A  ++R++  + DT  RA  YGQ+A D++     S  
Sbjct: 262 AEERDFWKQAITGHKTSDEDLVYATSLLRKHDTIADTLARARHYGQRAVDAIGGFRASQA 321

Query: 307 KKSLMEVVDFCLQR 320
           K +L E V F + R
Sbjct: 322 KSALTEAVAFAVAR 335


>gi|83311261|ref|YP_421525.1| geranylgeranyl pyrophosphate synthase [Magnetospirillum magneticum
           AMB-1]
 gi|82946102|dbj|BAE50966.1| Geranylgeranyl pyrophosphate synthase [Magnetospirillum magneticum
           AMB-1]
          Length = 339

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 150/314 (47%), Positives = 220/314 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   D++KVN  I+ R+ S VEMIP +  ++I +GGKRLRP+LTLA+A +  + G+ H+ 
Sbjct: 24  LVKDDLQKVNHAIVDRMHSPVEMIPQLAGHIIAAGGKRLRPVLTLASAKLAGHTGERHIK 83

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+ +A  ++GN+ SVLVGDFL S++F +++E  S
Sbjct: 84  LAACVEFIHTATLLHDDVVDESELRRGQASANALFGNKPSVLVGDFLFSRSFELMVEDGS 143

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L  LS  +  +AEGE+ QL  + + + +E+ YL VI+SKTA LF+AA  + +++A  
Sbjct: 144 LSVLAILSRASSVIAEGEVLQLITANDTETSEDSYLEVIRSKTAALFAAACRIGAVVADR 203

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                +AL+SYG+NLGIAFQL+DDVLDY  +   +GK +G+DFR GK TLPVILAF+RG 
Sbjct: 204 PKVEEEALESYGLNLGIAFQLIDDVLDYSAKQAVLGKTVGDDFREGKITLPVILAFRRGG 263

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW+  + +   S E++ +A  +M ++ +L  T  RA  YG+ A+D+L   PDS  
Sbjct: 264 DEERAFWRRCLEELDQSDEDIGQAIKLMEKHGSLAATIARARHYGEIARDALGIFPDSPV 323

Query: 307 KKSLMEVVDFCLQR 320
           K+++++V+DFC+ R
Sbjct: 324 KQAMIDVIDFCIDR 337


>gi|83945354|ref|ZP_00957702.1| polyprenyl synthetase family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851188|gb|EAP89045.1| polyprenyl synthetase family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 351

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 211/317 (66%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L  L   DM  V  +I +R+ S    IP    YL+ +GGKR+RP++T+  A ML Y GD 
Sbjct: 33  LATLASDDMAAVEAVIEERMASATRSIPQTADYLVAAGGKRIRPLITVTAARMLGYEGDG 92

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV LA A+E+IH+ATLLHDDVVD+S LRRGK  A  VWGN  SVLVGDFL +++F M+++
Sbjct: 93  HVSLAAAVEYIHSATLLHDDVVDESELRRGKAPANTVWGNAHSVLVGDFLFARSFMMMVD 152

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S +AL  LS  A  +AEGE+RQL+  +N+D++ ++Y+ +I +KTA LFSAA +V+ ++
Sbjct: 153 AGSMDALHVLSRAASVIAEGEVRQLAAVRNIDISRDEYMSIIDAKTAALFSAAAQVAPIL 212

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
            G   ++   L++YG  LG+AFQLVDD LDY G   E+GKN G+DFR GK TLPV LA +
Sbjct: 213 YGSDKAIEDGLETYGRELGLAFQLVDDALDYGGMAAELGKNTGDDFREGKITLPVALAME 272

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
             + RE+ FWK  I+DG+ +  +  +A  I++++ AL  T   A ++   A ++L+  P 
Sbjct: 273 NASARERAFWKRVISDGEQTDADFDEALAILKKHGALDATLEAARTHAANAVNALKIAPQ 332

Query: 304 SSWKKSLMEVVDFCLQR 320
           + W ++L  + +F ++R
Sbjct: 333 NEWTEALAALPEFVVER 349


>gi|23014219|ref|ZP_00054047.1| COG0142: Geranylgeranyl pyrophosphate synthase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 339

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 220/314 (70%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   D+EKVN  I+ R+ S VE+IP +  ++I +GGKRLRP+LTLA+A +  + G+ H+ 
Sbjct: 24  LVKDDLEKVNRAIVDRMHSPVELIPQLAGHIIAAGGKRLRPVLTLASAKLAGHTGERHIK 83

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+ +A  ++GN+ SVLVGDFL S++F +++E  S
Sbjct: 84  LAACVEFIHTATLLHDDVVDESELRRGQASANALFGNKPSVLVGDFLFSRSFELMVEDGS 143

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L  LS  +  +AEGE+ QL  + + + +E+ YL VI+SKTA LF+AA  + +++A  
Sbjct: 144 LSVLAILSHASSVIAEGEVLQLITANDTETSEDSYLEVIRSKTAALFAAACRIGAVVADR 203

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                +AL+SYG+NLGIAFQL+DDVLDY  +   +GK +G+DFR GK TLPVILAF+RG 
Sbjct: 204 PKVEEEALESYGLNLGIAFQLIDDVLDYSAKQAVLGKTVGDDFREGKITLPVILAFRRGD 263

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW+  + +   +  ++ +A  +M ++ +L  T  RA  YG+ A+D+L   PDS+ 
Sbjct: 264 DEERAFWRRCLEELDQADNDIGRAIKLMEKHGSLAATIARARHYGEIARDALGIFPDSAV 323

Query: 307 KKSLMEVVDFCLQR 320
           K+++++V+DFC+ R
Sbjct: 324 KQAMIDVIDFCIDR 337


>gi|56551460|ref|YP_162299.1| polyprenyl synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543034|gb|AAV89188.1| Polyprenyl synthetase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 337

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 214/320 (66%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L  L   DM+ VN +IL R+ S+V +IP++  +LI SGGKR+RPML LA + ++   
Sbjct: 16  LKPLMHLVASDMQAVNQVILDRMQSEVPLIPELAGHLISSGGKRMRPMLMLACSRLIGEP 75

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H  LA AIEFIHTATLLHDDVVD S LRRGK  A  +WGN  +VLVGDFLLS+AF M
Sbjct: 76  RDIHYKLAAAIEFIHTATLLHDDVVDHSDLRRGKRTANNIWGNGPTVLVGDFLLSRAFEM 135

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E+ S  ALE LS  A  + +GE+ QL     ++  E  YL +I +KTAVLF+A+  ++
Sbjct: 136 MVESGSLRALEILSNAAAIITQGEVDQLVSQYQVETDEARYLSIIGAKTAVLFAASCRIA 195

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG      Q+L  YG  LGIAFQL DD +DY  +   MGK +G+DFR+GK TLPVIL
Sbjct: 196 AVMAGCSKDKEQSLADYGQYLGIAFQLTDDAIDYMSDSQTMGKGVGDDFRDGKVTLPVIL 255

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A+QRG K +++FW+  I   +++  +L  A I++    AL DT  RA  YG+KA  SL+ 
Sbjct: 256 AYQRGEKADRDFWREAIEGRRVADSDLDIAKILLVNTDALSDTLERARLYGEKAIQSLKA 315

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            PD + K++L+E V+F + R
Sbjct: 316 FPDGAVKEALVEAVEFTIAR 335


>gi|241761105|ref|ZP_04759194.1| Polyprenyl synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374724|gb|EER64185.1| Polyprenyl synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 337

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 214/320 (66%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L  L   DM+ VN +IL R+ S+V +IP++  +LI SGGKR+RPML LA + ++   
Sbjct: 16  LKPLMHLVASDMQAVNQVILDRMQSEVPLIPELAGHLISSGGKRMRPMLMLACSRLIGEP 75

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H  LA AIEFIHTATLLHDDVVD S LRRGK  A  +WGN  +VLVGDFLLS+AF M
Sbjct: 76  RDIHYKLAAAIEFIHTATLLHDDVVDHSDLRRGKRTANNIWGNGPTVLVGDFLLSRAFEM 135

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E+ S  ALE LS  A  + +GE+ QL     ++  E  YL +I +KTAVLF+A+  ++
Sbjct: 136 MVESGSLRALEILSNAAAIITQGEVDQLVSQYQVETDEARYLSIIGAKTAVLFAASCRIA 195

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG      Q+L  YG  LGIAFQL DD +DY  +   MGK +G+DFR+GK TLPVIL
Sbjct: 196 AVMAGCSKDKEQSLADYGQYLGIAFQLTDDAIDYMSDSQTMGKGVGDDFRDGKVTLPVIL 255

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A+QRG K +++FW+  I   +++  +L  A I++    AL DT  RA  YG+KA  SL+ 
Sbjct: 256 AYQRGEKADRDFWREAIEGRRVADSDLDIAKILLVNTDALSDTLERARLYGEKAIQSLKA 315

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            PD + K++L+E V+F + R
Sbjct: 316 FPDGAVKEALIEAVEFTIAR 335


>gi|260752929|ref|YP_003225822.1| trans-hexaprenyltranstransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552292|gb|ACV75238.1| Trans-hexaprenyltranstransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 337

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 213/320 (66%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L  L   DM+ VN +IL R+ S+V +IP++  +LI SGGKR+RPML LA + ++   
Sbjct: 16  LKPLMHLVASDMQAVNQVILDRMQSEVPLIPELAGHLISSGGKRMRPMLMLACSRLIGEP 75

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D H  LA AIEFIHTATLLHDDVVD S LRRGK  A  +WGN  +VLVGDFLLS+AF M
Sbjct: 76  RDIHYKLAAAIEFIHTATLLHDDVVDHSDLRRGKRTANNIWGNGPTVLVGDFLLSRAFEM 135

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E+ S  ALE LS  A  + +GE+ QL     ++  E  YL +I +KTAVLF+A+  ++
Sbjct: 136 MVESGSLRALEILSNAAAIITQGEVDQLVSQYQVETDEARYLSIIGAKTAVLFAASCRIA 195

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG      Q+L  YG  LGIAFQL DD +DY  +   MGK +G+DFR+GK TLPVIL
Sbjct: 196 AVMAGCSKDKEQSLADYGQYLGIAFQLTDDAIDYMSDSQTMGKGVGDDFRDGKVTLPVIL 255

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A+QRG K +++FW+  I   +++  +L  A I++    AL DT  RA  YG+KA  SL  
Sbjct: 256 AYQRGEKADRDFWREAIEGRRVADSDLDIAKILLVNTDALSDTLERARLYGEKAIQSLEA 315

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            PD + K++L+E V+F + R
Sbjct: 316 FPDGAVKEALIEAVEFTIAR 335


>gi|148556350|ref|YP_001263932.1| polyprenyl synthetase [Sphingomonas wittichii RW1]
 gi|148501540|gb|ABQ69794.1| Polyprenyl synthetase [Sphingomonas wittichii RW1]
          Length = 341

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 150/314 (47%), Positives = 208/314 (66%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN +IL R+ SDV +IP++  +LI  GGKR+RPMLTLA A +L+Y G+ H  
Sbjct: 26  LVAADMNAVNSVILARMQSDVPLIPELAGHLIAGGGKRMRPMLTLACAKLLDYAGERHHK 85

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD S LRRG+  A ++WGN  SVLVGDFL S++F +++E  S
Sbjct: 86  LAATVEFIHTATLLHDDVVDQSGLRRGRSTANMIWGNAASVLVGDFLFSRSFELMVEDGS 145

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L  LS  +  +AEGE+ QL+  + ++ +EE YL +I +KTAVLF+AA  +++++A  
Sbjct: 146 LRVLRILSNASAVIAEGEVNQLTAQRRIETSEERYLEIIAAKTAVLFAAACRIAAVVAER 205

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
           + +V +AL  YG  LGIAFQLVDDV+DY  +   MGK+ G+DFR+GK TLPVILA+ R  
Sbjct: 206 EPAVEEALDQYGRYLGIAFQLVDDVIDYVSDGATMGKDAGDDFRDGKVTLPVILAYARAE 265

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +++F +  I   +   E+L +A  I+R   AL DT  RA  Y Q+A D+L   P    
Sbjct: 266 AADRDFLREAIEGLRNEDEDLVRATGILRGTGALADTAARARHYAQRAIDALASFPAGQA 325

Query: 307 KKSLMEVVDFCLQR 320
           + +L+E   F + R
Sbjct: 326 RSALIEAAQFAVSR 339


>gi|296284709|ref|ZP_06862707.1| geranylgeranyl pyrophosphate synthase [Citromicrobium bathyomarinum
           JL354]
          Length = 340

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 206/314 (65%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT   M  VN +IL R+ S++ +IP +  +LI  GGKRLRPMLTLA A ++ Y G  H  
Sbjct: 25  LTASGMNAVNTVILDRMQSEIPLIPSLAGHLISGGGKRLRPMLTLAGAELVGYNGTRHHK 84

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S +RRGK AA +++GN  +VLVGDFL S+AF ++ E  S
Sbjct: 85  LAAAVEFIHTATLLHDDVVDGSEMRRGKAAANIIFGNPATVLVGDFLFSRAFELMTEDGS 144

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ LS  +  +AEGE+ QL+  + +  +E+ YL +I SKTA LF+AA  +++++A  
Sbjct: 145 LKVLKILSSASAIIAEGEVAQLTSQRKITTSEQRYLDIIGSKTAALFAAASRIAAVVAEC 204

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            ++  QAL  YG NLGIAFQLVDD LDY  +  EMGK+ G+DFR GK TLPVILA+ RG 
Sbjct: 205 SDAEEQALDDYGRNLGIAFQLVDDALDYSSDAAEMGKDRGDDFREGKMTLPVILAYARGD 264

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW++ I   + S E+L  A  ++  +  +  T  RA  + Q A D+L   PD   
Sbjct: 265 AEERKFWEAAILGHRTSDEDLAHAVSLVERHDCVTATRERARHFAQMAADALSIFPDGKA 324

Query: 307 KKSLMEVVDFCLQR 320
           +++++E   F + R
Sbjct: 325 REAMVEAAHFAVAR 338


>gi|254512243|ref|ZP_05124310.1| geranylgeranyl pyrophosphate synthase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535954|gb|EEE38942.1| geranylgeranyl pyrophosphate synthase [Rhodobacteraceae bacterium
           KLH11]
          Length = 332

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/320 (47%), Positives = 209/320 (65%), Gaps = 1/320 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD 62
           L +L   +ME VN LI  R+ SD    IP+V  +L+ +GGKRLRPMLTLA A + +Y GD
Sbjct: 13  LAELLAAEMEAVNGLIRTRMASDHAPRIPEVTAHLVEAGGKRLRPMLTLAAAQLFDYSGD 72

Query: 63  NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVI 122
           +H+ LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++
Sbjct: 73  HHIRLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMV 132

Query: 123 ETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSL 182
           ET S   L+ L+  + T+AEGE+ Q++ + +LD +E  YL V++ KTA LFSAA EV  +
Sbjct: 133 ETGSLRVLDILANASATIAEGEVLQMTAATDLDTSEAIYLQVVRGKTAALFSAATEVGGV 192

Query: 183 IAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAF 242
           IAG  +   +AL  YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI A 
Sbjct: 193 IAGASDEQVRALYDYGDALGIAFQIADDLLDYQGDSAATGKNVGDDFRERKLTLPVIKAV 252

Query: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
            + T  E  FW+ TI  G+    +L  A  +MR+   L  T   A  +  KAK +L+ LP
Sbjct: 253 AQATAEEHAFWERTIGRGRQEEGDLDHALSLMRKYGTLEATRADALGWATKAKTALQLLP 312

Query: 303 DSSWKKSLMEVVDFCLQRLN 322
           D   +  L  + D+ + RLN
Sbjct: 313 DHEIRNLLGALADYVVSRLN 332


>gi|307294472|ref|ZP_07574314.1| Polyprenyl synthetase [Sphingobium chlorophenolicum L-1]
 gi|306878946|gb|EFN10164.1| Polyprenyl synthetase [Sphingobium chlorophenolicum L-1]
          Length = 346

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 214/314 (68%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  + M +VN +IL R+ S + +IP++  +LI  GGKR+RPMLTLA A ++ Y G  H  
Sbjct: 31  LVAEGMNQVNAVILDRMQSRIPLIPELAGHLIAGGGKRMRPMLTLACADLVGYAGSRHYK 90

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRG+  A ++WGN  SVLVGDFL S++F +++E +S
Sbjct: 91  LAAAVEFIHTATLLHDDVVDGSGLRRGRKTANIIWGNSASVLVGDFLFSRSFELMVEAES 150

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ LS  +  +AEGE+ QL+  + +D +EE YL +I +KTA LF+AA  +S+++A  
Sbjct: 151 LKVLKILSNASAVIAEGEVNQLTAQRKIDTSEEQYLDIIGAKTAALFAAACRISAVVADR 210

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +  QAL  YG NLGIAFQL+DD +DY  +   MGK+ G+DFR+GK TLPVILA+ RG+
Sbjct: 211 DEAEEQALDVYGRNLGIAFQLIDDAIDYESDGATMGKDAGDDFRDGKVTLPVILAYARGS 270

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FWK+ I   ++S E+L  A  ++R+  A+ DT  RA  YGQ+A D+L    +   
Sbjct: 271 DEERTFWKAAIAGNRVSDEDLAHATGLLRKTGAIADTLARARHYGQRAIDALGMFDNGKA 330

Query: 307 KKSLMEVVDFCLQR 320
           K +L E V+F + R
Sbjct: 331 KAALTEAVEFAIAR 344


>gi|163792420|ref|ZP_02186397.1| Geranylgeranyl pyrophosphate synthase [alpha proteobacterium
           BAL199]
 gi|159182125|gb|EDP66634.1| Geranylgeranyl pyrophosphate synthase [alpha proteobacterium
           BAL199]
          Length = 340

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 211/317 (66%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L  L   +M KVN  IL+ + S V +IP +  +++ SGGKRLRPMLTLATA +  Y G+ 
Sbjct: 22  LRRLVDANMLKVNRAILEHMQSPVALIPQLAGHIVASGGKRLRPMLTLATAGLCGYTGER 81

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA  +EFIHTATLLHDDVVD+S LRRG+  A  VWGNQ SVLVGDFL S+AF +++ 
Sbjct: 82  HIGLAACVEFIHTATLLHDDVVDESDLRRGQDTANAVWGNQASVLVGDFLFSRAFQLMVG 141

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S + L+ LS  +  +AEGE+ QL  + ++D TE  YL VI+ KTA LF+AA ++  ++
Sbjct: 142 DGSLKVLKILSDASAIIAEGEVHQLITTNDIDTTEAAYLEVIRCKTAQLFAAAAQIGPVV 201

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A    +   AL+ +G +LG+AFQLVDDVLDY  E   +GK +G+DFR GK TLPVILA+Q
Sbjct: 202 AERPEAEEMALEGFGRDLGVAFQLVDDVLDYAAEQAALGKTVGDDFREGKVTLPVILAYQ 261

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G   E+ FWK TI D     ++L +A  +M ++  L  +  RA  Y   A+ +LR  P 
Sbjct: 262 AGDDPERAFWKRTIGDLDQRDDDLAEAQRLMAKHGTLEASLNRARDYADAAQAALRSFPA 321

Query: 304 SSWKKSLMEVVDFCLQR 320
           + ++ +L E+VDFC++R
Sbjct: 322 NPYRAALEELVDFCVER 338


>gi|294012754|ref|YP_003546214.1| octaprenyl-diphosphate synthase [Sphingobium japonicum UT26S]
 gi|292676084|dbj|BAI97602.1| octaprenyl-diphosphate synthase [Sphingobium japonicum UT26S]
          Length = 346

 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 214/314 (68%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  + M +VN +IL R+ S + +IP++  +LI  GGKR+RPMLTLA A ++ Y G  H  
Sbjct: 31  LVAEGMNQVNAVILDRMQSRIPLIPELAGHLIAGGGKRMRPMLTLACADLVGYAGSRHYK 90

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRG+  A ++WGN  SVLVGDFL S++F +++E +S
Sbjct: 91  LAAAVEFIHTATLLHDDVVDGSGLRRGRKTANIIWGNSASVLVGDFLFSRSFELMVEAES 150

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ LS  +  +AEGE+ QL+  + +D +EE YL +I +KTA LF+AA  +S+++A  
Sbjct: 151 LKVLKILSNASAVIAEGEVNQLTAQRKIDTSEEQYLDIIGAKTAALFAAACRISAVVADR 210

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +  QAL  YG NLGIAFQL+DD +DY  +   MGK+ G+DFR+GK TLPVILA+ RG+
Sbjct: 211 DEAEEQALDVYGRNLGIAFQLIDDAIDYESDGATMGKDAGDDFRDGKVTLPVILAYARGS 270

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FWK+ I   ++S E+L  A  ++R+  A+ DT  RA  YGQ+A D+L    +   
Sbjct: 271 DEERAFWKAAIAGNRVSDEDLAHATGLLRKTGAIADTLARARHYGQRAIDALGMFDNGKA 330

Query: 307 KKSLMEVVDFCLQR 320
           + +L E V+F + R
Sbjct: 331 RAALTEAVEFAIAR 344


>gi|326403627|ref|YP_004283709.1| octaprenyl-diphosphate synthase [Acidiphilium multivorum AIU301]
 gi|325050489|dbj|BAJ80827.1| octaprenyl-diphosphate synthase [Acidiphilium multivorum AIU301]
          Length = 344

 Score =  298 bits (763), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 205/310 (66%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+ + N  IL R+ SDVE+IP +  +LI +GGKRLRP+LTLA A +  YRG+ H+ LA  
Sbjct: 33  DLTETNRTILARMASDVELIPQLAAHLIAAGGKRLRPLLTLAAARLCGYRGERHIHLAAC 92

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL ++AF +++E  S + L
Sbjct: 93  VEFIHTATLLHDDVVDESGLRRGLASANAVFGNKASVLVGDFLFARAFELMVEDGSLDVL 152

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L   + T+AEGE+ QL+   +L      Y  VI+ KTA LF+AA EV  ++A   ++V
Sbjct: 153 RILCNASATIAEGEVLQLTTQNDLSTDIPRYFKVIEGKTAALFAAACEVGGVVADRDSAV 212

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LG+AFQLVDD LDY  + NE+GK +G+DFR GK T PV++A+  G   E+
Sbjct: 213 CGALAGYGAALGMAFQLVDDALDYAADQNELGKTVGDDFREGKLTYPVLVAYAAGDGPER 272

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW+ TI DG+ +  +L  A  ++R + A+  T   A ++ +KAKD+L  LPD   +  +
Sbjct: 273 AFWRRTIEDGEQTETDLATALDLIRRHDAIGQTIREADAFARKAKDALATLPDDPLRALM 332

Query: 311 MEVVDFCLQR 320
           ME  D+ + R
Sbjct: 333 MEAADYAVSR 342


>gi|209964973|ref|YP_002297888.1| octaprenyl-diphosphate synthase, putative [Rhodospirillum centenum
           SW]
 gi|209958439|gb|ACI99075.1| octaprenyl-diphosphate synthase, putative [Rhodospirillum centenum
           SW]
          Length = 340

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 210/314 (66%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   D+  VN  IL R+ S VE+IP +  Y++  GGKRLRP+LTLA A +  Y+G     
Sbjct: 25  LVADDLNAVNEQILSRMHSSVELIPQLGGYIVAGGGKRLRPVLTLAAAQLCGYQGTRQTA 84

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EF+HTATLLHDDVVD+S LRRG+ +A  V+GN+ SVLVGDFL ++AF +++E  S
Sbjct: 85  LAACVEFLHTATLLHDDVVDESDLRRGQASANAVFGNKASVLVGDFLFARAFQIMVEDGS 144

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L  L   +  +AEGE+ QL+ + + D TEE YL VIK+KTA LF+AA E+  ++A  
Sbjct: 145 LDVLRILCTASAVIAEGEVLQLTTTNDTDTTEEAYLEVIKAKTAELFAAACELGGIVADR 204

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
               + AL+SYGMNLGIAFQLVDDVLDY      +GK IG+DFR GK  LPV+LAF+RG 
Sbjct: 205 PAVEQAALRSYGMNLGIAFQLVDDVLDYSAVQARLGKTIGDDFREGKINLPVVLAFRRGD 264

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FW+ T+ D      +L+ A  +M  + AL D+  RA  YG  A+D+L   P+S  
Sbjct: 265 EEERQFWRRTMEDLDQRDGDLEHAIALMTRHNALHDSVERARHYGAVARDALEMFPNSRI 324

Query: 307 KKSLMEVVDFCLQR 320
           K +L++V+DF + R
Sbjct: 325 KHALLDVIDFVVSR 338


>gi|148260434|ref|YP_001234561.1| polyprenyl synthetase [Acidiphilium cryptum JF-5]
 gi|146402115|gb|ABQ30642.1| Polyprenyl synthetase [Acidiphilium cryptum JF-5]
          Length = 344

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 205/310 (66%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+ + N  IL R+ SDVE+IP +  +LI +GGKRLRP+LTLA A +  YRG+ H+ LA  
Sbjct: 33  DLTETNRTILARMASDVELIPQLAAHLIAAGGKRLRPLLTLAAARLCGYRGERHIHLAAC 92

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL ++AF +++E  S + L
Sbjct: 93  VEFIHTATLLHDDVVDESGLRRGLASANAVFGNKASVLVGDFLFARAFELMVEDGSLDVL 152

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L   + T+AEGE+ QL+   +L      Y  VI+ KTA LF+AA EV  ++A   ++V
Sbjct: 153 RILCNASATIAEGEVLQLTTQNDLSTDIPRYFKVIEGKTAALFAAACEVGGVVADRDSAV 212

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LG+AFQLVDD LDY  + NE+GK +G+DFR GK T PV++A+  G   E+
Sbjct: 213 CGALACYGAALGMAFQLVDDALDYAADQNELGKTVGDDFREGKLTYPVLVAYAAGDGPER 272

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW+ TI DG+ +  +L  A  ++R + A+  T   A ++ +KAKD+L  LPD   +  +
Sbjct: 273 AFWRRTIEDGEQTETDLATALDLIRRHDAIGQTIREADAFARKAKDALATLPDDPLRALM 332

Query: 311 MEVVDFCLQR 320
           ME  D+ + R
Sbjct: 333 MEAADYAVSR 342


>gi|114705279|ref|ZP_01438187.1| Polyprenyl synthetase [Fulvimarina pelagi HTCC2506]
 gi|114540064|gb|EAU43184.1| Polyprenyl synthetase [Fulvimarina pelagi HTCC2506]
          Length = 338

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 222/316 (70%), Gaps = 1/316 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR-GDNHV 65
           LT +DM +VN LIL    S VE+IP++  +LI SGGKRLRPMLT+A+AL   Y  GD HV
Sbjct: 22  LTQRDMGRVNDLILSMAGSRVELIPEIANHLISSGGKRLRPMLTIASALAHGYEEGDAHV 81

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA ++EF+HTATLLHDDVVD+S LRRG+  AR +WGNQ SVLVGD+LL QAF M+++  
Sbjct: 82  KLAASVEFMHTATLLHDDVVDESDLRRGRRTARTIWGNQASVLVGDYLLGQAFKMMVDVG 141

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S  AL  LS  +  +AEGE+ QL+ +K +  +E DYL V+ +KTA LF+AA EV  +IAG
Sbjct: 142 SMAALAILSDASAVIAEGEVWQLAAAKRMTTSEADYLSVVDAKTAALFAAAAEVGPVIAG 201

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                R+A++ YG +LGI+FQL+DDVLDY G   ++GKN G+DFR GK TLPVILA++ G
Sbjct: 202 KSMREREAMRRYGRSLGISFQLIDDVLDYGGVATDLGKNTGDDFREGKITLPVILAYEAG 261

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +  EK FW+S + +G+     L KA  ++  +  L  T  RA +YG +A ++   LP S 
Sbjct: 262 SDEEKAFWRSAMEEGRNDDLALAKAVDLIDRHGTLKATIDRARAYGAEAYEAAASLPPSL 321

Query: 306 WKKSLMEVVDFCLQRL 321
            +++L++VV+FC+ R+
Sbjct: 322 AREALLDVVEFCVARI 337


>gi|259415043|ref|ZP_05738965.1| octaprenyl-diphosphate synthase [Silicibacter sp. TrichCH4B]
 gi|259348953|gb|EEW60707.1| octaprenyl-diphosphate synthase [Silicibacter sp. TrichCH4B]
          Length = 336

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 215/322 (66%), Gaps = 1/322 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++L +    ++E VN LI +R+ S+    IP+V  +L+ +GGKRLRPMLTLA A M  Y 
Sbjct: 15  ELLAETLASELEAVNLLIQERMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARMCGYE 74

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA  +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L +++F +
Sbjct: 75  GDHHLKLAATVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARSFQL 134

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++T S   L+ L+  + T+AEGE+ Q++ + +L  TEE YL V++ KTA LFSAA EV 
Sbjct: 135 MVDTGSLRVLDILANASATIAEGEVLQMTAATDLRTTEEIYLQVVRGKTAALFSAATEVG 194

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IA   ++  +AL  YG  LGIAFQ+ DD+LDY+G+  + GKN+G+DFR  K TLPVI 
Sbjct: 195 GVIASATDAQVKALYDYGDALGIAFQIADDLLDYQGDTAKTGKNVGDDFRERKLTLPVIK 254

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  + T  E+ FW+ TI  G+    +L  A  +M +   L  T   A+ + +KAK +L  
Sbjct: 255 AIAQATDEERAFWQRTIAKGRQEEGDLDHALELMAKYATLDATRADAFGWAEKAKSALAE 314

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD   +  L+++ D+ + RLN
Sbjct: 315 LPDHPIRTMLIDLADYVVSRLN 336


>gi|254464181|ref|ZP_05077592.1| decaprenyl diphosphate synthase [Rhodobacterales bacterium Y4I]
 gi|206685089|gb|EDZ45571.1| decaprenyl diphosphate synthase [Rhodobacterales bacterium Y4I]
          Length = 328

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 210/322 (65%), Gaps = 1/322 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +ML     +++E VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A M  Y 
Sbjct: 7   EMLAATLSQELEAVNVLIRTRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARMCGYE 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+HV LA  +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L +++F +
Sbjct: 67  GDHHVKLAATVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARSFQL 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++ET+S   L+ L+  + T+AEGE+ Q++ + NL   E  YL V++ KTA LFSAA EV 
Sbjct: 127 MVETESLRVLDILANASATIAEGEVLQMTAASNLKTDEGIYLQVVRGKTAALFSAATEVG 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG   +  +AL  YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI 
Sbjct: 187 GVIAGAPETQVKALFEYGDALGIAFQIADDLLDYQGDSKATGKNVGDDFRERKLTLPVIK 246

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  + T  E+ FW  TI  GK    +L++A  +M +   L  T   A  +  KA+ +L  
Sbjct: 247 AVAQATDEERAFWTRTIEKGKQQDGDLEQALALMAKYGTLEATRQDALGWAAKARAALEV 306

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LPD   +  L ++ D+ + RLN
Sbjct: 307 LPDHEIRTMLSDLADYVVARLN 328


>gi|295688727|ref|YP_003592420.1| trans-hexaprenyltranstransferase [Caulobacter segnis ATCC 21756]
 gi|295430630|gb|ADG09802.1| Trans-hexaprenyltranstransferase [Caulobacter segnis ATCC 21756]
          Length = 341

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 212/319 (66%), Gaps = 5/319 (1%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG----D 62
           L   DM  VN LI +R+ SDV +IP + ++LI +GGKRLRP+LT+A A +    G    +
Sbjct: 21  LAETDMAGVNRLITERMQSDVPIIPALAEHLIAAGGKRLRPLLTVAAARLAASDGAGSDN 80

Query: 63  NHVL-LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           +H L LA A+EFIHTATLLHDDVVD SALRRGKVAA L+WG   SVLVGDFL ++AF ++
Sbjct: 81  DHCLKLAAAVEFIHTATLLHDDVVDGSALRRGKVAAHLIWGGAQSVLVGDFLFARAFELM 140

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +ET S +ALE L+  +  +AEGE+ QL  S +L++++  YL +I++KTA LF+AA E  +
Sbjct: 141 VETNSMKALEILARASRVIAEGEVMQLMRSHDLNLSQALYLEIIQAKTAELFAAASEAGA 200

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           + AGV  +   ALK+YG+NLG+AFQLVDD LDY G    +GKN G+DFR GK TLP++LA
Sbjct: 201 VSAGVDQTRADALKAYGLNLGLAFQLVDDALDYGGATETLGKNAGDDFREGKATLPLLLA 260

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
             R   RE  FW+  +   + +  + ++A  ++    AL  T   A  Y  KAK +L   
Sbjct: 261 IARSGPREAEFWERAVGRREQTEADFRRARELIIGTGALDATLDLATDYADKAKAALAIF 320

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P + W++SL  + DF + R
Sbjct: 321 PANDWRESLESLADFAVSR 339


>gi|296535664|ref|ZP_06897840.1| farnesyltranstransferase [Roseomonas cervicalis ATCC 49957]
 gi|296264015|gb|EFH10464.1| farnesyltranstransferase [Roseomonas cervicalis ATCC 49957]
          Length = 347

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 150/320 (46%), Positives = 204/320 (63%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  L  L  +D+E  N  I+ R+ S V++IP +  +LI +GGKRLRP+L LA A +  YR
Sbjct: 26  LTALVSLVQEDLEACNREIIARMQSPVQLIPQLAAHLIAAGGKRLRPLLVLAAARLCGYR 85

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV LA  +EFIHTATLLHDDVVD+S LRRG+ +A  ++GN+ SVLVGDFL ++AF +
Sbjct: 86  GQRHVGLAACVEFIHTATLLHDDVVDESDLRRGQASANAIFGNKASVLVGDFLFARAFQL 145

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S E L+ L   + T+AEGE+ QL +  +   TE  YL VI+ KTA LF+AA  V 
Sbjct: 146 MTADGSLEVLDILCGASATIAEGEVLQLVIQNDTSSTEAQYLEVIEGKTAALFAAATRVG 205

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +   AL++YG N GIAFQLVDD LDY  E   +GK +G+DFR GK TLPV+L
Sbjct: 206 AVVAERPKAEADALEAYGRNFGIAFQLVDDALDYSAEQERLGKTVGDDFREGKITLPVLL 265

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AF RG + EK FW+  + + +    +L  A  +M  +RA+ DT  RA  YG  A   L  
Sbjct: 266 AFARGDETEKTFWRRVLEEKRQEEGDLAHALSLMHRHRAIEDTIARARHYGDLALQGLAP 325

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
             D   K++L  VV+FC+ R
Sbjct: 326 FADGPEKQALAGVVEFCIAR 345


>gi|163745677|ref|ZP_02153037.1| octaprenyl-diphosphate synthase [Oceanibulbus indolifex HEL-45]
 gi|161382495|gb|EDQ06904.1| octaprenyl-diphosphate synthase [Oceanibulbus indolifex HEL-45]
          Length = 334

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 150/313 (47%), Positives = 204/313 (65%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM+ V+ LI +R+ S     IP+V  +L+ +GGKRLRPMLTLA A M  Y G  HV LA 
Sbjct: 22  DMQAVSALIRERMASKHAPRIPEVTAHLVEAGGKRLRPMLTLAAARMCGYGGPYHVHLAA 81

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W NQ+SVLVGD+L +++F ++ E  S   
Sbjct: 82  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNQSSVLVGDYLFARSFQLMTEPGSMPV 141

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +  LS  A T+AEGE+ QL+ ++NL   E  YL V++ KTA LFSAA EV  +IAG    
Sbjct: 142 MRILSNAAATIAEGEVLQLTAAQNLATDEAVYLQVVRGKTAALFSAATEVGGVIAGASTD 201

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  YG  LGIAFQ+VDD+LDY+G+    GKN+G+DFR  K TLPVI A  +    E
Sbjct: 202 QVKALYDYGDALGIAFQIVDDLLDYQGDTGATGKNVGDDFRERKLTLPVIKAVAKADAEE 261

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  GK    +L +A  I+ ++  L  T+  A+ + +KAK +L  LPD   K  
Sbjct: 262 RAFWVRTIEKGKQEDGDLDQALSILNKHATLAATQRDAHGWAEKAKAALAPLPDHDLKDM 321

Query: 310 LMEVVDFCLQRLN 322
           L+++ D+ + R++
Sbjct: 322 LIDLADYVVSRIS 334


>gi|119384763|ref|YP_915819.1| trans-hexaprenyltranstransferase [Paracoccus denitrificans PD1222]
 gi|119374530|gb|ABL70123.1| Trans-hexaprenyltranstransferase [Paracoccus denitrificans PD1222]
          Length = 333

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 214/313 (68%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM++VN LI +R+ S     IP+V  +L+ +GGKRLRPML LA A +  Y G++H+LLA 
Sbjct: 21  DMDRVNALIRERMASRHAPRIPEVTAHLVEAGGKRLRPMLVLAAARLCGYAGESHILLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
           A+EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++ +T+S + 
Sbjct: 81  AVEFIHTATLLHDDVVDESQQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMADTESMQV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +  L+  + T+AEGE+ QL+ ++++  TE+ Y+ +++ KTA LFSAA E  +++AG   +
Sbjct: 141 MRILANASATIAEGEVLQLTAAQDVSTTEDTYIQIVRGKTAALFSAATEAGAVVAGADPA 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           V++AL  YG  LGIAFQ+VDD+LDY G  + +GKN+G+DFR  K TLPVI A  R  + E
Sbjct: 201 VQRALFDYGDALGIAFQIVDDLLDYGGSTSSIGKNVGDDFRERKLTLPVIKAIARADEVE 260

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW+ TI  G+    +L  A  I+R   AL      A ++ Q+AK +L+  PD   ++ 
Sbjct: 261 RAFWERTIGQGQQDEADLATALEILRRREALEAARADAIAWAQRAKAALQAAPDQPLRRI 320

Query: 310 LMEVVDFCLQRLN 322
           L ++ DF + RL+
Sbjct: 321 LADLADFVVSRLS 333


>gi|94497263|ref|ZP_01303835.1| Farnesyltranstransferase [Sphingomonas sp. SKA58]
 gi|94423368|gb|EAT08397.1| Farnesyltranstransferase [Sphingomonas sp. SKA58]
          Length = 378

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 213/315 (67%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +L    M +VN +IL R+ S + +IP++  +LI  GGKRLRPMLTLA A ++ Y G  H 
Sbjct: 62  NLVADGMNQVNAVILDRMQSRIPLIPELAGHLIAGGGKRLRPMLTLACADLVGYAGARHY 121

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA A+EFIHTATLLHDDVVD S +RRG+  A ++WGN  SVLVGDFL S++F +++E +
Sbjct: 122 KLAAAVEFIHTATLLHDDVVDGSGMRRGRKTANIIWGNSASVLVGDFLFSRSFELMVEAE 181

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S + L+ LS  +  +AEGE+ QL+  + +D +EE YL +I +KTA LF+AA  +S+++A 
Sbjct: 182 SLKVLKILSGASAVIAEGEVNQLTAQRKIDTSEEQYLDIIGAKTAALFAAACRISAVVAD 241

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +  QAL  YG NLGIAFQL+DD +DY  +   MGK+ G+DFR+GK TLPVILA+ RG
Sbjct: 242 RSEAEEQALDVYGRNLGIAFQLIDDAIDYESDEATMGKDAGDDFRDGKVTLPVILAYARG 301

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           ++ ++ FWK+ I   ++S  +L  A  ++R+  A+ DT  RA  YGQ+A D+L       
Sbjct: 302 SEADRAFWKAAIAGHRVSDADLAHATGLLRQTGAIADTLARARHYGQRAIDALGMFDAGR 361

Query: 306 WKKSLMEVVDFCLQR 320
            K +L E V+F + R
Sbjct: 362 AKAALTEAVEFAIAR 376


>gi|260429621|ref|ZP_05783598.1| octaprenyl-diphosphate synthase [Citreicella sp. SE45]
 gi|260420244|gb|EEX13497.1| octaprenyl-diphosphate synthase [Citreicella sp. SE45]
          Length = 333

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 213/319 (66%), Gaps = 1/319 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD 62
           L +L  +DM  VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA+A +  Y G 
Sbjct: 14  LAELLSEDMGGVNALIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLASARLCGYEGP 73

Query: 63  NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVI 122
            HV LA  +EFIHTATLLHDDVVD+S+ RRG+  A L+W N++SVLVGD+L +++F +++
Sbjct: 74  YHVHLAATVEFIHTATLLHDDVVDESSQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMV 133

Query: 123 ETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSL 182
           E  +   L  LS  A T+AEGE+ QL+ +++L  TE+ YL V++ KTA LFSAA EV  +
Sbjct: 134 EPGNLRVLNILSNAAATIAEGEVLQLTAAQDLKTTEDIYLQVVRGKTAALFSAATEVGGV 193

Query: 183 IAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAF 242
           IAGV     QAL +YG  LGIAFQ+ DD+LDY+G+ +  GKN+G+DFR  K TLP+I A 
Sbjct: 194 IAGVPEEQVQALFTYGDALGIAFQIADDLLDYQGDSSATGKNVGDDFRERKLTLPLIKAV 253

Query: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
            R +  E+ FW  TI  G     +L+ A  ++  + AL DT   A ++ +KAKD++  LP
Sbjct: 254 ARASDEERAFWVRTIEKGDQRDGDLEHALELLNAHAALEDTRTDALAWAEKAKDAMTELP 313

Query: 303 DSSWKKSLMEVVDFCLQRL 321
            S  +  L+++ DF + RL
Sbjct: 314 QSELRDLLIDLADFVVARL 332


>gi|56695234|ref|YP_165582.1| decaprenyl diphosphate synthase [Ruegeria pomeroyi DSS-3]
 gi|56676971|gb|AAV93637.1| decaprenyl diphosphate synthase [Ruegeria pomeroyi DSS-3]
          Length = 332

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 213/322 (66%), Gaps = 1/322 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +ML     ++M  VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y+
Sbjct: 11  EMLAATLSQEMAAVNALIRTRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYQ 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++HV LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F +
Sbjct: 71  GEDHVKLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFARSFQL 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++ET S   L+ L+  A T+AEGE+ Q++ + +L   E  YL V++ KTA LFSAA EV 
Sbjct: 131 MVETGSLRVLDILANAAATIAEGEVLQMTAASDLRTDESVYLQVVRGKTAALFSAATEVG 190

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAGV  +  +AL  YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI 
Sbjct: 191 GVIAGVPEAQVRALFEYGDALGIAFQIADDLLDYQGDAKATGKNVGDDFRERKLTLPVIK 250

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  + T  E+ FW  TI  GK +  +L++A  +M +   L  T   A+++ +KA+ +L  
Sbjct: 251 AVAQATDEERAFWVRTIEKGKQAEGDLEQALALMEKYGTLAATRADAHAWAEKARTALEL 310

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP+   +  L ++ D+ + RL+
Sbjct: 311 LPNHEIRTMLSDLADYVVARLS 332


>gi|126740547|ref|ZP_01756234.1| decaprenyl diphosphate synthase [Roseobacter sp. SK209-2-6]
 gi|126718348|gb|EBA15063.1| decaprenyl diphosphate synthase [Roseobacter sp. SK209-2-6]
          Length = 332

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +ME VN LI  R+ S     IP+V  +L+ +GGKRLRPMLTLA A +  Y G++H+ LA 
Sbjct: 20  EMEAVNSLIQTRMASKHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYEGEHHIKLAA 79

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++ET S + 
Sbjct: 80  TVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMVETGSLKV 139

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ Q++ + NL   E  YL V++ KTA LFSAA EV  +IAG   +
Sbjct: 140 LDILANASATIAEGEVLQMTAASNLATDEAVYLQVVRGKTAALFSAATEVGGVIAGASET 199

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI A  + T  E
Sbjct: 200 EIKALFDYGDALGIAFQIADDLLDYQGDSKATGKNVGDDFRERKLTLPVIKAVAQATDEE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
             FW  TI  G+    +L++A  +M + + L  T   A ++  KA D+L  LP+   ++ 
Sbjct: 260 HAFWTRTIEKGRQEEGDLEQALALMAKYQTLEATRQDALNWAAKATDALTALPEHPIRQM 319

Query: 310 LMEVVDFCLQRLN 322
           L ++ D+ + RLN
Sbjct: 320 LHDLADYVVSRLN 332


>gi|332188683|ref|ZP_08390398.1| polyprenyl synthetase family protein [Sphingomonas sp. S17]
 gi|332011300|gb|EGI53390.1| polyprenyl synthetase family protein [Sphingomonas sp. S17]
          Length = 336

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 214/314 (68%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN +I+ R+ S++ +IP +  +LI  GGKR+RPMLTLA+A +L YRG +H +
Sbjct: 21  LVADDMNAVNQVIIDRMRSEIPLIPQLAGHLISGGGKRMRPMLTLASAQLLGYRGTSHHV 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRG+  A ++WGN  SVLVGDFL S++F ++++  S
Sbjct: 81  LAAAVEFIHTATLLHDDVVDGSDLRRGRRTANIIWGNPASVLVGDFLFSRSFQLMVDAGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L  LS  +  +AEGE+ QL+  + + + EE YL +I +KTA LF+AA  +++++A  
Sbjct: 141 LKVLNILSGASAVIAEGEVNQLTAVRQVGLPEERYLSIIDAKTAALFAAACRIAAVVAER 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   AL++YG NLGIAFQL+DD +DY  +   MGK+ G+DFR GK TLPVILA+ RG 
Sbjct: 201 PEAEELALEAYGRNLGIAFQLIDDAIDYVSDAGTMGKDAGDDFREGKMTLPVILAYARGN 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FWK  +   + S ++  +A  ++R++RA+ DT  RA  YG  A +++R   D   
Sbjct: 261 EEERAFWKDAVEGRRTSDQDFTRAIALVRKSRAVDDTMARARHYGGLAIEAIRGFADGPA 320

Query: 307 KKSLMEVVDFCLQR 320
           K +++E V+F + R
Sbjct: 321 KAAMIEAVEFAVAR 334


>gi|149187005|ref|ZP_01865313.1| geranylgeranyl pyrophosphate synthase [Erythrobacter sp. SD-21]
 gi|148829394|gb|EDL47837.1| geranylgeranyl pyrophosphate synthase [Erythrobacter sp. SD-21]
          Length = 338

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 213/314 (67%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT + M  VN +IL R+ S+V +IP +  +LI  GGKRLRPMLTLA A ++ Y G  H  
Sbjct: 23  LTAQGMNAVNQVILDRMQSEVPLIPALAGHLISGGGKRLRPMLTLAGAELVGYSGTRHHK 82

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRGK AA +++GN  +VLVGDFL S++F ++ E  S
Sbjct: 83  LAAAVEFIHTATLLHDDVVDGSDLRRGKAAANIIFGNPATVLVGDFLFSRSFELMTEDGS 142

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ LS  +  +AEGE+ QL+  + +D +E+ YLH+I++KTA LF+AA  +++++A  
Sbjct: 143 LKVLKILSGASAIIAEGEVDQLTAQRKIDTSEQRYLHIIRAKTAALFAAASRIAAVVAEC 202

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                Q+L  YG NLG+AFQLVDD LDY  +  EMGK+ G+DFR GK TLPVILA+ RG+
Sbjct: 203 SEEEEQSLDEYGRNLGVAFQLVDDALDYDSDAAEMGKDRGDDFREGKMTLPVILAYARGS 262

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FWK+ I   + S  +L +A  ++  + A+ DT+ RA  + Q+A D+L   PD   
Sbjct: 263 EEEREFWKAAIAGFRTSDSDLDEAIRLIEVHNAVADTKARARHFAQRAIDALSIFPDGKA 322

Query: 307 KKSLMEVVDFCLQR 320
           ++++ +   F + R
Sbjct: 323 RRAMTQAALFAVSR 336


>gi|85373560|ref|YP_457622.1| geranylgeranyl pyrophosphate synthase [Erythrobacter litoralis
           HTCC2594]
 gi|84786643|gb|ABC62825.1| geranylgeranyl pyrophosphate synthase [Erythrobacter litoralis
           HTCC2594]
          Length = 340

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 209/314 (66%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT   M  VN +IL R+ S++ +IP +  +LI  GGKRLRPMLTLA A ++ Y+G  H  
Sbjct: 25  LTASGMNAVNTVILDRMQSEIPLIPRLAGHLISGGGKRLRPMLTLAGAELVGYQGSRHHK 84

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S +RRGK AA +++GN  +VLVGDFL S+AF ++ E  S
Sbjct: 85  LAAAVEFIHTATLLHDDVVDGSEMRRGKAAANIIFGNPATVLVGDFLFSRAFELMTEDGS 144

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ LS  +  +AEGE+ QLS  + L+ +EE YL +I +KTA LF+AA  +S+++A  
Sbjct: 145 LRVLKILSNASAVIAEGEVAQLSAQRKLETSEERYLDIIGAKTAALFAAASRISAVVAEC 204

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            +S  +AL  YG NLG+AFQLVDD +DY  +  EMGK+ G+DFR GK TLPVILA+ RG 
Sbjct: 205 DDSHERALDDYGRNLGVAFQLVDDAIDYDSDAAEMGKDQGDDFREGKMTLPVILAYARGN 264

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FWK  I   + S  +L  A  ++  + AL DT  RA  + ++A D++   PDS  
Sbjct: 265 EDERAFWKDAIGGHRASDADLAHAITLIGRHNALEDTRTRARHFARRAIDAISIFPDSKA 324

Query: 307 KKSLMEVVDFCLQR 320
           ++++ E   F + R
Sbjct: 325 RQAMAEAALFAVAR 338


>gi|99078713|ref|YP_611971.1| farnesyltranstransferase [Ruegeria sp. TM1040]
 gi|99035851|gb|ABF62709.1| Farnesyltranstransferase [Ruegeria sp. TM1040]
          Length = 336

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 211/322 (65%), Gaps = 1/322 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++L +    ++E VN LI +R+ S     IP+V  +L+ +GGKRLRPMLTLA A M  Y 
Sbjct: 15  ELLAETLAPELEAVNLLIRERMASQHAPRIPEVTAHLVEAGGKRLRPMLTLAAARMCGYE 74

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H+ LA  +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L +++F +
Sbjct: 75  GEHHLKLAATVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARSFQL 134

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++T S   L+ L+  + T+AEGE+ Q++ + +L  TEE YL V++ KTA LFSAA EV 
Sbjct: 135 MVDTGSLRVLDILANASATIAEGEVLQMTAATDLGTTEEIYLQVVRGKTAALFSAATEVG 194

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG   +  +AL  YG  LGIAFQ+ DD+LDY+G+  + GKN+G+DFR  K TLPVI 
Sbjct: 195 GVIAGASEAQVKALFDYGDALGIAFQIADDLLDYQGDTAKTGKNVGDDFRERKLTLPVIK 254

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  +    E+ FW  TI  G+    +L+ A  +M +   L  T   A  +  KAK +L  
Sbjct: 255 AIAQAGDEERAFWHRTIAKGRQEEGDLEHALSLMAKYATLEATRADAIGWADKAKSALAD 314

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP+   +  L+++ D+ + RLN
Sbjct: 315 LPEHPIRTLLIDLADYVVSRLN 336


>gi|20429105|emb|CAD24417.1| decaprenyl diphosphate synthase [Paracoccus zeaxanthinifaciens]
          Length = 333

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 204/313 (65%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
            +ME VN LI +R+ S     IP+V  +LI +GGKRLRPMLTLA A +L Y G  HV LA
Sbjct: 20  PEMEAVNALIRERMASRHAPRIPEVTAHLIEAGGKRLRPMLTLAAAKLLGYGGPYHVHLA 79

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F +++E  S  
Sbjct: 80  ATVEFIHTATLLHDDVVDESRQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMVEPGSMR 139

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            LE LS  A T+AEGE+ QL+ +++L   E+ YL V++ KTA LFSAA EV  +IAGV +
Sbjct: 140 TLEILSNAAATIAEGEVLQLTAAQDLATNEDIYLQVVRGKTAALFSAATEVGGVIAGVPD 199

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
           +  +AL  YG  LGIAFQ+VDD+LDY G    + KN G+DFR  K TLPVI A  R T  
Sbjct: 200 AQVRALFDYGDALGIAFQIVDDLLDYGGTAEAIDKNTGDDFRERKLTLPVIKAVARATPE 259

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FW  TI  G     +L+ A  ++  + A+ D    A  +  +A+ SL+ LP+   + 
Sbjct: 260 ERAFWSRTIEKGDQKDGDLEHALELLARHGAMADARRDALDWAARARASLQILPEHPIRD 319

Query: 309 SLMEVVDFCLQRL 321
            L ++ DF ++R+
Sbjct: 320 MLSDLADFVVERI 332


>gi|167647338|ref|YP_001685001.1| polyprenyl synthetase [Caulobacter sp. K31]
 gi|167349768|gb|ABZ72503.1| Polyprenyl synthetase [Caulobacter sp. K31]
          Length = 322

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 205/320 (64%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  L  L   DM  V+ LI  R+ S+V +IP + ++LI +GGKRLRP+LT+ATA +    
Sbjct: 1   MDRLVRLAAADMAGVDALITARMQSEVPVIPALAEHLIAAGGKRLRPLLTVATARLAGSD 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
               + LA A+EFIHTATLLHDDVVD S LRRGKVAA L+WG   SVLVGDFL ++AF +
Sbjct: 61  NAACLKLAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGAAQSVLVGDFLFARAFEL 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++ET S  ALE L+  +  +AEGE+ QL+ S +L++++  YL +I +KTA LF+AA E  
Sbjct: 121 MVETSSMRALEILAKASRVIAEGEVLQLTRSHDLNLSQALYLEIIAAKTAELFAAASEAG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            + AGV     +AL++YGMNLG+AFQL DD LDY G    +GKN G+DFR GK TLP++L
Sbjct: 181 GVSAGVSADKSEALRAYGMNLGLAFQLADDALDYGGTTEALGKNAGDDFREGKATLPLLL 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  R   RE  FW+  I   + +  + ++A  ++    AL  T   A  Y  KAK +L  
Sbjct: 241 AIARSGPREAEFWERAIGRREQTEADFRRARELIVGTGALEATLDLASEYADKAKLALAS 300

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            P + W+ SL  + DF + R
Sbjct: 301 FPANDWRASLESLADFAVSR 320


>gi|87199374|ref|YP_496631.1| farnesyltranstransferase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135055|gb|ABD25797.1| Farnesyltranstransferase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 337

 Score =  289 bits (739), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 206/314 (65%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  + M  VN +IL R+ S + +IP +  +LI  GGKR+RPMLTLA+A +L Y G  H  
Sbjct: 22  LVAEGMNSVNAVILDRMQSRIPLIPTLAGHLIAGGGKRMRPMLTLASAALLGYGGSRHYK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S +RRGK  A +V+GN  +VLVGDFL S++F +++E  S
Sbjct: 82  LAAAVEFIHTATLLHDDVVDGSDMRRGKKTANIVYGNPATVLVGDFLFSRSFELMVEDGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L  LS  +  ++EGE+ QL   + +D TEE YL +I +KTA LFSAA  +++++A  
Sbjct: 142 LKVLRILSNASAVISEGEVDQLVAQRQIDTTEEMYLDIIAAKTAALFSAACRIAAVVAER 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            ++   AL +YG NLGIAFQL DD +DY  +  EMGK+ G+DFR GK TLPVILA+ RG 
Sbjct: 202 PDADELALDAYGRNLGIAFQLADDAIDYDSDAAEMGKDQGDDFREGKMTLPVILAYARGD 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E+ FW+  I   + S  +L  A  ++R + A+  T  RA  Y Q+A D++   P S+ 
Sbjct: 262 EEERGFWQQAIAGERSSDADLAHAISLIRRHDAVHATRERARMYAQRAIDAISGFPASAA 321

Query: 307 KKSLMEVVDFCLQR 320
           K ++ E  +F + R
Sbjct: 322 KAAMTEAAEFAVAR 335


>gi|83854856|ref|ZP_00948386.1| decaprenyl diphosphate synthase [Sulfitobacter sp. NAS-14.1]
 gi|83842699|gb|EAP81866.1| decaprenyl diphosphate synthase [Sulfitobacter sp. NAS-14.1]
          Length = 332

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM  VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y G  HV LA 
Sbjct: 20  DMTAVNDLIRDRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYDGPYHVHLAA 79

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L +++F ++ ET +   
Sbjct: 80  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMTETNNMRV 139

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  L+  + T+AEGE+ QL+ ++NL   E  YL V++ KTA LFSAA +V  +IA   ++
Sbjct: 140 LAILANASATIAEGEVLQLTAAQNLATDEGIYLQVVRGKTAALFSAATQVGGVIAAAPDA 199

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             QAL  YG  LGIAFQ+VDD+LDY+G+ N  GKNIG+DFR  K TLPVI A  +G   E
Sbjct: 200 QVQALFDYGDALGIAFQIVDDLLDYQGDPNATGKNIGDDFRERKLTLPVIKAIAKGDATE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  GK    +L+ A  ++  +  L +T+  A ++ ++AK +L  LPD    + 
Sbjct: 260 RAFWTRTIEKGKQEDGDLEHALSLLNAHGTLDETKAEALAWAEQAKTALNTLPDHELTQM 319

Query: 310 LMEVVDFCLQRLN 322
           L ++ D+ + R++
Sbjct: 320 LRDLADYVVARIS 332


>gi|83941379|ref|ZP_00953841.1| decaprenyl diphosphate synthase [Sulfitobacter sp. EE-36]
 gi|83847199|gb|EAP85074.1| decaprenyl diphosphate synthase [Sulfitobacter sp. EE-36]
          Length = 332

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM  VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y G  HV LA 
Sbjct: 20  DMTAVNDLIRDRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYDGPYHVHLAA 79

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L +++F ++ ET +   
Sbjct: 80  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMTETNNMRV 139

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  L+  + T+AEGE+ QL+ ++NL   E  YL V++ KTA LFSAA +V  +IA   ++
Sbjct: 140 LAILANASATIAEGEVLQLTAAQNLATDEGIYLQVVRGKTAALFSAATQVGGVIATAPDA 199

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             QAL  YG  LGIAFQ+VDD+LDY+G+ N  GKNIG+DFR  K TLPVI A  +G   E
Sbjct: 200 QVQALYDYGDALGIAFQIVDDLLDYQGDPNATGKNIGDDFRERKLTLPVIKAIAKGDAAE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  GK    +L+ A  ++  +  L +T+  A ++ ++AK +L  LPD    + 
Sbjct: 260 RAFWTRTIEKGKQEDGDLEHALSLLNAHGTLDETKAEALAWAEQAKTALNTLPDHDLTQM 319

Query: 310 LMEVVDFCLQRLN 322
           L ++ D+ + R++
Sbjct: 320 LRDLADYVVARIS 332


>gi|254488187|ref|ZP_05101392.1| geranylgeranyl pyrophosphate synthase [Roseobacter sp. GAI101]
 gi|214045056|gb|EEB85694.1| geranylgeranyl pyrophosphate synthase [Roseobacter sp. GAI101]
          Length = 332

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 149/322 (46%), Positives = 208/322 (64%), Gaps = 2/322 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +M E L + DM  VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y 
Sbjct: 12  RMAEYLAV-DMAAVNTLIRDRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAAHLCGYD 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV LA  +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L +++F +
Sbjct: 71  GPYHVHLAATVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARSFQL 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + ET +   L  LS  + T+AEGE+ QL+ ++NL   E  YL V++ KTA LFSAA EV 
Sbjct: 131 MTETNNMRVLAILSNASATIAEGEVLQLTAAQNLATDESVYLQVVRGKTAALFSAATEVG 190

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +IAG  ++  QAL  +G  LGIAFQ+VDD+LDY+G+ +  GKNIG+DFR  K TLPVI 
Sbjct: 191 GVIAGAPDAQVQALFDFGDALGIAFQIVDDLLDYQGDASATGKNIGDDFRERKLTLPVIK 250

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  R    E  FW  TI  G+    +L+ A  ++ ++  +  T   A ++  +AK +L  
Sbjct: 251 AVARADAEEHAFWTRTIEKGRQEDGDLEHALSLLHKHDTMTQTRAEAVAWANRAKAALDA 310

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP+   +  L ++ D+ + R+N
Sbjct: 311 LPEHGVRDMLRDLADYVVARIN 332


>gi|329848574|ref|ZP_08263602.1| polyprenyl synthetase family protein [Asticcacaulis biprosthecum
           C19]
 gi|328843637|gb|EGF93206.1| polyprenyl synthetase family protein [Asticcacaulis biprosthecum
           C19]
          Length = 339

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 205/317 (64%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +LT  DM KVN LI  R+ S+V +IP +  +LI +GGKRLRP+L +A A + E R DN
Sbjct: 21  LVNLTAADMVKVNSLITARMQSEVAVIPALADHLIAAGGKRLRPLLCVAAARLCEVRNDN 80

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H  L+ A+EFIHTATLLHDDVVD S+LRRGKVAA L+WG  +SVLVGDFL ++AF +++E
Sbjct: 81  HHKLSAAVEFIHTATLLHDDVVDSSSLRRGKVAAHLIWGAPSSVLVGDFLFARAFELMVE 140

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
           T S  AL+ LS  +  + +GE+ QL  + +L++++ DY+ +I SKTA LFSAA E  ++ 
Sbjct: 141 TGSLRALDILSKASAVITQGEVLQLMKAFDLNLSQADYIEIISSKTAALFSAASESGAVA 200

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG       AL SYG+NLG+AFQ+ DDVLDY+G+  ++GKN G+DF  GK TLP+ILA Q
Sbjct: 201 AGASEDKITALYSYGLNLGLAFQIQDDVLDYQGDAADLGKNAGDDFAEGKSTLPLILAMQ 260

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
                +  FW  TI + K    +   A  +M  + AL      A +Y  KA+ SL     
Sbjct: 261 ATKGTQDAFWARTIGERKQQDGDFAMAQDLMVSSGALDQARALARAYADKARASLSLFEP 320

Query: 304 SSWKKSLMEVVDFCLQR 320
             W+ +L  +  + + R
Sbjct: 321 GPWRTALENLALYSVDR 337


>gi|114766799|ref|ZP_01445733.1| decaprenyl diphosphate synthase [Pelagibaca bermudensis HTCC2601]
 gi|114540993|gb|EAU44051.1| decaprenyl diphosphate synthase [Roseovarius sp. HTCC2601]
          Length = 331

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 206/312 (66%), Gaps = 1/312 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM+ VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA+A +  Y G  HV LA 
Sbjct: 19  DMDGVNALIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLASARLCGYEGPFHVHLAA 78

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L ++AF +++E  +   
Sbjct: 79  TVEFIHTATLLHDDVVDESKQRRGRPTANLLWDNKSSVLVGDYLFARAFQLMVEPGNLRV 138

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  LS  A T+AEGE+ QL+ +++L   E+ YL V++ KTA LFSAA EV  +IAGV+  
Sbjct: 139 LNILSNAAATIAEGEVLQLTAAQDLRTNEDIYLQVVRGKTAALFSAATEVGGVIAGVEEE 198

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             QAL  YG  LGIAFQ+VDD+LDY+G+ +  GKN+G+DFR  K TLPVI A       E
Sbjct: 199 QVQALFDYGDALGIAFQIVDDLLDYQGDSSATGKNVGDDFRERKLTLPVIKAIAAADDEE 258

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FWK TI  G     +L+ A  ++ ++ AL  T   A ++  KAK S+  LP S  +  
Sbjct: 259 RAFWKRTIEKGDQQDGDLEHALALLNKHGALDATRADAQAWTDKAKASMEKLPQSELRDL 318

Query: 310 LMEVVDFCLQRL 321
           L+E+ DF + R+
Sbjct: 319 LVELADFVVSRV 330


>gi|83594282|ref|YP_428034.1| farnesyltranstransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83577196|gb|ABC23747.1| Farnesyltranstransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 360

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+++VN +I++R+ S + +IP +  ++I +GGKRLRP+LTLA+A +  Y G+ H  LA  
Sbjct: 47  DLKRVNEIIVERMHSPIALIPQLAGHIIAAGGKRLRPLLTLASARLCGYEGERHAQLAAC 106

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+ +A  +WGN+ SVLVGDFL S++F +++E    + L
Sbjct: 107 VEFIHTATLLHDDVVDESLLRRGRDSANALWGNKASVLVGDFLFSRSFELMVEDGVLKVL 166

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS  +  +AEGE+ QL  + ++  TE  YL VI+ KTA LF+AA  + +++A    + 
Sbjct: 167 GILSHASRVIAEGEVAQLITANDMATTEAQYLEVIRGKTAQLFAAACRIGAVVAERPEAE 226

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL +YGM LGIAFQLVDD LDY     ++GK +G+DF +GK TLPVILA+QRGT  E+
Sbjct: 227 EEALDTYGMTLGIAFQLVDDYLDYSARQQDLGKTVGDDFMDGKITLPVILAYQRGTDDER 286

Query: 251 NFWKSTI--NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
            FW+  +   D     ++L KA  +M     L +T  RA  YG++A+ +L    D   K 
Sbjct: 287 AFWRRCMEAQDMAEPEKDLAKAIELMTRYGTLAETVERARHYGERARSALDIFADGPAKA 346

Query: 309 SLMEVVDFCLQR 320
           +L  +VDFC++R
Sbjct: 347 ALAGIVDFCIER 358


>gi|254462754|ref|ZP_05076170.1| geranylgeranyl pyrophosphate synthase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679343|gb|EDZ43830.1| geranylgeranyl pyrophosphate synthase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 333

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 207/313 (66%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           D+  VN LI +R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y G  HV LA 
Sbjct: 21  DLNAVNVLIQQRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAAHLCGYDGPYHVHLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++ET S   
Sbjct: 81  TVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMVETGSMRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ QL+ S++L  TE  YL V++ KTA LFSAA EV  +IAG   +
Sbjct: 141 LDILANASATIAEGEVLQLTASQDLSTTEAIYLQVVRGKTAALFSAATEVGGVIAGADEA 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  YG  LGIAFQ+VDD+LD  G+   +GKNIG+DFR  K TLP+I A  +    E
Sbjct: 201 HVKALFDYGDALGIAFQIVDDLLDMSGDAGAIGKNIGDDFREKKLTLPLIKAIAKADAEE 260

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW+ TI  G+    +L+ A  ++ ++ AL DT   A ++ +KA  ++  LP    ++ 
Sbjct: 261 RAFWERTIEKGRQEDGDLETAIALLHKHGALDDTRDEALAWAEKAVKAIDYLPAHPVREM 320

Query: 310 LMEVVDFCLQRLN 322
           L ++ D+ + R+N
Sbjct: 321 LRDLADYVVARIN 333


>gi|114771291|ref|ZP_01448711.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [alpha
           proteobacterium HTCC2255]
 gi|114548216|gb|EAU51103.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [alpha
           proteobacterium HTCC2255]
          Length = 329

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICSDV-EMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM KVN LI KR+ SD    IP+V ++LI +GGKRLRP+LTLA A M       H+ LA 
Sbjct: 17  DMVKVNSLIKKRMASDAAPRIPEVTEHLIDAGGKRLRPLLTLAAAEMCGNTSPYHIHLAA 76

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W NQ+SVLVGD+L S++F +++ET +   
Sbjct: 77  TVEFIHTATLLHDDVVDESKQRRGRPTANLLWDNQSSVLVGDYLFSRSFQLMVETGNLRV 136

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ QL++++NL  TE+ YL VI+ KTA LF AA +V  +I+  +  
Sbjct: 137 LDILANASATIAEGEVLQLTVAQNLSTTEDTYLKVIRGKTAALFGAACKVGGVISNAEEK 196

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           +  AL SYG  LG+ FQ+ DD+LDY G   ++GK+IG+DFR  K +LP+I   ++    E
Sbjct: 197 IIDALASYGDALGVCFQITDDLLDYNGSSADLGKSIGDDFRERKMSLPLIKVLKKSDVTE 256

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           K FWK TI  G    ++L  A  +M ++ AL DT   A  + +KAK S+  LP S  +  
Sbjct: 257 KEFWKRTIEKGDQQDDDLDFALKLMTKHNALKDTHNDAKFWAEKAKKSISILPKSKLRNI 316

Query: 310 LMEVVDFCLQRLN 322
           L E+ DF + RL+
Sbjct: 317 LTELPDFVVNRLS 329


>gi|163741857|ref|ZP_02149247.1| decaprenyl diphosphate synthase [Phaeobacter gallaeciensis 2.10]
 gi|161385030|gb|EDQ09409.1| decaprenyl diphosphate synthase [Phaeobacter gallaeciensis 2.10]
          Length = 332

 Score =  285 bits (729), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 203/316 (64%), Gaps = 2/316 (0%)

Query: 8   TLKD-MEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           TL D M  VN LI  R+ S     IP+V  +L+ +GGKRLRPMLTLA A +  Y GDNHV
Sbjct: 16  TLSDEMAAVNTLIQTRMASKHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYSGDNHV 75

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F +++ET 
Sbjct: 76  KLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMVETG 135

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ L+  + T+AEGE+ Q++ + +L   EE YL V++ KTA LFSAA +   ++A 
Sbjct: 136 SLRVLDILANASATIAEGEVLQMTAASDLATDEEIYLQVVRGKTAALFSAATQAGGVVAN 195

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +   AL +YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI A  + 
Sbjct: 196 APETQIDALFAYGDALGIAFQIADDLLDYQGDSAATGKNVGDDFRERKLTLPVIKAVAQA 255

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  E+ FW  TI  G+    +L  A  +M +   L  T + A  +  KA+D+L  LPD  
Sbjct: 256 TAEERGFWVRTIEKGRQDEGDLDHALALMDKYGTLTATRHDAMDWVGKAQDALTALPDDP 315

Query: 306 WKKSLMEVVDFCLQRL 321
            ++ L ++ D+ + RL
Sbjct: 316 IRQMLHDLADYVVARL 331


>gi|260431561|ref|ZP_05785532.1| octaprenyl-diphosphate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415389|gb|EEX08648.1| octaprenyl-diphosphate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 332

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 210/320 (65%), Gaps = 1/320 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD 62
           L +L   +M+ VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y GD
Sbjct: 13  LAELLAGEMDAVNTLIRTRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLFGYGGD 72

Query: 63  NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVI 122
           +H+ LA  +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L S++F +++
Sbjct: 73  HHIRLAATVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMV 132

Query: 123 ETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSL 182
           ET S   L+ L+  + T+AEGE+ Q++ + +L   E  YL V++ KTA LFSAA EV  +
Sbjct: 133 ETGSLRVLDILANASATIAEGEVLQMTAATDLRTDEAVYLQVVRGKTAALFSAATEVGGV 192

Query: 183 IAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAF 242
           IAG      +AL +YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI A 
Sbjct: 193 IAGASEEQVRALFAYGDALGIAFQIADDLLDYQGDSKATGKNVGDDFRERKLTLPVIKAV 252

Query: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
            + T  E+ FW+ TI  G+    +L+ A  +MR+ R L  T   A  +  KAK +L  LP
Sbjct: 253 AQATPEERAFWERTIEKGRQQEGDLEHALGLMRKYRTLEATRADALGWAAKAKAALAVLP 312

Query: 303 DSSWKKSLMEVVDFCLQRLN 322
           D   +  L ++ D+ + RLN
Sbjct: 313 DHEIRDLLRDMADYVVARLN 332


>gi|307824936|ref|ZP_07655158.1| Polyprenyl synthetase [Methylobacter tundripaludum SV96]
 gi|307733983|gb|EFO04838.1| Polyprenyl synthetase [Methylobacter tundripaludum SV96]
          Length = 336

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 203/317 (64%), Gaps = 2/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ LT  + + V+ LI+  + SDV +I  +  Y++ SGGKRLRPML L  A  L    DN
Sbjct: 20  IKKLTTAEAKAVDQLIINELSSDVVLINQMGHYIVGSGGKRLRPMLLLLAAKALGGANDN 79

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+L+A  IEFIHTATLLHDDVVDDS LRRGK +A  VWGN  S+LVGD+L S AF M++ 
Sbjct: 80  HLLMAAVIEFIHTATLLHDDVVDDSDLRRGKESANAVWGNAASILVGDYLYSSAFEMMVR 139

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
           T +   +E LS     +AEGE+ QL    N + TE+ YL VI  KTA+LFSAA +++++I
Sbjct: 140 TGNMRVMEILSKTTTAIAEGEVLQLLNCNNPETTEQKYLEVIARKTAILFSAATKLAAVI 199

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG      Q L  YG +LGIAFQL+DD LDY+   +E+GKN+G+D   GKPTLP+I A Q
Sbjct: 200 AGASTETEQGLSLYGQHLGIAFQLIDDALDYKASKDELGKNLGDDLAEGKPTLPLIYAIQ 259

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G++ E       I +G   V N  + + I++  +A+  TE RA    QKA  +L  LPD
Sbjct: 260 NGSESEAKIIIDAIKNGDRDVFN--EVYAIVQSTKAIDYTEQRADEEAQKAISALSVLPD 317

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L  +  F +QR
Sbjct: 318 SEYKQALTLLAMFSVQR 334


>gi|149378271|ref|ZP_01895982.1| Trans-hexaprenyltranstransferase [Marinobacter algicola DG893]
 gi|149357436|gb|EDM45947.1| Trans-hexaprenyltranstransferase [Marinobacter algicola DG893]
          Length = 322

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 202/317 (63%), Gaps = 2/317 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           D    D  +VN LI+KR+ SDV ++  + +Y+I SGGKRLRP+L L ++  L Y  D H+
Sbjct: 8   DTVADDFSRVNDLIIKRLSSDVPLVEKIAQYIIESGGKRLRPLLVLLSSRALGYNKDEHL 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL ++AF M++E +
Sbjct: 68  KLAAVIEFLHTATLLHDDVVDTSDMRRGRSTANARWGNAPSVLVGDFLYARAFEMMVELQ 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           + + ++ LS     +AEGE+ QL   KN DV+E+ Y+ VI +KTA+LF AA    +L+AG
Sbjct: 128 NLKIMDVLSHATAVIAEGEVLQLMNVKNPDVSEDKYMEVIHNKTAMLFEAASHTGALLAG 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              S  QAL +YG +LG+AFQLVDDVLDYRG+   MGKN+G+D   GKPTLP+I A   G
Sbjct: 188 ANGSQEQALSAYGKHLGLAFQLVDDVLDYRGDAEAMGKNVGDDLAEGKPTLPLIYAMANG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +  EK   +  +  G   +++L +   I+  + AL  T  RA    + A D L  LP+S 
Sbjct: 248 SDDEKQLIRQAVRKG--GLDDLARILDIVNRSGALEYTMERAKGEAKAALDCLETLPESD 305

Query: 306 WKKSLMEVVDFCLQRLN 322
            + +L  + D  + R++
Sbjct: 306 HRNALALLTDVAVARVS 322


>gi|86139019|ref|ZP_01057590.1| decaprenyl diphosphate synthase [Roseobacter sp. MED193]
 gi|85824250|gb|EAQ44454.1| decaprenyl diphosphate synthase [Roseobacter sp. MED193]
          Length = 332

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 206/317 (64%), Gaps = 2/317 (0%)

Query: 8   TLKD-MEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           TL D ME VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y G +HV
Sbjct: 16  TLSDEMEAVNTLIQTRMASEHAPRIPEVTAHLVGAGGKRLRPMLTLAAARLCGYEGAHHV 75

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++ET 
Sbjct: 76  KLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMVETG 135

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S + L+ L+  + T+AEGE+ Q++ + NL   E  YL V++ KTA LFSAA +V  +IA 
Sbjct: 136 SLQVLDILANASATIAEGEVLQMTAASNLATDEAVYLQVVRGKTAALFSAATQVGGVIAA 195

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +  + L  YG  LGIAFQ+ DD+LDY+G+    GKNIG+DFR  K TLPVI A  + 
Sbjct: 196 APETQIKGLFDYGDALGIAFQIADDLLDYQGDAATTGKNIGDDFRERKLTLPVIKAVAQA 255

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  E+ FW  TI  G+    +L++A  +M +   L  T   A  + +KA ++L  LPD  
Sbjct: 256 TDEERAFWIRTIEKGQQQEGDLEQALALMAKYGTLEATRQDALLWAEKATEALSALPDHP 315

Query: 306 WKKSLMEVVDFCLQRLN 322
            ++ L ++ ++ + RL+
Sbjct: 316 IRQMLHDLAEYVVSRLH 332


>gi|326385511|ref|ZP_08207150.1| farnesyltranstransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326210050|gb|EGD60828.1| farnesyltranstransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 337

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 201/314 (64%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L    M  VN +IL R+ S + +IP +  +LI  GGKR+RPMLTLA A ++ Y G  H  
Sbjct: 22  LVADGMNSVNAVILDRMQSRIPLIPALAGHLIAGGGKRMRPMLTLAGAELVGYGGSRHYK 81

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S +RRGK AA +++GN  +VLVGDFL S++F +++E  S
Sbjct: 82  LAAAVEFIHTATLLHDDVVDGSDMRRGKKAANIIYGNPATVLVGDFLFSRSFELMVEDGS 141

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L  LS  +  + EGE+ QL   + ++ +EE YL +I  KTA LF+AA  +++++A  
Sbjct: 142 IKVLRILSNASAIITEGEVDQLIAQREIETSEERYLAIINGKTAALFAAACRIAAVVAER 201

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                 AL +YG +LG AFQL DD +DY  + + MGK+ G+DFR GK TLPVILA+ RG 
Sbjct: 202 PEDEELALDAYGRHLGTAFQLADDAIDYDSDADVMGKDKGDDFREGKMTLPVILAYARGN 261

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+ FW+  I   +    +L  A  ++R++ A++ T  RA  Y Q+A D++   P S+ 
Sbjct: 262 AEEREFWRRAIAGERNGEADLAHAIELIRKHDAVLATRERARHYAQRAIDAIASFPASAA 321

Query: 307 KKSLMEVVDFCLQR 320
           K +++E  +F + R
Sbjct: 322 KSAMIEAAEFAVAR 335


>gi|114570734|ref|YP_757414.1| trans-hexaprenyltranstransferase [Maricaulis maris MCS10]
 gi|114341196|gb|ABI66476.1| Trans-hexaprenyltranstransferase [Maricaulis maris MCS10]
          Length = 340

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 214/319 (67%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           + L  L   DM +V+ LIL+R+ S VE+IP++ +YLI +GGKR+RPM+T+A A M+ +  
Sbjct: 20  EALARLAHDDMRRVDALILERLDSHVELIPELARYLIEAGGKRVRPMITVAAANMIGHSD 79

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
              + LA A+EFIHTATLLHDDVVD+S +RRGK AA LVWGN +SVLVGDFL +++F ++
Sbjct: 80  IAPLKLAAAVEFIHTATLLHDDVVDESGMRRGKAAANLVWGNASSVLVGDFLFARSFSLM 139

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +E  S  AL  LS  A T+AEGE+RQLS  K++ V+ E Y+ +I +KTA LF+AA +VS 
Sbjct: 140 VEAGSMRALGVLSDAASTIAEGEVRQLSAVKDVGVSVETYMQIIDAKTAALFAAAAQVSG 199

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++A    +   AL++YG  LG+AFQLVDD LDY G   ++GK+ G+DFR GK TLPV LA
Sbjct: 200 IVADRPANEETALETYGRELGLAFQLVDDALDYSGASAKLGKSTGDDFREGKVTLPVALA 259

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
               +  E  FW   I  G+    + ++A  ++  + AL  T  +A ++ ++A+++L   
Sbjct: 260 IAAASTEETAFWDRVIARGEQVEGDFERAISLVNTHGALAATVTQARNHARRAREALAIF 319

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P + W+ +L ++ DF   R
Sbjct: 320 PANKWRTALEDLADFVADR 338


>gi|163738897|ref|ZP_02146310.1| decaprenyl diphosphate synthase [Phaeobacter gallaeciensis BS107]
 gi|161387702|gb|EDQ12058.1| decaprenyl diphosphate synthase [Phaeobacter gallaeciensis BS107]
          Length = 332

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 202/316 (63%), Gaps = 2/316 (0%)

Query: 8   TLKD-MEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           TL D M  VN LI  R+ S     IP+V  +L+ +GGKRLRPMLTLA A +  Y GDNHV
Sbjct: 16  TLSDEMAAVNTLIQTRMASKHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYSGDNHV 75

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F +++ET 
Sbjct: 76  KLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMVETG 135

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ L+  + T+AEGE+ Q++ + +L   E  YL V++ KTA LFSAA +   ++A 
Sbjct: 136 SLRVLDILANASATIAEGEVLQMTAASDLATDEGIYLQVVRGKTAALFSAATQAGGVVAN 195

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +   AL +YG  LGIAFQ+ DD+LDY+G+    GKN+G+DFR  K TLPVI A  + 
Sbjct: 196 APETQIDALFAYGDALGIAFQIADDLLDYQGDSAATGKNVGDDFRERKLTLPVIKAVAQA 255

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  E+ FW  TI  G+    +L  A  +M +   L  T + A  +  KA+++L  LPD  
Sbjct: 256 TAEERGFWVRTIEKGRQDEGDLDHALALMDKYDTLTATRHDAMDWVAKAQNALTALPDDP 315

Query: 306 WKKSLMEVVDFCLQRL 321
            ++ L ++ D+ + RL
Sbjct: 316 IRQMLHDLADYVVARL 331


>gi|84500217|ref|ZP_00998483.1| decaprenyl diphosphate synthase [Oceanicola batsensis HTCC2597]
 gi|84392151|gb|EAQ04419.1| decaprenyl diphosphate synthase [Oceanicola batsensis HTCC2597]
          Length = 331

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 199/312 (63%), Gaps = 1/312 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           D+  VN LI +R+ S     IP+V  +L+ +GGKR+RPMLTLA A +  Y G  H+ LA 
Sbjct: 19  DLGAVNALIRERMASRHAPRIPEVTAHLVEAGGKRIRPMLTLAAARLCGYDGPYHIHLAA 78

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L ++AF +++E  +   
Sbjct: 79  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARAFQLMVEPGNLRV 138

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  LS  A T+AEGE+ QLS +++L  TEE YL VI+ KTA LFSAA E    IAG   +
Sbjct: 139 LSILSDAAATIAEGEVLQLSAAQDLKTTEETYLQVIRGKTAALFSAATEAGGEIAGASPA 198

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  YG  LGIAFQ+ DD+LD+ G+ +  GKN+G+DFR  K TLP+I A       E
Sbjct: 199 QVRALFDYGDALGIAFQMADDLLDWTGKTDSTGKNVGDDFRERKLTLPLIRAVAAADDEE 258

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  G+ + E+L  A  ++  + AL  T   A  +  +AK +L  LPD      
Sbjct: 259 RAFWTRTIEKGRQNDEDLATARELLDRHGALGSTRETALDWADRAKSALTHLPDHDLTAH 318

Query: 310 LMEVVDFCLQRL 321
           L ++ D+ ++RL
Sbjct: 319 LSDLADYVVERL 330


>gi|304570808|ref|YP_002517571.2| trans-isoprenyl diphosphate synthase [Caulobacter crescentus
           NA1000]
          Length = 336

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 208/314 (66%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LI  R+ SDV +IP + ++LI +GGKRLRP++T+A A +     D+   
Sbjct: 21  LAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGADNDHFQK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRGKVAA L+WG   SVLVGDFL ++AF +++ET S
Sbjct: 81  LAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFLFARAFELMVETNS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            +ALE L+  +  +AEGE+ QL  S +L++++  YL +I++KTA LF+AA E  ++ AGV
Sbjct: 141 MKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQAKTAELFAAASEAGAVSAGV 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +  +AL+ YG+NLG+AFQL DD LDY G    +GKN G+DFR GK TLP++LA  R  
Sbjct: 201 DVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGKATLPLLLAIARSG 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
            RE  FW+  I   + +  + ++A  ++  + AL  T   A  Y  KAK +L   P + W
Sbjct: 261 PREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDLAADYADKAKAALAMFPANDW 320

Query: 307 KKSLMEVVDFCLQR 320
           +++L E+ DF + R
Sbjct: 321 REALEELADFAVSR 334


>gi|254475222|ref|ZP_05088608.1| decaprenyl diphosphate synthase [Ruegeria sp. R11]
 gi|214029465|gb|EEB70300.1| decaprenyl diphosphate synthase [Ruegeria sp. R11]
          Length = 406

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 205/320 (64%), Gaps = 1/320 (0%)

Query: 3   MLEDLTLKDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           ML     ++M  VN LI  R+ S     IP+V  +L+ +GGKRLRPMLTLA A +  Y G
Sbjct: 86  MLAATLSEEMAAVNTLIRTRMASKHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYSG 145

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           DNHV LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++
Sbjct: 146 DNHVKLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFARSFQLM 205

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +ET S   L+ L+  + T+AEGE+ Q++ + +L   E+ YL V++ KTA LFSAA +   
Sbjct: 206 VETGSLRVLDILANASATIAEGEVLQMTAASDLATDEDIYLQVVRGKTAALFSAATQAGG 265

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           +IA    +   AL +YG  LGIAFQ+ DD+LDY+G+ +  GKN+G+DFR  K TLPVI A
Sbjct: 266 VIAEASEAEVDALYAYGDALGIAFQIADDLLDYQGDSSATGKNVGDDFRERKLTLPVIKA 325

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
             + T  E+ FW  TI  G+    +L  A  +M +   L  T   A ++  KA+D+L  L
Sbjct: 326 VAQATAEERAFWVRTIEKGRQDEGDLDHALALMDKYDTLGATRRDAMAWVAKAQDALTAL 385

Query: 302 PDSSWKKSLMEVVDFCLQRL 321
           P+   ++ L ++ D+ + RL
Sbjct: 386 PEDPIRQMLHDLADYVVARL 405


>gi|126733996|ref|ZP_01749743.1| Farnesyltranstransferase [Roseobacter sp. CCS2]
 gi|126716862|gb|EBA13726.1| Farnesyltranstransferase [Roseobacter sp. CCS2]
          Length = 332

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 203/309 (65%), Gaps = 2/309 (0%)

Query: 15  VNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEF 73
           VN LI +R+ S+    IP+V  +L+ +GGKRLRPMLTLA A M  Y G  HV LA  +EF
Sbjct: 25  VNTLIRERMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARMCGYDGPYHVHLAATVEF 84

Query: 74  IHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEAL 133
           IHTATLLHDDVVD+S+ RRG+  A L+W N +SVLVGD+L +++F +++ET S   L+ L
Sbjct: 85  IHTATLLHDDVVDESSQRRGRPTANLLWDNTSSVLVGDYLFARSFQLMVETGSLRVLDIL 144

Query: 134 SLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQA 193
           +  A T+AEGE+ QL+ + +L  TE+ YL V++ KTA LFSAA+EV   IA    + +QA
Sbjct: 145 ANAAATIAEGEVLQLTAASDLATTEDIYLQVVRGKTAALFSAAMEVGGEIADQDAATKQA 204

Query: 194 LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFW 253
           L  YG  LGI+FQ+VDD+LDY G     GKN+G+DFR  K TLPVI A       E++FW
Sbjct: 205 LFDYGDALGISFQIVDDLLDY-GGTKATGKNVGDDFRERKLTLPVIRAIAAADAGERDFW 263

Query: 254 KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEV 313
             TI  G+    +L  A  ++ ++  +  T   A ++ +KAK +L  +PD + K+ L+++
Sbjct: 264 VRTIGKGRQEAGDLDHAIALLAKHGTMEATRLDALAWAEKAKSALDAIPDHALKQMLVDL 323

Query: 314 VDFCLQRLN 322
            D+ + R+ 
Sbjct: 324 ADYVVARIT 332


>gi|85708095|ref|ZP_01039161.1| geranylgeranyl pyrophosphate synthase [Erythrobacter sp. NAP1]
 gi|85689629|gb|EAQ29632.1| geranylgeranyl pyrophosphate synthase [Erythrobacter sp. NAP1]
          Length = 336

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 146/298 (48%), Positives = 203/298 (68%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT   M  VN +IL+R+ S++ +IP +  +LI  GGKRLRPMLTLA A ++ Y G  H  
Sbjct: 21  LTANGMNSVNSVILERMQSEIPLIPRLAGHLISGGGKRLRPMLTLAGAALVGYEGTRHHK 80

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRGK AA +V+GN  +VLVGDFL S+AF ++ E  S
Sbjct: 81  LAAAVEFIHTATLLHDDVVDGSELRRGKAAANIVFGNPATVLVGDFLFSRAFELMTEDGS 140

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ LS  +  +AEGE+ QL+  + ++ +EE YLH+I +KTA LF+AA ++S+++A  
Sbjct: 141 LRVLKILSHASAVIAEGEVSQLTAQRQIETSEERYLHIIGAKTAALFAAASQISAVVAEC 200

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            +   +AL+ YG NLG+AFQLVDD +DY  +  +MGK+ G+DFR GK TLPVILA  RG 
Sbjct: 201 SDEEERALEDYGRNLGVAFQLVDDAIDYDSDAAQMGKDQGDDFREGKMTLPVILAHARGD 260

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDS 304
           + E+ FWK  I   + S E+  +A  ++ ++ AL DT  +A  + Q+A D++    DS
Sbjct: 261 EAERKFWKDAILGHRSSDEDFAEAIRLIEKHNALEDTREKARHFAQRAIDAISIFADS 318


>gi|220964307|gb|ACL95663.1| trans-isoprenyl diphosphate synthase [Caulobacter crescentus
           NA1000]
          Length = 322

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 210/320 (65%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  L  L   DM  VN LI  R+ SDV +IP + ++LI +GGKRLRP++T+A A +    
Sbjct: 1   MDRLVRLAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGAD 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D+   LA A+EFIHTATLLHDDVVD S LRRGKVAA L+WG   SVLVGDFL ++AF +
Sbjct: 61  NDHFQKLAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFLFARAFEL 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++ET S +ALE L+  +  +AEGE+ QL  S +L++++  YL +I++KTA LF+AA E  
Sbjct: 121 MVETNSMKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQAKTAELFAAASEAG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++ AGV  +  +AL+ YG+NLG+AFQL DD LDY G    +GKN G+DFR GK TLP++L
Sbjct: 181 AVSAGVDVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGKATLPLLL 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A  R   RE  FW+  I   + +  + ++A  ++  + AL  T   A  Y  KAK +L  
Sbjct: 241 AIARSGPREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDLAADYADKAKAALAM 300

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            P + W+++L E+ DF + R
Sbjct: 301 FPANDWREALEELADFAVSR 320


>gi|16126352|ref|NP_420916.1| polyprenyl synthetase family protein [Caulobacter crescentus CB15]
 gi|13423600|gb|AAK24084.1| polyprenyl synthetase family protein [Caulobacter crescentus CB15]
          Length = 338

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 208/314 (66%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LI  R+ SDV +IP + ++LI +GGKRLRP++T+A A +     D+   
Sbjct: 23  LAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGADNDHFQK 82

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRGKVAA L+WG   SVLVGDFL ++AF +++ET S
Sbjct: 83  LAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFLFARAFELMVETNS 142

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            +ALE L+  +  +AEGE+ QL  S +L++++  YL +I++KTA LF+AA E  ++ AGV
Sbjct: 143 MKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQAKTAELFAAASEAGAVSAGV 202

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +  +AL+ YG+NLG+AFQL DD LDY G    +GKN G+DFR GK TLP++LA  R  
Sbjct: 203 DVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGKATLPLLLAIARSG 262

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
            RE  FW+  I   + +  + ++A  ++  + AL  T   A  Y  KAK +L   P + W
Sbjct: 263 PREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDLAADYADKAKAALAMFPANDW 322

Query: 307 KKSLMEVVDFCLQR 320
           +++L E+ DF + R
Sbjct: 323 REALEELADFAVSR 336


>gi|126728318|ref|ZP_01744134.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Sagittula stellata E-37]
 gi|126711283|gb|EBA10333.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Sagittula stellata E-37]
          Length = 325

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 207/313 (66%), Gaps = 2/313 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +M  VN LI +R+ S     IP+V  +L+ +GGKRLRPMLTLA+A +  Y G  HV LA 
Sbjct: 14  EMAAVNDLIRERMASRHAPRIPEVTAHLVEAGGKRLRPMLTLASAKLCGYDGPYHVHLAA 73

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++ ET +   
Sbjct: 74  TVEFIHTATLLHDDVVDESERRRGRPTANLLWDNKSSVLVGDYLFARSFQLMTETGNLRV 133

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  LS  A T+AEGE+ QL+ +++L  TE+ YL V++ KTA LFSAA EV  +IAG    
Sbjct: 134 LRILSDAAATIAEGEVLQLTAAQDLSTTEDIYLQVVRGKTAALFSAATEVGGVIAGRPEE 193

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  YG  LGIAFQ+VDD+LDY G  +  GKN+G+DFR  K TLP+I AF +    E
Sbjct: 194 DVRALFDYGDALGIAFQIVDDLLDYWGG-DATGKNVGDDFRERKLTLPLIKAFAKADDAE 252

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           K FWK  I  G     +L++A  ++  + AL +T   A ++ ++AK +++ LP S  +  
Sbjct: 253 KAFWKRVIEKGDQREGDLEEALRLLERHGALEETRQEALAWAERAKTAMQKLPSSGLRDL 312

Query: 310 LMEVVDFCLQRLN 322
           L+E+ D+ + R+N
Sbjct: 313 LIELSDYVVSRVN 325


>gi|308388198|pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter
           Crescentus Cb15 Complexed With Calcium And Isoprenyl
           Diphosphate
 gi|308388199|pdb|3OYR|B Chain B, Crystal Structure Of Polyprenyl Synthase From Caulobacter
           Crescentus Cb15 Complexed With Calcium And Isoprenyl
           Diphosphate
          Length = 345

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 208/314 (66%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LI  R+ SDV +IP + ++LI +GGKRLRP++T+A A +     D+   
Sbjct: 30  LAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGADNDHFQK 89

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRGKVAA L+WG   SVLVGDFL ++AF +++ET S
Sbjct: 90  LAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFLFARAFELMVETNS 149

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            +ALE L+  +  +AEGE+ QL  S +L++++  YL +I++KTA LF+AA E  ++ AGV
Sbjct: 150 MKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQAKTAELFAAASEAGAVSAGV 209

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +  +AL+ YG+NLG+AFQL DD LDY G    +GKN G+DFR GK TLP++LA  R  
Sbjct: 210 DVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGKATLPLLLAIARSG 269

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
            RE  FW+  I   + +  + ++A  ++  + AL  T   A  Y  KAK +L   P + W
Sbjct: 270 PREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDLAADYADKAKAALAMFPANDW 329

Query: 307 KKSLMEVVDFCLQR 320
           +++L E+ DF + R
Sbjct: 330 REALEELADFAVSR 343


>gi|149913258|ref|ZP_01901792.1| decaprenyl diphosphate synthase [Roseobacter sp. AzwK-3b]
 gi|149813664|gb|EDM73490.1| decaprenyl diphosphate synthase [Roseobacter sp. AzwK-3b]
          Length = 333

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 203/312 (65%), Gaps = 1/312 (0%)

Query: 12  MEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           M  VN LI +R+ S     IP+V  +L+ +GGKRLRPMLTLATA M  Y G   V LA  
Sbjct: 22  MAAVNTLIRERMASRHAPRIPEVTAHLVEAGGKRLRPMLTLATADMCGYGGAFDVHLAAT 81

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L ++AF +++E  +   L
Sbjct: 82  VEFIHTATLLHDDVVDESQQRRGRPTANLLWDNKSSVLVGDYLFARAFQLMVEPGNLRVL 141

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS  A  +AEGE+ QLS +++L   E  YL V++ KTA LFSAA EV  +IA    + 
Sbjct: 142 DILSNAAAVIAEGEVLQLSAARDLKTDENIYLQVVRGKTAALFSAATEVGGVIADAPEAQ 201

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL  YG  LGIAFQ+VDD+LDY+G+ N  GKN+G+DFR  K TLPVI A     + E+
Sbjct: 202 IKALFDYGDALGIAFQIVDDLLDYQGDSNATGKNVGDDFRERKLTLPVIKAVAAADETER 261

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW  TI  G+    +L+ A  +++++ AL  T   A S+  KAK ++  LPD + +  L
Sbjct: 262 AFWIRTIEKGRQEDGDLQHALDLLKKHGALEATRQDALSWAAKAKSAMDALPDHAVRGML 321

Query: 311 MEVVDFCLQRLN 322
            ++ D+ + R+N
Sbjct: 322 TDLADYVVARVN 333


>gi|329889422|ref|ZP_08267765.1| polyprenyl synthetase family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844723|gb|EGF94287.1| polyprenyl synthetase family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 367

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 202/316 (63%), Gaps = 2/316 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG--DNH 64
           L   DM  V+ LI+ R+ SDV +IP + ++L+ +GGKRLRP+LT+A A  +   G  D  
Sbjct: 50  LAKDDMAAVDALIIARMQSDVPVIPLLAEHLVSAGGKRLRPLLTVAAARAIGQTGAIDGP 109

Query: 65  VLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIET 124
             LA ++EFIHTATLLHDD+VD S +RRGKVAA L+WG+ +SVLVGDFL ++AF +++ET
Sbjct: 110 KKLAASVEFIHTATLLHDDIVDGSEMRRGKVAAHLIWGSASSVLVGDFLFARAFELMVET 169

Query: 125 KSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIA 184
            S  AL  L+  +  +AEGE+ QL+ + +L++  + YL +I++KTA LF+AA E  ++ A
Sbjct: 170 DSLRALGILARASAVIAEGEVLQLTRAHDLNLDLDTYLQIIRAKTAELFAAAAESGAVGA 229

Query: 185 GVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQR 244
           G  +    AL+ YGM LGIAFQL DD LDY G    +GKN G+DF  GK TLP++LA QR
Sbjct: 230 GATDEQVAALRDYGMALGIAFQLADDALDYGGATETLGKNAGDDFNEGKATLPLLLAVQR 289

Query: 245 GTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDS 304
               E  FW   I  G    E+  +A  ++  + A+  T   A  Y  +AK +L+ LP  
Sbjct: 290 TKGTEDLFWDRVITKGDRKPEDFDRARQLIVASGAVEATLDTASEYADRAKTALQVLPAG 349

Query: 305 SWKKSLMEVVDFCLQR 320
            W+ +L  + DF + R
Sbjct: 350 PWRSALEALADFAVSR 365


>gi|89052978|ref|YP_508429.1| trans-hexaprenyltranstransferase [Jannaschia sp. CCS1]
 gi|88862527|gb|ABD53404.1| Trans-hexaprenyltranstransferase [Jannaschia sp. CCS1]
          Length = 335

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 201/315 (63%), Gaps = 3/315 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           D+  VN LI  R+ S     IP+V  +L+ +GGKR+RPMLTLA A +  Y GD+HV LA 
Sbjct: 21  DLTAVNTLIRARMASKHAPRIPEVTAHLVEAGGKRIRPMLTLACARLCGYSGDDHVKLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W NQ+SVLVGD+L ++AF +++E  +   
Sbjct: 81  TVEFIHTATLLHDDVVDESEQRRGRPTANLLWDNQSSVLVGDYLFARAFQLMVEPGNLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ LS  A T+AEGE+ QL+++ N++  EE YL VI+ KTA LF AA EV  +IAG    
Sbjct: 141 LDILSNAAATIAEGEVLQLTVASNIETPEETYLQVIRGKTAALFEAACEVGGVIAGRDTF 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRG--EVNEMGKNIGEDFRNGKPTLPVILAFQRGTK 247
           + QAL +YG  LG+AFQ+ DD+LD+ G     ++ KNIG+DFR  K TLPVI A      
Sbjct: 201 IIQALATYGDGLGVAFQMADDLLDWGGVDGGAQLDKNIGDDFRERKMTLPVIRAIAAANG 260

Query: 248 REKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWK 307
            E+ FW  TI  G     +L++A  +++ +  L  T   A  +  +AK +L  LPD   +
Sbjct: 261 DERAFWARTIGKGDQRDGDLEQALDVLQRHGTLASTRDAANDHVARAKAALTNLPDDPLR 320

Query: 308 KSLMEVVDFCLQRLN 322
             L ++ D+ + RLN
Sbjct: 321 DMLADLADYVVARLN 335


>gi|294678700|ref|YP_003579315.1| octaprenyl-diphosphate synthase [Rhodobacter capsulatus SB 1003]
 gi|77862362|gb|ABB04465.1| decaprenyl diphosphate synthase [Rhodobacter capsulatus]
 gi|294477520|gb|ADE86908.1| octaprenyl-diphosphate synthase [Rhodobacter capsulatus SB 1003]
          Length = 333

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 202/313 (64%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM  VN LI +R+ S+    IP+V  +LI +GGKRLRPMLTLA A ++ Y G  HV LA
Sbjct: 20  EDMAAVNALIRERMSSEHAPRIPEVTAHLIEAGGKRLRPMLTLAAARLVGYGGPFHVHLA 79

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++ +T +  
Sbjct: 80  ATVEFIHTATLLHDDVVDESRQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMTDTGNMR 139

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            +E L+  +  +AEGE+ QL+ ++NL  TE+ YL VI+ KTA LFSAA EV  +I G   
Sbjct: 140 VMEILANASAVIAEGEVLQLTAAQNLATTEDIYLRVIRGKTAALFSAATEVGGIIGGAPE 199

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
              QAL  YG  LGIAFQ+VDD+LDY G+  E+GKN G+DFR  K T+PVI A     + 
Sbjct: 200 DQVQALFDYGDALGIAFQIVDDLLDYGGKSAEIGKNTGDDFRERKLTMPVIKAVALADEA 259

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FWK  I  G     +L+ A  +M ++  L  T   A  +   A+ +L  LPD   ++
Sbjct: 260 ERAFWKRVIEKGDQQDGDLEHAMALMTKHGTLEATRLAAIGWTDTARKALAKLPDHPLRQ 319

Query: 309 SLMEVVDFCLQRL 321
            L ++ D+ ++R+
Sbjct: 320 MLDDLADYVVERV 332


>gi|297787795|pdb|3MZV|A Chain A, Crystal Structure Of A Decaprenyl Diphosphate Synthase
           From Rhodobacter Capsulatus
 gi|297787796|pdb|3MZV|B Chain B, Crystal Structure Of A Decaprenyl Diphosphate Synthase
           From Rhodobacter Capsulatus
          Length = 341

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 202/313 (64%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM  VN LI +R+ S+    IP+V  +LI +GGKRLRPMLTLA A ++ Y G  HV LA
Sbjct: 20  EDMAAVNALIRERMSSEHAPRIPEVTAHLIEAGGKRLRPMLTLAAARLVGYGGPFHVHLA 79

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++ +T +  
Sbjct: 80  ATVEFIHTATLLHDDVVDESRQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMTDTGNMR 139

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            +E L+  +  +AEGE+ QL+ ++NL  TE+ YL VI+ KTA LFSAA EV  +I G   
Sbjct: 140 VMEILANASAVIAEGEVLQLTAAQNLATTEDIYLRVIRGKTAALFSAATEVGGIIGGAPE 199

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
              QAL  YG  LGIAFQ+VDD+LDY G+  E+GKN G+DFR  K T+PVI A     + 
Sbjct: 200 DQVQALFDYGDALGIAFQIVDDLLDYGGKSAEIGKNTGDDFRERKLTMPVIKAVALADEA 259

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FWK  I  G     +L+ A  +M ++  L  T   A  +   A+ +L  LPD   ++
Sbjct: 260 ERAFWKRVIEKGDQQDGDLEHAMALMTKHGTLEATRLAAIGWTDTARKALAKLPDHPLRQ 319

Query: 309 SLMEVVDFCLQRL 321
            L ++ D+ ++R+
Sbjct: 320 MLDDLADYVVERV 332


>gi|163732321|ref|ZP_02139767.1| octaprenyl-diphosphate synthase [Roseobacter litoralis Och 149]
 gi|161394619|gb|EDQ18942.1| octaprenyl-diphosphate synthase [Roseobacter litoralis Och 149]
          Length = 333

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 208/313 (66%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM  VN LI +R+ S     IP+V  +L+ +GGKRLRPMLTLATA +  Y G  H+ LA 
Sbjct: 21  DMAAVNTLIRERMASKHAPRIPEVTAHLVDAGGKRLRPMLTLATAHLCGYDGPFHINLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++ET S   
Sbjct: 81  TVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMVETGSLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ QL+ S+NL  TEE YL V++ KTA LFSAA EV  +IAG  + 
Sbjct: 141 LDILANASATIAEGEVLQLTASQNLATTEEIYLQVVRGKTAALFSAATEVGGVIAGAPDD 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              AL  YG  LG+AFQ+VDD+LD++G+   +GKNIG+DFR  K T+P+I A  +    E
Sbjct: 201 QVAALFEYGDALGVAFQIVDDLLDFQGDAGAIGKNIGDDFRERKLTMPLIKAVAKADAEE 260

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  GK    +L+ A  ++ ++ AL DT   A +   +AK +L  LP    K  
Sbjct: 261 RAFWVRTIEKGKQEESDLQHAIDLLHKHAALFDTSVVARAEAARAKAALAPLPAHPVKDM 320

Query: 310 LMEVVDFCLQRLN 322
           L+++ D+ ++R+N
Sbjct: 321 LVDLADYVVERIN 333


>gi|255264686|ref|ZP_05344028.1| octaprenyl-diphosphate synthase [Thalassiobium sp. R2A62]
 gi|255107021|gb|EET49695.1| octaprenyl-diphosphate synthase [Thalassiobium sp. R2A62]
          Length = 332

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 207/312 (66%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           D+E VN +I  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y GDNH+ LA 
Sbjct: 21  DLEAVNEVIAARMASEHAPRIPEVTAHLVGAGGKRLRPMLTLAAAQLCGYDGDNHIKLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W NQ+SVLVGD+L +++F ++++T S   
Sbjct: 81  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNQSSVLVGDYLFARSFQLMVKTGSLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  A T+AEGE+ Q++ +++L  TE+ YL +++ KTA LFSAA +V  +I+    +
Sbjct: 141 LDILANAAATIAEGEVLQMTAAQDLGTTEDTYLKIVRGKTAALFSAATQVGGVISDADET 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           + +AL  YG  LGIAFQ+VDD+LDY G  +  GKNIG+DFR  K TLPVI A       E
Sbjct: 201 IVKALYDYGDALGIAFQIVDDLLDYGGS-DATGKNIGDDFRERKLTLPVIKAVAAADTEE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW+  I  GK    +L+ A  ++ ++ ++      A  + + AK ++  LP +  ++ 
Sbjct: 260 RAFWERVIEKGKQDEGDLEHALTLLAKHGSMQAARVDALEWIEVAKSAMANLPQAPLREM 319

Query: 310 LMEVVDFCLQRL 321
           L+++ D+ + R+
Sbjct: 320 LIDLADYVVARV 331


>gi|110680572|ref|YP_683579.1| octaprenyl-diphosphate synthase [Roseobacter denitrificans OCh 114]
 gi|109456688|gb|ABG32893.1| octaprenyl-diphosphate synthase [Roseobacter denitrificans OCh 114]
          Length = 333

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 207/313 (66%), Gaps = 1/313 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM  V+ LI +R+ S     IP+V  +L+ +GGKRLRPMLTLA A +  Y G  H+ LA 
Sbjct: 21  DMAAVSTLIRERMASKHAPRIPEVTAHLVEAGGKRLRPMLTLAAAHLCGYDGPFHINLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++ET S   
Sbjct: 81  TVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMVETGSLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ QL+ S+NL  TEE YL V++ KTA LFSAA EV  +IAG  + 
Sbjct: 141 LDILANASATIAEGEVLQLTASQNLATTEEVYLQVVRGKTAALFSAATEVGGVIAGAPDD 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              AL  YG  LGIAFQ+VDD+LD++G+   +GKNIG+DFR  K T+P+I A  +    E
Sbjct: 201 HVAALFEYGDALGIAFQIVDDLLDFQGDAGAIGKNIGDDFRERKLTMPLIKAVAKADAEE 260

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  GK    +L+ A  ++ ++ AL DT   A +   +AK +L  LP    K  
Sbjct: 261 RAFWVRTIEKGKQEEGDLQHAIALLHKHAALTDTSVVARTQAARAKAALAPLPAHPVKDM 320

Query: 310 LMEVVDFCLQRLN 322
           L+++ D+ ++R+N
Sbjct: 321 LVDLADYVVERIN 333


>gi|84515724|ref|ZP_01003085.1| decaprenyl diphosphate synthase [Loktanella vestfoldensis SKA53]
 gi|84510166|gb|EAQ06622.1| decaprenyl diphosphate synthase [Loktanella vestfoldensis SKA53]
          Length = 332

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 200/309 (64%), Gaps = 2/309 (0%)

Query: 15  VNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEF 73
           VN +I  R+ S+    IP V  +L+ +GGKRLRPMLTLA A M  Y G  H+ LA  +EF
Sbjct: 25  VNAMIRDRMASEHAPRIPQVTAHLVEAGGKRLRPMLTLAAARMCGYDGPYHIHLAATVEF 84

Query: 74  IHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEAL 133
           IHTATLLHDDVVD+S+ RRG+  A L+W N +SVLVGD+L +++F +++ET S   L+ L
Sbjct: 85  IHTATLLHDDVVDESSQRRGRPTANLLWDNTSSVLVGDYLFARSFQLMVETGSLRVLDIL 144

Query: 134 SLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQA 193
           +  + T+AEGE+ QL+ + +L  TE+ Y+ V++ KTA LFSAA+EV   IAG   +++QA
Sbjct: 145 ANASATIAEGEVLQLTAAADLATTEDIYIKVVRGKTAALFSAAMEVGGEIAGQDPAIKQA 204

Query: 194 LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFW 253
           L  YG  LGI+FQ+VDD+LDY G     GKN+G+DFR  K TLPVI A       E+ FW
Sbjct: 205 LFDYGDALGISFQIVDDLLDY-GGTKATGKNVGDDFRERKLTLPVIRAVAAADADERAFW 263

Query: 254 KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEV 313
           + TI  G+    +L  A  ++  +  L  T   A  +  KAK++L  +PD + K  L+++
Sbjct: 264 ERTIQKGRQQDGDLDHAIALLHRHGTLESTRQDAILWAAKAKEALGVIPDHALKTMLVDL 323

Query: 314 VDFCLQRLN 322
            D+ + RL 
Sbjct: 324 ADYVVARLT 332


>gi|85705714|ref|ZP_01036811.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Roseovarius sp. 217]
 gi|85669704|gb|EAQ24568.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Roseovarius sp. 217]
          Length = 333

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 202/312 (64%), Gaps = 1/312 (0%)

Query: 12  MEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           ME VN LI +R+ S     IP V  +L+ +GGKRLRPML LATA +  Y G   V LA  
Sbjct: 22  MEAVNVLIRERMASRHAPRIPQVTAHLVEAGGKRLRPMLVLATADLCGYDGPFDVHLAAT 81

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L ++AF +++E  S   L
Sbjct: 82  VEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARAFQLMVEPGSLRVL 141

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS  + T+AEGE+ QLS +++L  TE+ YL V++ KTA LFSAA EV  +IAG     
Sbjct: 142 DILSNASATIAEGEVLQLSAAQDLATTEDIYLQVVRGKTAALFSAATEVGGVIAGAPEDH 201

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL  YG  LGIAFQ+VDD+LDY+G+V   GKN+G+DFR  K TLPVI A    +  E+
Sbjct: 202 VKALFEYGDALGIAFQIVDDLLDYQGDVKSTGKNVGDDFRERKLTLPVIKAVAAASAEER 261

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FWK TI  G     +L+ A  +M+ + AL  T   A  +  +A+ ++  LPD   ++ L
Sbjct: 262 AFWKRTIEKGDQRDGDLEHALTLMQAHGALEQTRAEALDWAARARAAIAVLPDHPVQRML 321

Query: 311 MEVVDFCLQRLN 322
             +  + + R++
Sbjct: 322 DNLAGYVVARIS 333


>gi|126666697|ref|ZP_01737674.1| Geranylgeranyl pyrophosphate synthase [Marinobacter sp. ELB17]
 gi|126628742|gb|EAZ99362.1| Geranylgeranyl pyrophosphate synthase [Marinobacter sp. ELB17]
          Length = 322

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 198/317 (62%), Gaps = 2/317 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           D    D  +VN LI++R+ SDV M+  + +Y+I SGGKRLRP+L L  +    Y  DNH+
Sbjct: 8   DTVADDFSRVNELIIQRLSSDVPMVEKIAQYIIESGGKRLRPLLVLLASRATGYNEDNHL 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL ++AF M++E +
Sbjct: 68  KLAAVIEFLHTATLLHDDVVDTSDMRRGRSTANAKWGNAPSVLVGDFLYARAFEMMVELE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   ++ LS     +AEGE+ QL   KN D+TE  Y+ VI +KTA+LF A+    +L+AG
Sbjct: 128 SLPIMKVLSHATAVIAEGEVMQLMNVKNPDLTENQYMQVIHNKTAMLFEASSHSGALLAG 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             ++  +ALK+YG +LG+AFQLVDDVLDYRG+   MGKN+G+D   GK TLP+I A    
Sbjct: 188 ANHAQEEALKNYGKHLGLAFQLVDDVLDYRGDAETMGKNVGDDLAEGKTTLPLIYAIANS 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
              EK   +  I  G   +++L+    I+    AL     +A +  Q+AKD L+ LP S 
Sbjct: 248 NDDEKKLIRRAIRKG--GLDDLQPVLAIINTTGALNYAMDKAKNQAQQAKDCLQSLPASE 305

Query: 306 WKKSLMEVVDFCLQRLN 322
              +L  + D  + R++
Sbjct: 306 HLDALHLLTDIAVARIS 322


>gi|254439584|ref|ZP_05053078.1| polyprenyl synthetase superfamily [Octadecabacter antarcticus 307]
 gi|198255030|gb|EDY79344.1| polyprenyl synthetase superfamily [Octadecabacter antarcticus 307]
          Length = 332

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 203/312 (65%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +M+ VN LI  R+ S     IP+V  +L+ +GGKRLRPMLTLA A M  Y G  HV LA 
Sbjct: 21  EMDAVNVLITDRMASKHAPRIPEVTAHLVGAGGKRLRPMLTLAAAKMCGYSGPYHVHLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W N +SVLVGD+L +++F +++ET S   
Sbjct: 81  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNTSSVLVGDYLFARSFQLMVETGSLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ QL+ + +L  TE  YL +++ KTA LFSAA+EV  +IAG   +
Sbjct: 141 LDILANASATIAEGEVLQLTAASDLATTEAIYLQIVRGKTAALFSAAMEVGGVIAGQDAA 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           + +AL  YG  LGI FQ+VDD+LDY G  + +GKNIG+DFR  K TLPVI A       E
Sbjct: 201 LVEALYDYGDALGIGFQIVDDLLDYAG-TDAIGKNIGDDFRERKLTLPVIKAVALADVEE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  G+    +L  A  ++ ++  L  T+  A ++ +KAK +L  LPD   K  
Sbjct: 260 RAFWVRTIEKGRQEDGDLDAALGLLVKHGTLDATKSEALAWMEKAKAALAPLPDHPIKPM 319

Query: 310 LMEVVDFCLQRL 321
           L+++  + + R+
Sbjct: 320 LLDLAGYVVARV 331


>gi|291465068|gb|ADE06004.1| polyprenyl synthase [Rhodobacter sphaeroides 2.4.1]
          Length = 333

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 140/313 (44%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM  VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA A +  Y G  H+ LA
Sbjct: 20  EDMAAVNGLIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLAAARLCGYEGPYHIHLA 79

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRGK  A L+W N++SVLVGD+L +++F +++ET S  
Sbjct: 80  ATVEFIHTATLLHDDVVDESHRRRGKPTANLLWDNKSSVLVGDYLFARSFQLMVETGSLR 139

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            ++ L+  + T++EGE+ QL+ +++L  TE+ YL V++ KTA LF+AA EV  ++AGV  
Sbjct: 140 VMDILANASATISEGEVLQLTAAQDLRTTEDIYLQVVRGKTAALFAAATEVGGVVAGVPE 199

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
           +  +AL +YG  LGIAFQ+VDD+LDY G   ++GKN G+DFR  K TLPVI A  +    
Sbjct: 200 AQVEALHAYGDALGIAFQIVDDLLDYGGVDAQIGKNTGDDFRERKLTLPVIKAVAQADAE 259

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FW+  I  G     +L++A  IM  + A+      A  +   A+++L  LP+   +K
Sbjct: 260 ERAFWQRVIEKGDQREGDLEQAHAIMSRHGAMEAARQDALRWVTVAREALGQLPEHPLRK 319

Query: 309 SLMEVVDFCLQRL 321
            L ++ DF ++R+
Sbjct: 320 MLHDLADFVVERI 332


>gi|302383413|ref|YP_003819236.1| polyprenyl synthetase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194041|gb|ADL01613.1| Polyprenyl synthetase [Brevundimonas subvibrioides ATCC 15264]
          Length = 346

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 201/315 (63%), Gaps = 5/315 (1%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGDNHVL--- 66
           DM  V+ LIL R+ S V +IP + ++++ +GGKRLRP+LT+A A      R D  +    
Sbjct: 30  DMAAVDALILDRMQSSVPVIPLLAEHIVSAGGKRLRPLLTIAAARSATADRPDADLTAAL 89

Query: 67  -LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA ++EFIHTATLLHDDVVD S  RRGKVAA L+WG+ TSVLVGDFL ++AF +++ET 
Sbjct: 90  KLAASVEFIHTATLLHDDVVDGSERRRGKVAAHLIWGSATSVLVGDFLFARAFELMVETD 149

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
              AL  L+  +  +A+GE+ QL+ + +L++ +E YL +I +KTA LF+AA E  ++  G
Sbjct: 150 QIRALGILAQASSVIAQGEVLQLTRAHDLNLDQETYLRIISAKTAELFAAAAESGAVGVG 209

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL+SYG+NLG+AFQL DD LDY G    +GKN G+DFR GK T+P++LA  R 
Sbjct: 210 ADPKTTSALRSYGLNLGLAFQLADDALDYGGSSEALGKNAGDDFREGKVTMPLLLAVART 269

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
             RE  FW  TIN  + + ++ ++A  ++    A+  T   A  Y   AK +L  LP+  
Sbjct: 270 RGREDAFWDRTINGNQRTDDDFRRARELIVGTGAVSATLDAAGEYADAAKTALGVLPNGE 329

Query: 306 WKKSLMEVVDFCLQR 320
           WK +L  + DF + R
Sbjct: 330 WKAALERLADFAVSR 344


>gi|146278504|ref|YP_001168663.1| polyprenyl synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556745|gb|ABP71358.1| Polyprenyl synthetase [Rhodobacter sphaeroides ATCC 17025]
          Length = 333

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 202/312 (64%), Gaps = 1/312 (0%)

Query: 11  DMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM  VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA A +  Y G  H+ LA 
Sbjct: 21  DMAAVNGLIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLAAARLCGYEGPYHIHLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S  RRGK  A L+W N++SVLVGD+L +++F +++ET S   
Sbjct: 81  TVEFIHTATLLHDDVVDESHRRRGKPTANLLWDNKSSVLVGDYLFARSFQLMVETGSLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+  + T++EGE+ QL+ +++L  TE+ YL V++ KTA LF+AA EV  ++AGV  +
Sbjct: 141 MDILANASATISEGEVLQLTAAQDLRTTEDIYLQVVRGKTAALFAAATEVGGVVAGVPEA 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              AL +YG  LGIAFQ+VDD+LDY G   ++GKN G+DFR  K TLPVI A  +    E
Sbjct: 201 QVAALHAYGDALGIAFQIVDDLLDYGGADAQIGKNTGDDFRERKLTLPVIKAVAKADAEE 260

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW+  I  G     +L +A  IM  + A+      A  +   A++SL  LP+   +  
Sbjct: 261 RAFWQRVIEKGDQREGDLAQAHAIMARHGAMEAARQDALHWVAVARESLTQLPEHPLRDM 320

Query: 310 LMEVVDFCLQRL 321
           L ++ DF ++R+
Sbjct: 321 LHDLADFVVERI 332


>gi|77464324|ref|YP_353828.1| geranylgeranyl pyrophosphate synthase/polyprenyl synthetase
           [Rhodobacter sphaeroides 2.4.1]
 gi|57115620|gb|AAW33555.1| decaprenyl diphosphate synthase [Rhodobacter sphaeroides]
 gi|77388742|gb|ABA79927.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Rhodobacter sphaeroides 2.4.1]
          Length = 333

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM  VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA A +  Y G  H+ LA
Sbjct: 20  EDMAAVNGLIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLAAARLCGYEGPYHIHLA 79

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRGK  A L+W N++SVLVGD+L +++F +++ET S  
Sbjct: 80  ATVEFIHTATLLHDDVVDESHRRRGKPTANLLWDNKSSVLVGDYLFARSFQLMVETGSLR 139

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            ++ L+  + T++EGE+ QL+ +++L  TE+ YL V++ KTA LF+AA EV  ++AGV  
Sbjct: 140 VMDILANASATISEGEVLQLTAAQDLRTTEDIYLQVVRGKTAALFAAATEVGGVVAGVPE 199

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
           +  +AL +YG  LGIAFQ+VDD+LDY G   ++GKN G+DFR  K TLPVI A  +    
Sbjct: 200 AQVEALHAYGDALGIAFQIVDDLLDYGGVDAQIGKNTGDDFRERKLTLPVIKAVAQADAE 259

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FW+  I  G     +L++A  IM  + A+      A  +   A+++L  LP+   ++
Sbjct: 260 ERAFWQRVIEKGDQREGDLEQAHAIMSRHGAMEAARQDALRWVTVAREALGQLPEHPLRE 319

Query: 309 SLMEVVDFCLQRL 321
            L ++ DF ++R+
Sbjct: 320 MLHDLADFVVERI 332


>gi|126463166|ref|YP_001044280.1| trans-hexaprenyltranstransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559215|ref|ZP_08413537.1| trans-hexaprenyltranstransferase [Rhodobacter sphaeroides WS8N]
 gi|126104830|gb|ABN77508.1| Trans-hexaprenyltranstransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332276927|gb|EGJ22242.1| trans-hexaprenyltranstransferase [Rhodobacter sphaeroides WS8N]
          Length = 333

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 206/313 (65%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM  VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA A +  Y G  H+ LA
Sbjct: 20  EDMAAVNGLIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLAAARLCGYEGPYHIHLA 79

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRGK  A L+W N++SVLVGD+L +++F +++ET S  
Sbjct: 80  ATVEFIHTATLLHDDVVDESHRRRGKPTANLLWDNKSSVLVGDYLFARSFQLMVETGSLR 139

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            ++ L+  + T++EGE+ QL+ +++L  TE+ YL V++ KTA LF+AA EV  ++AGV  
Sbjct: 140 VMDILANASATISEGEVLQLTAAQDLRTTEDIYLQVVRGKTAALFAAATEVGGVVAGVPE 199

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
           +  +AL +YG  LGIAFQ+VDD+LDY G   ++GKN G+DFR  K TLPVI A  +    
Sbjct: 200 AQVEALHAYGDALGIAFQIVDDLLDYGGVDAQIGKNTGDDFRERKLTLPVIKAVAQADAE 259

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FW+  I  G     +L++A  IM  + A+      A  +   A+++L  LP+   ++
Sbjct: 260 ERAFWQRVIEKGDQREGDLEQAHAIMSRHGAMEAARQDALRWVAVAREALGQLPEHPLRE 319

Query: 309 SLMEVVDFCLQRL 321
            L ++ DF ++R+
Sbjct: 320 MLHDLADFVVERI 332


>gi|83952381|ref|ZP_00961112.1| decaprenyl diphosphate synthase [Roseovarius nubinhibens ISM]
 gi|83836054|gb|EAP75352.1| decaprenyl diphosphate synthase [Roseovarius nubinhibens ISM]
          Length = 333

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 142/312 (45%), Positives = 205/312 (65%), Gaps = 1/312 (0%)

Query: 12  MEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           ME VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y GD+   LA  
Sbjct: 22  MEAVNALIRARMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAAAICGYEGDHDERLAAT 81

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L S++F +++ET S   L
Sbjct: 82  VEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFSRSFQLMVETGSLRVL 141

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+  + T+AEGE+ QL+ S+++  TE  YL V++ KTA LFSAA EV  +IAG  + V
Sbjct: 142 DILANASATIAEGEVLQLTASRDIATTEATYLQVVRGKTAALFSAATEVGGVIAGASDEV 201

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LGIAFQ+ DD+LD++G+  + GKN+G+DFR  K TLP+I A  +  + E+
Sbjct: 202 TGALYDYGDALGIAFQIADDLLDFQGDSAKTGKNVGDDFRERKLTLPLIKAIAKADETER 261

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW+ TI  G     +L  A  ++ ++RAL +T   A  +  +A+ +L  LP    +  L
Sbjct: 262 AFWRRTIEKGAQGEGDLDHAIALLHKHRALEETLADAQGWAARAQAALAKLPAHPVRDML 321

Query: 311 MEVVDFCLQRLN 322
            ++ D+ + R++
Sbjct: 322 GDLSDYVVARVS 333


>gi|114798232|ref|YP_759407.1| polyprenyl synthetase [Hyphomonas neptunium ATCC 15444]
 gi|114738406|gb|ABI76531.1| polyprenyl synthetase [Hyphomonas neptunium ATCC 15444]
          Length = 337

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 202/317 (63%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   D+  V  L+  R  S V +IPD+  Y++ +GGKRLRPM+TL  A  +      
Sbjct: 20  MQALVADDLAAVERLLATRAASPVAVIPDLSGYIVSAGGKRLRPMITLIAAHAVGKANAA 79

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
              LA A+EFIHTATLLHDDVVD+S LRRGK AA+ +WGN+ ++LVGDFL ++AF +++E
Sbjct: 80  THALAAAVEFIHTATLLHDDVVDESDLRRGKPAAKAIWGNKAAILVGDFLFARAFNLLVE 139

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S + L  L+  +  +AEGE+RQL+     D+  E+YL ++++KT  LF AA E  ++ 
Sbjct: 140 ANSLDILNRLATASTVIAEGEVRQLAAMATRDLPTEEYLAIVEAKTGALFEAAAETGAMS 199

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG +     AL +YG NLG+AFQ++DD LDY G  + +GK++G+DFR GK TLPVI+A +
Sbjct: 200 AGGEE-YSDALATYGKNLGLAFQIIDDALDYGGTTSVIGKSVGDDFREGKITLPVIIARR 258

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG+  ++ FW   +N       +L  A  ++R   A   T   A +Y   AK +LR LP 
Sbjct: 259 RGSDEDRAFWDRALNPETQEDSDLAHAVHLIRATGAAEATVQEAEAYAALAKGALRTLPA 318

Query: 304 SSWKKSLMEVVDFCLQR 320
           S+++ +L ++ DFC+ R
Sbjct: 319 STYRDALEDLADFCVSR 335


>gi|149202965|ref|ZP_01879936.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Roseovarius sp. TM1035]
 gi|149143511|gb|EDM31547.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Roseovarius sp. TM1035]
          Length = 333

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 200/312 (64%), Gaps = 1/312 (0%)

Query: 12  MEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           ME VN LI +R+ S     IP V  +L+ +GGKRLRPML LATA +  Y G   V LA  
Sbjct: 22  MEAVNLLIRERMASRHAPRIPQVTAHLVEAGGKRLRPMLVLATADLCGYDGPFDVHLAAT 81

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+SA RRG+  A L+W N++SVLVGD+L ++AF +++E  S   L
Sbjct: 82  VEFIHTATLLHDDVVDESAQRRGRPTANLLWDNKSSVLVGDYLFARAFQLMVEPGSLRVL 141

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS  + T+AEGE+ QLS +++L  TE+ YL V++ KTA LFSAA EV  +IAG   + 
Sbjct: 142 DILSNASATIAEGEVLQLSAAQDLATTEDIYLQVVRGKTAALFSAATEVGGVIAGAPETQ 201

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL  YG  LGIAFQ+VDD+LDY+G+    GKN+G+DFR  K TLPVI A       E+
Sbjct: 202 IKALFEYGDALGIAFQIVDDLLDYQGDAKSTGKNVGDDFRERKLTLPVIKAVSAANAEER 261

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FWK TI  G     +L+ A  +M+ + AL  T   A  +  +A+ ++  LPD   +  L
Sbjct: 262 AFWKRTIEKGDQRDGDLEHALALMQAHGALEQTRAEALDWAARARAAIAVLPDHPVRGML 321

Query: 311 MEVVDFCLQRLN 322
             +  + + R++
Sbjct: 322 DRLAGYVVARIS 333


>gi|120553786|ref|YP_958137.1| farnesyltranstransferase [Marinobacter aquaeolei VT8]
 gi|120323635|gb|ABM17950.1| farnesyl-diphosphate synthase / geranylgeranyl-diphosphate synthase
           [Marinobacter aquaeolei VT8]
          Length = 322

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 201/317 (63%), Gaps = 2/317 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           D    D  +VN LI+KR+ SDV ++  + +Y+I SGGKRLRP+L L  +    Y+ D+H+
Sbjct: 8   DTVADDFSRVNDLIIKRLASDVPLVEKIAQYIIESGGKRLRPLLVLLASQAAGYQKDDHL 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL ++AF M++E +
Sbjct: 68  KLAAVIEFLHTATLLHDDVVDTSDMRRGRSTANAKWGNAPSVLVGDFLYARAFEMMVELQ 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   +  LS     +AEGE+ QL   KN D++E+ Y+ VI +KTA+LF AA    +L+A 
Sbjct: 128 SLPIMNVLSHATAVIAEGEVMQLMNVKNPDLSEDQYMVVIHNKTAMLFEAASHTGALLAK 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  ALK YG +LG+AFQLVDDVLDY+G+   MGKN+G+D   GK TLP+I A  +G
Sbjct: 188 ASKEQETALKDYGKHLGLAFQLVDDVLDYQGDAETMGKNVGDDLAEGKTTLPLIYAMAKG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           ++ E+   +  I  G   +++L K   I++ + A+  T  +A    Q A+D L CLP S 
Sbjct: 248 SEDERQLIRQAIRKG--GLDDLPKVLDIVKASGAIEYTMTKAKEQAQIARDLLACLPGSE 305

Query: 306 WKKSLMEVVDFCLQRLN 322
            +++L  + +  + R++
Sbjct: 306 HRQALELLTEVAVARVS 322


>gi|84683979|ref|ZP_01011881.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667732|gb|EAQ14200.1| Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase
           [Rhodobacterales bacterium HTCC2654]
          Length = 331

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 204/313 (65%), Gaps = 2/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           D+ +V+ +I  R+ S+    IP+V  +L+ +GGKRLRPMLTLA+A +  Y G +H+ LA 
Sbjct: 20  DLSQVDEMIRARMASEHAPRIPEVTAHLVDAGGKRLRPMLTLASARLCGYEGGHHIHLAT 79

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
           A+EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++ E  S   
Sbjct: 80  AVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMTEADSLRV 139

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ LS  + T+ EGE+ QL+ +++L  TE+ Y  V++ KTA LF+AA EV  ++AGV   
Sbjct: 140 LQVLSNASATITEGEVLQLTAAQDLGTTEDTYFKVVRGKTAALFAAATEVGGILAGVSED 199

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  YG  LGIAFQ+VDD+LD+ G  +  GKNIG+DFR  K TLP+I A  RG   E
Sbjct: 200 RIKALHDYGDALGIAFQVVDDLLDFWGG-DATGKNIGDDFRERKLTLPIIKAIARGDDEE 258

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FWK T+        +L++A  IM  + AL DT   A  +  +AK  L  LP+   +  
Sbjct: 259 RAFWKRTLEKNDQRDGDLERALEIMTAHGALDDTRAAALDWAARAKACLDALPEDPIRDM 318

Query: 310 LMEVVDFCLQRLN 322
           L ++ D+ + RLN
Sbjct: 319 LSDIADYVVARLN 331


>gi|192361220|ref|YP_001981260.1| octaprenyl-diphosphate synthase [Cellvibrio japonicus Ueda107]
 gi|190687385|gb|ACE85063.1| octaprenyl-diphosphate synthase [Cellvibrio japonicus Ueda107]
          Length = 320

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 196/310 (63%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   VN LI+ ++ SDV ++ ++  YL+ +GGKRLRP+L +  A  L Y G  H+ LA  
Sbjct: 11  DFAAVNQLIIDQLHSDVGLVENIGHYLVEAGGKRLRPLLVMLAAKSLGYTGKQHLDLAAI 70

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTATLLHDDVVD S LRRG+  A   WGN  SVLVGDFL S+AF M++   S + +
Sbjct: 71  IEFIHTATLLHDDVVDMSQLRRGRPTANAQWGNAPSVLVGDFLYSRAFQMMVAIGSMDVM 130

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS    T+AEGE++QL  +K+ +VTEE+Y  VI  KTA+LFSAA EV  +IAG     
Sbjct: 131 AILSDTTNTIAEGEVQQLVNAKDPNVTEENYFQVIDKKTAILFSAACEVGGVIAGANTRQ 190

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+ YG ++GIAFQLVDD LDY G+   +GKN+G+D   GKPTLP+I A + GT+ + 
Sbjct: 191 REALRHYGSHVGIAFQLVDDALDYTGDAATLGKNVGDDLAEGKPTLPLIHAMRTGTRAQA 250

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
               +TI  G  S   L     +++    +  T   A     +A   L+ LPD+++ +++
Sbjct: 251 ELVANTIRTGDAS--QLHAILEVVKATGGMDYTLQAARRQVDQALSQLQTLPDNAYSQAM 308

Query: 311 MEVVDFCLQR 320
            ++ +F L R
Sbjct: 309 RQLAEFSLAR 318


>gi|88798952|ref|ZP_01114534.1| Geranylgeranyl pyrophosphate synthase [Reinekea sp. MED297]
 gi|88778432|gb|EAR09625.1| Geranylgeranyl pyrophosphate synthase [Reinekea sp. MED297]
          Length = 322

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 193/310 (62%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D E VN  I + + SDV M+  V +Y+I SGGKR+RP+L L    +     D H LLA  
Sbjct: 13  DFEAVNSTIHRYLASDVPMVEKVAEYIIDSGGKRMRPLLVLLAGQLNGQLTDRHHLLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL +++F M++E  + + +
Sbjct: 73  IEFLHTATLLHDDVVDKSDMRRGRATANANWGNAPSVLVGDFLYARSFEMLVELGNFDVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           ++LS     +AEGE+ QL   KN D+TE  Y+ VIK KTA+LF A+ E S LI+G   + 
Sbjct: 133 QSLSQATRVIAEGEVMQLMNVKNPDITEAQYMEVIKGKTAILFKASAETSGLISGYDRTS 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG+NLG+AFQL+DD LDY G+   +GKNIG+D   GKPTLP+I A ++GT  EK
Sbjct: 193 VNALADYGLNLGLAFQLIDDALDYAGDAEALGKNIGDDLAEGKPTLPLIFAMEKGTDEEK 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              ++ I  G + VE L     ++R   A+     +A ++   AK +L    DS  K++L
Sbjct: 253 ALVRNCIRKGGL-VE-LDAVLEVIRHTDAIGYVTQKALTHADAAKQALASFADSDSKRAL 310

Query: 311 MEVVDFCLQR 320
           M + D  + R
Sbjct: 311 MALADLAVSR 320


>gi|254449834|ref|ZP_05063271.1| geranylgeranyl pyrophosphate synthase [Octadecabacter antarcticus
           238]
 gi|198264240|gb|EDY88510.1| geranylgeranyl pyrophosphate synthase [Octadecabacter antarcticus
           238]
          Length = 332

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 205/313 (65%), Gaps = 2/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +M+ VN LI  R+ S+    IP+V  +L+ +GGKRLRPMLTLA A M  Y G  HV LA 
Sbjct: 21  EMDAVNVLIRDRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAAKMCGYGGPYHVHLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W N +SVLVGD+L +++F +++ET S   
Sbjct: 81  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNTSSVLVGDYLFARSFQLMVETGSLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + T+AEGE+ QL+ + +L  +E  YL +++ KTA LFSAALEV  +IA    +
Sbjct: 141 LDILANASATIAEGEVLQLTAASDLATSEAVYLQIVRGKTAALFSAALEVGGVIAQQDEA 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           + +AL  YG  LGI FQ+VDD+LDY G  + +GK++G+DFR  K TLPVI A       E
Sbjct: 201 LVKALYDYGDALGIGFQIVDDLLDYSG-TDAIGKDVGDDFRERKLTLPVIKAVALADATE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  G+    +L+ A  ++ ++  L  T+  A ++ +KAK +L  LPD   K  
Sbjct: 260 RAFWVRTIEKGRQEDGDLQTALGLLVKHGTLDATKSDALAWMEKAKAALAPLPDHPIKLM 319

Query: 310 LMEVVDFCLQRLN 322
           L+++ D+ + R+ 
Sbjct: 320 LLDLADYVVARIK 332


>gi|221640208|ref|YP_002526470.1| Decaprenyl diphosphate synthase [Rhodobacter sphaeroides KD131]
 gi|221160989|gb|ACM01969.1| Decaprenyl diphosphate synthase [Rhodobacter sphaeroides KD131]
          Length = 331

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 205/313 (65%), Gaps = 1/313 (0%)

Query: 10  KDMEKVNFLILKRICS-DVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM  VN LI +R+ S     IP+V  +L+ +GGKRLRP+LTLA A +  Y G  H+ LA
Sbjct: 18  EDMAAVNGLIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLAAARLCGYEGPYHIHLA 77

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRGK  A L+W N++SVLVGD+L +++F +++ET S  
Sbjct: 78  ATVEFIHTATLLHDDVVDESHRRRGKPTANLLWDNKSSVLVGDYLFARSFQLMVETGSLR 137

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            ++ L+  + T++EGE+ QL+ +++L  TE+ YL V++ KTA LF+AA +V  ++AG+  
Sbjct: 138 VMDILANASATISEGEVLQLTAAQDLRTTEDIYLQVVRGKTAALFAAATQVGGVVAGMPE 197

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
           +  +AL +YG  LGIAFQ+VDD+LDY G   ++GKN G+DFR  K TLPVI A  +    
Sbjct: 198 AQVEALHAYGDALGIAFQIVDDLLDYGGVDAQIGKNTGDDFRERKLTLPVIKAVAQADAE 257

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           E+ FW+  I  G     +L++A  IM  + A+      A  +   A+++L  LP    ++
Sbjct: 258 ERAFWQRVIEKGDQREGDLEQAHAIMSRHGAMEAARQDALRWVAVAREALGQLPKHPLRE 317

Query: 309 SLMEVVDFCLQRL 321
            L ++ DF ++R+
Sbjct: 318 MLHDLADFVVERI 330


>gi|315498623|ref|YP_004087427.1| polyprenyl synthetase [Asticcacaulis excentricus CB 48]
 gi|315416635|gb|ADU13276.1| Polyprenyl synthetase [Asticcacaulis excentricus CB 48]
          Length = 343

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/314 (45%), Positives = 209/314 (66%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN +I +R+ SDV +IP + ++L+ +GGKRLRP+L +A A +      +H  
Sbjct: 29  LCADDMAAVNAIITERMQSDVAVIPALAEHLVSAGGKRLRPLLCVAAARVAGTTNLHHRK 88

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           L+ A+EFIHTATLLHDDVVD S LRRGKVAA L+WG  +SVLVGDFL ++AF +++ET S
Sbjct: 89  LSAAVEFIHTATLLHDDVVDSSQLRRGKVAAHLIWGAPSSVLVGDFLFARAFELMVETDS 148

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            +AL  LS  +  +AEGE+ QL  + ++++TE  Y+ +I +KTAVLF+AA E  ++ AG 
Sbjct: 149 LQALGILSKASGVIAEGEVLQLMKAYDVNLTEATYIDIIAAKTAVLFAAAAESGAVAAGA 208

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            ++ +QAL+ YG+NLG+AFQ+ DD LDY G    +GKN G+DF  GK TLP+ILA  + T
Sbjct: 209 SSAGQQALRDYGLNLGLAFQIQDDALDYGGTTQSLGKNAGDDFAEGKATLPLILAV-KAT 267

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
                FW  T++    +  +L +A  ++ E+ A+  T   A  Y QKAKD+L+    S W
Sbjct: 268 PEAAAFWHRTVSLRDQTDGDLAQAQALIVESGAMAKTMETARHYAQKAKDALKGFEPSDW 327

Query: 307 KKSLMEVVDFCLQR 320
           + +L  + D+ ++R
Sbjct: 328 RTALEALADYSVER 341


>gi|89070187|ref|ZP_01157515.1| decaprenyl diphosphate synthase [Oceanicola granulosus HTCC2516]
 gi|89044203|gb|EAR50354.1| decaprenyl diphosphate synthase [Oceanicola granulosus HTCC2516]
          Length = 332

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 206/313 (65%), Gaps = 2/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           D+  VN LI +R+ S+    IP+V  +L+ +GGKRLRPMLTLA A +  Y G  HV LA 
Sbjct: 21  DLAAVNALIRERMQSEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYDGPYHVHLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA RRG+  A L+W NQ+SVLVGD+L +++F ++++T + + 
Sbjct: 81  TVEFIHTATLLHDDVVDESAQRRGRPTANLLWDNQSSVLVGDYLFAKSFLLMVDTGNLDV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  LS  + T+AEGE+ QL+ S++L   E  Y+ VI+ KTA LFSAA EV  +IAG    
Sbjct: 141 LRILSQASATIAEGEVLQLTASRSLATDEAVYMKVIRGKTAALFSAATEVGGVIAGQGPE 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           V +AL  YG  LGIAFQ+VDD+LDY G     GKN+G+DFR  K TLPVI A  R    E
Sbjct: 201 VCRALFDYGDALGIAFQIVDDLLDYEG-TEATGKNVGDDFRERKLTLPVIKAVARADAEE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW+ TI  G+    +L+ A  ++  + AL +T   A  +  +AK +L  LPDS+  + 
Sbjct: 260 RAFWQRTIEKGRQEEGDLETALGLLARHGALDETRAAAIEWAARAKAALAPLPDSALTEM 319

Query: 310 LMEVVDFCLQRLN 322
           L ++ D+ + R++
Sbjct: 320 LADLADYVVARIS 332


>gi|114327555|ref|YP_744712.1| decaprenyl diphosphate synthase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315729|gb|ABI61789.1| farnesyl pyrophosphate synthetase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 353

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 201/320 (62%), Gaps = 6/320 (1%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG----- 61
           L   D+   N  I+ R+ S V +IP +  +++ +GGKRLRP+LTLA+A +  +       
Sbjct: 32  LVQDDLTLCNQAIIDRMDSQVPLIPQLAAHIVAAGGKRLRPLLTLASARLCGFDTALAGG 91

Query: 62  -DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
              HV LA  +EFIHTATLLHDDVVD+S +RRG  +A  V+GN  SVLVGDFL ++AF +
Sbjct: 92  VPRHVHLAACVEFIHTATLLHDDVVDESRMRRGMASANAVFGNNASVLVGDFLFARAFQL 151

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S + L  LS  A T+AEGE+ QL+   +L+  E  YL VI+ KTA LF+AA +V 
Sbjct: 152 MVEDGSLQVLAILSKAAATIAEGEVLQLATQNDLETPESRYLEVIEGKTASLFAAACQVG 211

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A       QAL  YGM+LGIAFQL DD LDY  +  ++GK +G+DFR GK TLPV+ 
Sbjct: 212 AVVAARPAEEEQALYDYGMSLGIAFQLTDDALDYAADQRKLGKTVGDDFREGKITLPVLA 271

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AF  G   EK FW+ TI +   + ++L++A  ++  +  +  T  RA    +KAK +L  
Sbjct: 272 AFHAGDAEEKRFWQRTIGESDQTEDDLEEALRLIARHDTIGLTLERARIMAEKAKRALDI 331

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            PD+  ++SL  V D+ + R
Sbjct: 332 FPDTPLRRSLCAVADYTVWR 351


>gi|254418195|ref|ZP_05031919.1| polyprenyl synthetase superfamily [Brevundimonas sp. BAL3]
 gi|196184372|gb|EDX79348.1| polyprenyl synthetase superfamily [Brevundimonas sp. BAL3]
          Length = 324

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 208/322 (64%), Gaps = 2/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  L  L   DM +V+ LI+ R+ SDV +IP + ++L+ +GGKRLRP+LT+A A      
Sbjct: 1   MNALVRLAGTDMAEVDALIIDRMQSDVPIIPKLAEHLVSAGGKRLRPLLTVAAARASGTE 60

Query: 61  GD--NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAF 118
           GD  +   LA A+EFIHTATLLHDD+VD S LRRGKVAA L+WG  TSVLVGDFL ++AF
Sbjct: 61  GDILSPKKLAAAVEFIHTATLLHDDIVDASELRRGKVAAHLIWGAPTSVLVGDFLFARAF 120

Query: 119 CMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALE 178
            +++ET S  AL  L+  +  ++EGE+ QL+ + +L++ +  YL +I +KTA LF+AA E
Sbjct: 121 ELMVETDSMRALGILAQASRVISEGEVLQLTRAHDLNLDQATYLQIISAKTAELFAAAAE 180

Query: 179 VSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPV 238
             ++ AG   +   AL+ YGM LGIAFQL DD LDY      +GKN G+DF  GK TLP+
Sbjct: 181 AGAVGAGADAAATAALRDYGMALGIAFQLADDALDYGATAEALGKNAGDDFNEGKATLPL 240

Query: 239 ILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
           +LA  R   RE +FW+ T+  G+ + E+  +A  ++  + A+  T   A  Y  +AK +L
Sbjct: 241 LLAVARTRGREDDFWERTVTKGERTPEDFARARELVVGSGAIGATLDLAGDYADQAKAAL 300

Query: 299 RCLPDSSWKKSLMEVVDFCLQR 320
             LP S W+ +L ++ DF + R
Sbjct: 301 SVLPASDWRAALEDLADFAVSR 322


>gi|162147610|ref|YP_001602071.1| octaprenyl-diphosphate synthase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209542242|ref|YP_002274471.1| polyprenyl synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786187|emb|CAP55769.1| putative octaprenyl-diphosphate synthase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529919|gb|ACI49856.1| Polyprenyl synthetase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 358

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 203/324 (62%), Gaps = 4/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L D    DM   N  I++R+ S V +IP +  +L+ +GGKRLRP+LTLA A + +Y 
Sbjct: 33  LRDLSDYLGDDMAACNRAIVERMDSPVALIPQLAAHLVAAGGKRLRPLLTLAAARLCDYP 92

Query: 61  G----DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
                  HV LA  +EFIHTATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL ++
Sbjct: 93  AGPEHQRHVSLAACVEFIHTATLLHDDVVDESLLRRGLASANAVFGNKASVLVGDFLFAR 152

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           +F ++ +  S + +  LS  + T+AEGE+ Q+S   +L  + E YL VI  KTA LF+AA
Sbjct: 153 SFQLMTDDGSLKVMAILSSASATIAEGEVLQMSTQNDLSTSVEQYLEVIHGKTAALFAAA 212

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
             V +++A    +   AL+S+G NLG+AFQLVDD LDY  +   +GK +G+DFR GK TL
Sbjct: 213 CRVGAVVAERPEAEELALESFGTNLGMAFQLVDDALDYAADQAVLGKTVGDDFREGKITL 272

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           PV+ A+  G + E+ FW+  I   + + E+L +A  ++ +  A+  T  RA  Y Q A+D
Sbjct: 273 PVLAAYAAGDEEERVFWRRVIEQSEQAPEDLDRALALIAKTDAIGVTLDRAALYAQAARD 332

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L   PDS  ++ L +   + + R
Sbjct: 333 ALEIFPDSRLRRLLQDTAAYTVSR 356


>gi|294085837|ref|YP_003552597.1| decaprenyl diphosphate synthase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665412|gb|ADE40513.1| decaprenyl diphosphate synthase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 357

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 200/311 (64%), Gaps = 6/311 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  L +L   DM +VN  I+ R+ SDV +IP +  +LI SGGKR+RP++TLA A +    
Sbjct: 29  LTALVNLLADDMAQVNETIMARMTSDVPLIPQLAGHLITSGGKRMRPLMTLAGARIASPN 88

Query: 61  GDN----HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
             +     + LA A+EFIH+ATLLHDDV+D+S +RRG+  A  +WGN  SVLVGDFL ++
Sbjct: 89  TTSCSVAAIKLATAVEFIHSATLLHDDVIDESNMRRGQDTANALWGNDASVLVGDFLFAR 148

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++E+ + + L  LS  +  + E E++Q++++ N D   EDYL VI+ KTA+LF+AA
Sbjct: 149 AFELMVESGNIDVLGTLSSASARITEAEIKQMTVAGNPDTRLEDYLDVIEGKTAILFAAA 208

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
               + I+G    + QA+  YG+NLG+AFQ++DD LDY  +  +MGKN G+DF + K T+
Sbjct: 209 AASGARISGADEQITQAMHMYGLNLGLAFQIMDDALDYTADSAQMGKNAGDDFLDQKITM 268

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           PVILA+Q+    E+ FW  TI DG  + E+  KA  I+  ++A+  +   A SY  KAK 
Sbjct: 269 PVILAYQKANDEERGFWHRTIGDGNFAAEDFAKAQSILSHHKAIEASLEAATSYANKAKA 328

Query: 297 SLRCL--PDSS 305
           +L     PD +
Sbjct: 329 ALAIFDAPDQA 339


>gi|157960679|ref|YP_001500713.1| polyprenyl synthetase [Shewanella pealeana ATCC 700345]
 gi|157845679|gb|ABV86178.1| Polyprenyl synthetase [Shewanella pealeana ATCC 700345]
          Length = 323

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  +  LT  DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+
Sbjct: 3   LNAIRQLTDSDMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSILAARAIDYK 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA  IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 63  GDSHLKLAAIIEFIHTASLLHDDVVDESMLRRGRKTANALFGNSASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E +S + LE L+     LAEGE+ QL    + D TE+ Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELRSLDVLEILADATNVLAEGEVLQLMNCNDPDTTEDSYMRVIYCKTAKLFEAATRLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            L+A     V+ AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I 
Sbjct: 183 GLLADSPIEVQTALADYGKYLGTAFQLTDDLLDYTADTEELGKNIGDDLAEGKPTLPLIF 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   EK   +  I  G    E++      ++   AL  TE RA    +KA  +L  
Sbjct: 243 AMANGNDTEKALIRDAIEKGD-GTEHIDVILAALKNCGALEYTEQRAIEESEKAIAALSI 301

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           +PDS +KK+L+ +     QR N
Sbjct: 302 IPDSDYKKALISLAKIATQRSN 323


>gi|114564252|ref|YP_751766.1| trans-hexaprenyltranstransferase [Shewanella frigidimarina NCIMB
           400]
 gi|114335545|gb|ABI72927.1| Trans-hexaprenyltranstransferase [Shewanella frigidimarina NCIMB
           400]
          Length = 323

 Score =  268 bits (685), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 202/312 (64%), Gaps = 5/312 (1%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+G++H+ LA  
Sbjct: 13  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARTVDYQGEHHLKLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E ++ + L
Sbjct: 73  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELENMKVL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+     LAEGE+ QL    + D TE +Y+ VI  KTA LF AA +++ ++A V    
Sbjct: 133 QVLAHTTNVLAEGEVLQLMNCNDPDTTEANYMRVIYCKTAKLFEAATQLAGVLANVSPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            QAL  YG  LG AFQL DD+LDY    +E+GKNIG+D   GKPTLP+I A + G+   K
Sbjct: 193 EQALADYGKYLGTAFQLTDDLLDYTANADELGKNIGDDLAEGKPTLPLIYAMENGSDTAK 252

Query: 251 NFWKSTI--NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
              +  I  +DG  +++ +    + + E+ ALV T+ +A +  QKA D+L   PDS +K+
Sbjct: 253 KLIRDAIEQSDGTKAIDEI---LVALEESGALVYTQEKAQAEAQKAIDALTVFPDSDYKQ 309

Query: 309 SLMEVVDFCLQR 320
           +L+ +    + R
Sbjct: 310 ALISLAHLSVNR 321


>gi|126726042|ref|ZP_01741884.1| decaprenyl diphosphate synthase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705246|gb|EBA04337.1| decaprenyl diphosphate synthase [Rhodobacterales bacterium
           HTCC2150]
          Length = 332

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 203/313 (64%), Gaps = 2/313 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +M +VN +I  R+ S+    IP+V  +L+ +GGKR+RPM+TLA A M  Y G  H+ LA 
Sbjct: 21  EMAQVNDMIRARMASEHAPRIPEVTAHLVEAGGKRIRPMMTLAAAKMCGYDGPYHINLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S+ RRG+  A L+W N++S+LVGD+L ++AF +++E +S   
Sbjct: 81  TVEFIHTATLLHDDVVDESSQRRGRATANLLWDNKSSILVGDYLFARAFQLMVEAESLTV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ LS  + T+AEGE+ Q++ +++L+  E  YL V++ KTA LFSAA EV  +IA     
Sbjct: 141 LDILSNASATIAEGEVLQMTAAQDLETDEATYLKVVRGKTAALFSAATEVGGVIANAPAE 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL  +G  LGI+FQ+VDD+LDY G +  +GKNIG+DFR  K TLPVI A       E
Sbjct: 201 HTKALFDFGDALGISFQIVDDLLDYDGSL-AIGKNIGDDFRERKLTLPVIKAVAMADAEE 259

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW  TI  GK    + + A  +++++  L  T   A  +  KAK SL  +P S  +  
Sbjct: 260 RAFWVKTIEKGKQDDGDFEHALSLLKKHDTLNATRTEALEWRDKAKASLSIIPQSELRDM 319

Query: 310 LMEVVDFCLQRLN 322
           L+++ D+ + R++
Sbjct: 320 LLDLADYVVARIS 332


>gi|254448914|ref|ZP_05062369.1| octaprenyl-diphosphate synthase [gamma proteobacterium HTCC5015]
 gi|198261451|gb|EDY85741.1| octaprenyl-diphosphate synthase [gamma proteobacterium HTCC5015]
          Length = 322

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 197/316 (62%), Gaps = 2/316 (0%)

Query: 5   EDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNH 64
           +DL   +M+ VN LI++R+ SDV +I  +  Y+I SGGKRLRP L +  A    Y+G++H
Sbjct: 7   QDLIGGEMKAVNALIVERLKSDVALINQLGHYIIQSGGKRLRPQLAVLAARAAGYQGEDH 66

Query: 65  VLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIET 124
           + +A  IEFIHTATLLHDDVVD S LRRG+  A  V+GN+ +VLVGDFL S++F M++E 
Sbjct: 67  LQIAAIIEFIHTATLLHDDVVDASELRRGRETANAVFGNEAAVLVGDFLYSRSFEMMVEL 126

Query: 125 KSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIA 184
            S   +  LS     +AEGE+ QL    + D TE  YL VI SKTA LF AA  + ++++
Sbjct: 127 DSMRIMSILSRATNVIAEGEVMQLLNIHDADTTEARYLEVIHSKTAKLFEAATRIGAVLS 186

Query: 185 GVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQR 244
           G+     QAL  YGM+LG AFQL+DDVLDY  + + MGKN+G+D   GKPTLP+I A + 
Sbjct: 187 GLPQEKEQALADYGMHLGTAFQLIDDVLDYSADADAMGKNVGDDLAEGKPTLPLIYAMRE 246

Query: 245 GTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDS 304
           G++ E    +  I +G   ++ +      ++   AL  T   A      A  ++ CLPDS
Sbjct: 247 GSEDEAALIRRAIENG--GLDEIDAVLAAIQSTGALEFTRRAAQREADAAVAAVGCLPDS 304

Query: 305 SWKKSLMEVVDFCLQR 320
            ++++L+ +  F + R
Sbjct: 305 EYRQALIALAQFSVDR 320


>gi|260576245|ref|ZP_05844237.1| Polyprenyl synthetase [Rhodobacter sp. SW2]
 gi|259021513|gb|EEW24817.1| Polyprenyl synthetase [Rhodobacter sp. SW2]
          Length = 333

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/312 (43%), Positives = 200/312 (64%), Gaps = 1/312 (0%)

Query: 11  DMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           DM  VN LI +R+ S+    IP V  +L+ +GGKRLRP+LTLA A +  Y G  HV LA 
Sbjct: 21  DMLAVNVLIRERMASEHAPRIPQVTAHLVEAGGKRLRPLLTLAAARLCGYGGPFHVHLAA 80

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S+ RRG+  A L+W N++SVLVGD+L +++F +++E  +   
Sbjct: 81  TVEFIHTATLLHDDVVDESSRRRGRPTANLLWDNKSSVLVGDYLFARSFQLMVEPGNLRV 140

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+  + ++AEGE+ QL+ +++L  TE  YL V++ KTA LFSAA EV  +IAG    
Sbjct: 141 LDILANASASIAEGEVLQLTAAQDLATTEAIYLQVVRGKTAALFSAATEVGGVIAGAPAD 200

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL +YG  LG+AFQ+VDD+LDY G    +GK++G+DFR  K TLPVI A  +    E
Sbjct: 201 QVKALFTYGDALGVAFQIVDDLLDYGGVAATIGKDVGDDFRERKLTLPVIKAVAKADAEE 260

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           + FW   I  G  +  +L++A  ++  + AL      A  +   A+D+L  LP    +  
Sbjct: 261 RAFWVRVIEKGHQAEGDLEQAQALLARHGALQAARVDALHWAATARDALAVLPAHPLRTM 320

Query: 310 LMEVVDFCLQRL 321
           L ++ DF ++R+
Sbjct: 321 LEDLADFVVERI 332


>gi|159045612|ref|YP_001534406.1| octaprenyl-diphosphate synthase [Dinoroseobacter shibae DFL 12]
 gi|157913372|gb|ABV94805.1| octaprenyl-diphosphate synthase [Dinoroseobacter shibae DFL 12]
          Length = 334

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/275 (49%), Positives = 186/275 (67%), Gaps = 1/275 (0%)

Query: 10  KDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           +DM+ VN LI +R+ S+    IP+V  +L+ +GGKRLRPMLTLATA +  Y G  HV LA
Sbjct: 21  EDMDAVNVLIRERMASEHAPRIPEVTAHLVEAGGKRLRPMLTLATARLCGYTGPYHVHLA 80

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S  RRG+  A L+W NQ+SVLVGD+L +++F +++ET S  
Sbjct: 81  ATVEFIHTATLLHDDVVDESNQRRGRPTANLLWDNQSSVLVGDYLFARSFQLMVETGSLR 140

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            L+ L+  A T+AEGE+ QLS +++L   E+ YL V++ KTA LFSAA EV  +IAG   
Sbjct: 141 VLDILANAAATIAEGEVLQLSAAQDLATDEDIYLKVVRGKTAALFSAATEVGGVIAGADE 200

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
           +  +AL +YG  LGIAFQ+VDD+LDY G+  + GKNIG+DFR  K TLPVI A  +    
Sbjct: 201 AQVRALFTYGDALGIAFQIVDDLLDYGGDSTKTGKNIGDDFRERKLTLPVIKAVAKADLE 260

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDT 283
           E+ FW   I  G     +L+ A  ++  + A+  T
Sbjct: 261 ERAFWSRVIEKGDQRDGDLEHALALLDRHGAMAAT 295


>gi|224588345|gb|ACN58969.1| octaprenyl diphosphate synthase [uncultured bacterium BLR10]
          Length = 348

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 203/310 (65%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN +I +++ S+V ++  + +Y+I +GGKR+RP+L L  A    Y+G  H  LA  
Sbjct: 39  DMDAVNTVIRRKLHSEVSLVNQIAEYIISAGGKRIRPVLVLLVANAYSYKGTAHHELAAV 98

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S+LRRG+  A  ++GN  SVLVGDFL S+AF M++   +   +
Sbjct: 99  VEFIHTATLLHDDVVDESSLRRGRATANALFGNAASVLVGDFLYSRAFQMMVGLNNMRVM 158

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QL    + DV++E YL VI+SKTA LF AA E+ +L++G  ++ 
Sbjct: 159 QILSDATNVIAEGEVLQLLNMHDPDVSQERYLQVIRSKTAKLFEAAAELGALVSGANDAQ 218

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG +LG AFQL+DDVLDY G+ NE+GKN+G+D R GKPTLP+I   + GT  ++
Sbjct: 219 IEAAGEYGRSLGTAFQLIDDVLDYAGDANEIGKNVGDDLREGKPTLPLIYLMENGTPEQR 278

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +S I  G    ++       +  + AL  T  +A +  ++A +++  LPDS +K+SL
Sbjct: 279 ELVRSCIEQGD--EQHFDTILAAITSSGALEYTRQQAVTAAKRAAEAIAGLPDSIYKESL 336

Query: 311 MEVVDFCLQR 320
           +++ DF + R
Sbjct: 337 LQLADFSVNR 346


>gi|330994653|ref|ZP_08318576.1| Octaprenyl-diphosphate synthase [Gluconacetobacter sp. SXCC-1]
 gi|329758294|gb|EGG74815.1| Octaprenyl-diphosphate synthase [Gluconacetobacter sp. SXCC-1]
          Length = 334

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 136/325 (41%), Positives = 203/325 (62%), Gaps = 4/325 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L +    DM   N  I++R+ S V +IP +  +L+ +GGKRLRP+LTLA+A +  Y+
Sbjct: 9   LRDLAEYLADDMAACNRAIVERMDSPVALIPQLAAHLVAAGGKRLRPLLTLASARLCGYQ 68

Query: 61  GD----NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
            D     HV LA  +EFIHTATLLHDDVVD+S+LRRG  +A  V+GN+ SVLVGDFL ++
Sbjct: 69  PDATHQRHVGLAACVEFIHTATLLHDDVVDESSLRRGMASANAVFGNKASVLVGDFLFAR 128

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           +F ++ +  S + +  LS  + T+AEGE+ Q+S   +L    + YL VI  KTA LF+AA
Sbjct: 129 SFQLMTDDGSLKVMNILSSASATIAEGEVLQMSTQNDLSTRIDQYLEVIHGKTAALFAAA 188

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
             V +++A    +V +AL+SYG NLG+AFQLVDD LDY  +   +GK +G+DFR GK TL
Sbjct: 189 CRVGAVVAERDETVERALESYGTNLGMAFQLVDDALDYAADQARLGKTVGDDFREGKITL 248

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           PV+ A+  G++ ++ FW+  I   +   E+L  A  ++    A+  T  RA  Y   A++
Sbjct: 249 PVLAAYAAGSEEDRAFWQRVIERSEQQPEDLDHALQLIARTDAIRITLDRATEYADAARE 308

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRL 321
           +L   P    ++ L +   + + RL
Sbjct: 309 ALSIFPPGHLRQLLQDTASYTVSRL 333


>gi|311693395|gb|ADP96268.1| trans-hexaprenyltranstransferase [marine bacterium HP15]
          Length = 322

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 197/317 (62%), Gaps = 2/317 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           D    D  +VN LI++R+ SDV ++  + +Y+I SGGKRLRP+L L ++    Y  ++H+
Sbjct: 8   DTVADDFSRVNDLIIQRLSSDVPLVEKIAQYIIESGGKRLRPLLVLLSSQAAGYEENDHL 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL ++AF M++E K
Sbjct: 68  KLAAVIEFLHTATLLHDDVVDTSDMRRGRSTANARWGNAPSVLVGDFLYARAFEMMVELK 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   ++ LS     +AEGE+ QL   KN D+TEE Y+ VI +KTA+LF AA    +L+A 
Sbjct: 128 SLRIMDVLSHATAVIAEGEVMQLMNVKNPDLTEEQYMKVIHNKTAMLFEAASHTGALLAH 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                   LK YG +LG+AFQLVDDVLDY+G+   MGKN+G+D   GK TLP+I A   G
Sbjct: 188 ASAEQELGLKDYGKHLGLAFQLVDDVLDYQGDAEAMGKNVGDDLAEGKTTLPLIHAMSHG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  E+   +  I  G   +++L +   I+  + A+  T  +A    + A+  L  LPDS 
Sbjct: 248 TGEERQLIRQAIRKG--GLDDLPRILDIVERSGAIEYTMAKAREQAELAQTCLLSLPDSG 305

Query: 306 WKKSLMEVVDFCLQRLN 322
            K+++  + +  + R++
Sbjct: 306 HKEAMELLTEVAVARVS 322


>gi|212636824|ref|YP_002313349.1| Octaprenyl-diphosphate synthase [Shewanella piezotolerans WP3]
 gi|212558308|gb|ACJ30762.1| Octaprenyl-diphosphate synthase [Shewanella piezotolerans WP3]
          Length = 323

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 193/310 (62%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y G++H+ LA  
Sbjct: 13  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSILAARAIDYNGESHLKLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E KS E L
Sbjct: 73  IEFIHTASLLHDDVVDESMLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELKSLEVL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E L+     LAEGE+ QL    + D TE+ Y+ VI  KTA LF AA  ++ L+A     V
Sbjct: 133 EILADATNVLAEGEVLQLMNCNDPDTTEDSYMRVIYCKTAKLFEAATRLAGLLAESSEEV 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           + AL  YG  LG AFQL DD+LDY  E  E+GKNIG+D   GKPTLP+I A   G+  EK
Sbjct: 193 QTALAEYGKFLGTAFQLTDDLLDYTAETEELGKNIGDDLAEGKPTLPLIFAMANGSDTEK 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    E+++     ++   AL  TE RA     KA  +L  LP+S +K +L
Sbjct: 253 ALIREAIEKGD-GTEHIEVILSALKSCGALEYTEQRAIEESNKAIAALNILPESEYKTAL 311

Query: 311 MEVVDFCLQR 320
           + +    +QR
Sbjct: 312 VSLAKIAVQR 321


>gi|296116309|ref|ZP_06834925.1| Polyprenyl synthetase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977128|gb|EFG83890.1| Polyprenyl synthetase [Gluconacetobacter hansenii ATCC 23769]
          Length = 334

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 197/315 (62%), Gaps = 4/315 (1%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD----NHVL 66
           DM   N  I++R+ S V +IP +  +L+ +GGKRLRP+LTLA+A +  Y  D     HV 
Sbjct: 19  DMAACNRAIVERMDSPVALIPQLAAHLVAAGGKRLRPLLTLASARLCGYEPDATHQRHVA 78

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG  +A  ++GN+ SVLVGDFL +++F ++ +  S
Sbjct: 79  LAACVEFIHTATLLHDDVVDESTLRRGLASANAIFGNKASVLVGDFLFARSFQLMTDDGS 138

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + +  LS  + T+AEGE+ Q+S   +L  + E YL VI  KTA LF+AA  V +++A  
Sbjct: 139 LKVMNILSSASATIAEGEVLQMSTQNDLSTSIEKYLEVIHGKTAALFAAACRVGAVVADQ 198

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              V +AL SYG NLG+AFQLVDD LDY  +   +GK IG+DFR GK TLPV+ A+  G 
Sbjct: 199 PLKVEEALDSYGTNLGMAFQLVDDALDYAADQATLGKTIGDDFREGKITLPVLTAYNAGD 258

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           ++++ FW+  I + + + ++L  A  ++    A+  T   A  Y + A  +L   P S  
Sbjct: 259 EKDRVFWRRVIEESEQTPDDLDHALELIARTNAIGITLDHATRYAEAASQALDIFPHSRL 318

Query: 307 KKSLMEVVDFCLQRL 321
           K+ L +   + + RL
Sbjct: 319 KQLLQDTASYTVSRL 333


>gi|90020654|ref|YP_526481.1| phage tail region protein [Saccharophagus degradans 2-40]
 gi|89950254|gb|ABD80269.1| Trans-hexaprenyltranstransferase [Saccharophagus degradans 2-40]
          Length = 320

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 210/320 (65%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+    +  +D  +VN LI+ ++ SDV ++ ++  Y++ +GGKRLRP+L L TA  L Y 
Sbjct: 1   MQSFYKVVQEDFAEVNTLIVNQLHSDVGLVENIGHYIVDAGGKRLRPLLVLLTARALGYN 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ H+ L+  IEFIHTATLLHDDVVD SALRRG+  A   WGN  SVLVGDFL S+AF M
Sbjct: 61  GNQHLSLSAIIEFIHTATLLHDDVVDVSALRRGRPTANANWGNAPSVLVGDFLYSRAFQM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E      ++ L+     ++EGE++QL  ++N +VTE++Y+ VI  KTA LF AA E +
Sbjct: 121 MVEIGEMGIMKELANTTNVISEGEVQQLVNARNPEVTEQNYMTVIHKKTAALFEAACETA 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG   +  +A++SYG +LG+AFQLVDDVLDY+G+  E+GKN+G+D   GKPTLP+I 
Sbjct: 181 AILAGADAATCKAVRSYGYHLGVAFQLVDDVLDYQGDAEELGKNVGDDLAEGKPTLPLIY 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
               G+  E    K  I +   S++ L++   I++    L  T+  A  +  +AK ++  
Sbjct: 241 TINNGSAEEAELVKQAIINS--SLDKLQQIVDIVQRRGGLEYTQQCAQDHINRAKQAIAL 298

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ ++ ++ ++ DF ++R
Sbjct: 299 LPETEFRSAMEDLADFAIKR 318


>gi|323961158|gb|EGB56772.1| polyprenyl synthetase [Escherichia coli H489]
          Length = 323

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M   R+L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACRSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|256822892|ref|YP_003146855.1| polyprenyl synthetase [Kangiella koreensis DSM 16069]
 gi|256796431|gb|ACV27087.1| Polyprenyl synthetase [Kangiella koreensis DSM 16069]
          Length = 323

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 197/317 (62%), Gaps = 2/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + DL   + +  N +I+ R+ SDV ++  V  Y++ +GGKRLRPML L  A  L Y+G  
Sbjct: 7   IRDLVADEFDTTNQIIIDRLQSDVVLVNQVGHYIVAAGGKRLRPMLLLLAAKSLNYQGKF 66

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H  LA  IE IHTATLLHDDVVD+S LRRG+  A  ++GNQ SVLVGD+L S++F M++E
Sbjct: 67  HPNLAAVIELIHTATLLHDDVVDESDLRRGRQTANAMFGNQASVLVGDYLYSRSFQMMVE 126

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
                 +E LS     +A GE+ QL    + DV E  Y  VI+ KTA+LF+AA ++++++
Sbjct: 127 VGEMRVMEVLSETTNEVAAGEVLQLMNVNDPDVDEASYYQVIERKTAILFAAATQLAAIL 186

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG    V + L+ YG+ LG AFQLVDD LDY  +  E+GKN+G+D   GKPTLP+I A Q
Sbjct: 187 AGASKDVEEGLREYGLQLGNAFQLVDDALDYAADTEELGKNVGDDLAEGKPTLPLIYAMQ 246

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G+  +    +  I  G   ++N+     I+++  A+  T   A     KA  +L+ LP+
Sbjct: 247 HGSDTDAQMIRQAIEQG--GLDNMDAILRIIQDTGAIEYTYQSAEKAVAKAISALKPLPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+++ +  L+R
Sbjct: 305 SQYKQALIDIANLSLKR 321


>gi|329113331|ref|ZP_08242112.1| Octaprenyl-diphosphate synthase [Acetobacter pomorum DM001]
 gi|326697156|gb|EGE48816.1| Octaprenyl-diphosphate synthase [Acetobacter pomorum DM001]
          Length = 356

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 196/324 (60%), Gaps = 4/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L D    DM   N +I+ R+ S V +IP +  +L+ +GGKRLRP+LTLA A M  Y 
Sbjct: 31  LKALADYLASDMLACNQVIVDRMQSPVALIPQLAAHLVAAGGKRLRPLLTLAAARMCGYN 90

Query: 61  GDN----HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
             +    HV +A  +EFIHTATLLHDDVVDDS LRRG  +A  ++GN+ SVLVGDFL ++
Sbjct: 91  NQDGRMRHVEIAACVEFIHTATLLHDDVVDDSQLRRGLASANAIFGNKASVLVGDFLFAR 150

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           +F ++    S   +  LS  + TLAEGE+ Q++   +L  + + YL VI  KTA LF+AA
Sbjct: 151 SFQILTADASLGVMAILSAASATLAEGEVMQMTTQNDLSTSVDQYLQVIYGKTAALFAAA 210

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            E  ++I       R+AL+ YG NLG+AFQLVDD LDY  +   +GK +G+DFR GK TL
Sbjct: 211 CESGAVIGEATPEQREALRMYGANLGMAFQLVDDALDYAADQATLGKEVGDDFREGKVTL 270

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           PV+ A++ G + ++ FW+  I +      +L+ A   + E  A+  T   A  Y  KA++
Sbjct: 271 PVLAAYEAGNEEDRIFWRRVIEECDQHPGDLEAALGRIAETNAIGITLKCAEDYAAKARE 330

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L   PD + K  L+E   +   R
Sbjct: 331 NLSMFPDDTLKNLLLETASYSASR 354


>gi|237809123|ref|YP_002893563.1| Trans-hexaprenyltranstransferase [Tolumonas auensis DSM 9187]
 gi|237501384|gb|ACQ93977.1| Trans-hexaprenyltranstransferase [Tolumonas auensis DSM 9187]
          Length = 323

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 199/319 (62%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           +++  L   DM+ VN LI +R+ SDV ++  +  Y+I  GGKR+RP+L + +A  + Y+G
Sbjct: 4   QVIRTLADDDMQAVNQLIYQRLQSDVALVNQLAYYIISGGGKRIRPLLAVLSARAIGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           D H+ LA  IEFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL ++AF M+
Sbjct: 64  DAHISLATIIEFIHTATLLHDDVVDESVLRRGRDTANQLFGNAASVLVGDFLHTRAFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +E  +   ++ LS     +AEGE+ QL    +   TE++YL VI  KTA LF AA   ++
Sbjct: 124 VELGNMRIMQLLSEATNLIAEGEVMQLMNCNDPSTTEDNYLQVIYCKTAKLFEAATHCAA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++A     + QAL+ YG  LG AFQL+DDV+DY      MGKN+G+D   GKPTLP+I A
Sbjct: 184 ILANQPAHIEQALRDYGKYLGTAFQLIDDVMDYSSSSETMGKNVGDDLSEGKPTLPLIYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
             +GT  +K   +  I + +  +E L +   I+++  AL  T  RA    +KA D+L  L
Sbjct: 244 MVQGTPEQKKRIEQAITE-RDGMEYLDEILDILQQTHALEYTVTRAEQEARKAIDALSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           PDS +K +L  + +  + R
Sbjct: 303 PDSDYKTALQALAESAVHR 321


>gi|284006654|emb|CBA71916.1| octaprenyl-diphosphate synthase [Arsenophonus nasoniae]
          Length = 323

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 195/317 (61%), Gaps = 1/317 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT KDME VN  IL ++ SDV +I  +  Y+I  GGK++RPM+ +     L Y G  H+
Sbjct: 8   NLTAKDMEAVNKAILNQLNSDVHLINQLGHYIISGGGKKIRPMIAILVGRALGYEGKKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S LRRGK  A  V+GN  SVLVGDF+ +++F M+ E  
Sbjct: 68  NVAALIEFIHTATLLHDDVVDESTLRRGKKTANAVFGNAASVLVGDFIYTRSFQMMTELD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ +S     +AEGE+ QL    N D+TE  Y+ +I SKTA LF AA   S++++G
Sbjct: 128 SMPILKLMSDATNVIAEGEVSQLINCNNPDITESTYMQIIYSKTARLFEAATHASAIVSG 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              + +QAL+ YG  LG AFQL+DD+LDY  +   +GKNIG+D   GK TLP++ A ++G
Sbjct: 188 ANETQQQALRDYGRYLGTAFQLIDDLLDYDADSTTIGKNIGDDLDEGKLTLPLLHAMKKG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  E    +++I  G      L    I M+   +L  T  RA     KA  +L  LPD+S
Sbjct: 248 TAEESALIRNSIEKGN-GRHLLSAILITMKRCGSLEYTRDRAREEADKAIKALDILPDTS 306

Query: 306 WKKSLMEVVDFCLQRLN 322
           +K +L+ +    +QRL+
Sbjct: 307 YKDALISLACISVQRLS 323


>gi|167622844|ref|YP_001673138.1| polyprenyl synthetase [Shewanella halifaxensis HAW-EB4]
 gi|167352866|gb|ABZ75479.1| Polyprenyl synthetase [Shewanella halifaxensis HAW-EB4]
          Length = 323

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 196/322 (60%), Gaps = 1/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  +  LT  DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+
Sbjct: 3   LNAIRQLTDSDMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSILAARAIDYK 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA  IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 63  GDSHLKLAAIIEFIHTASLLHDDVVDESMLRRGRKTANALFGNSASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E K  + LE L+     LAEGE+ QL    + D TE+ Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELKCLDVLEILADATNVLAEGEVLQLMNCNDPDTTEDSYMRVIYCKTAKLFEAATRLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            L+A     V+ AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I 
Sbjct: 183 GLLADSPIEVQTALAEYGKYLGTAFQLTDDLLDYTADTEELGKNIGDDLAEGKPTLPLIF 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   EK   +  I  G    E+++     +    AL  TE RA    +KA  +L  
Sbjct: 243 AMANGNDTEKALIREAIEKGD-GTEHIEVILAALNNCGALKYTEQRAIEESEKAIAALAI 301

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           +P+S +K +L+ +     QR N
Sbjct: 302 IPESDYKTALISLAKLATQRSN 323


>gi|307543898|ref|YP_003896377.1| octylprenyl diphosphate synthase [Halomonas elongata DSM 2581]
 gi|307215922|emb|CBV41192.1| octylprenyl diphosphate synthase [Halomonas elongata DSM 2581]
          Length = 333

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 188/311 (60%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D   VN  I  ++ S + ++  + +Y++ SGGKR+RP+L L  A  L Y GD HV LA 
Sbjct: 23  EDFAAVNRTIQTQLASRIPLVEAIGQYIVDSGGKRMRPLLVLLAARSLGYEGDQHVALAT 82

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEF+HT+TLLHDDVVD+S +RRG+  A   WGN  SVLVGDFL S++F M++   S   
Sbjct: 83  LIEFMHTSTLLHDDVVDESHMRRGRATANDAWGNAPSVLVGDFLYSRSFQMMVGVGSMRI 142

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +E LS   CT+AEGE++QL+   N DV E  Y   I+ KTA+LF AA    ++IA     
Sbjct: 143 MEILSAATCTIAEGEVQQLTNVGNPDVDEAAYFETIQGKTAMLFEAASHCGAIIADATPE 202

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              AL++YG  LG+AFQLVDD+LDYRG+ + MGKN+G+D   GKPTLP+I A   G+  +
Sbjct: 203 QEAALQAYGRYLGLAFQLVDDLLDYRGDADTMGKNVGDDLAEGKPTLPLIQAMVTGSPEQ 262

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               +  I  G +  E L +   I+ +  AL  T+ RA     KA   L  LP S ++ S
Sbjct: 263 AKVIRQAIRQGGL--ERLDEVLAIVHDTGALDYTQRRAEEMSAKALAQLEVLPPSVFRDS 320

Query: 310 LMEVVDFCLQR 320
           + ++    + R
Sbjct: 321 MEQLAHRAVDR 331


>gi|283788174|ref|YP_003368039.1| octaprenyl-diphosphate synthase [Citrobacter rodentium ICC168]
 gi|282951628|emb|CBG91328.1| octaprenyl-diphosphate synthase [Citrobacter rodentium ICC168]
          Length = 323

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 200/320 (62%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG  ++  + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCSDAQEKGLQDYGRYLGTAFQLIDDLLDYSADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMRHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQT 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|117926629|ref|YP_867246.1| trans-hexaprenyltranstransferase [Magnetococcus sp. MC-1]
 gi|117610385|gb|ABK45840.1| Trans-hexaprenyltranstransferase [Magnetococcus sp. MC-1]
          Length = 331

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/318 (42%), Positives = 205/318 (64%), Gaps = 1/318 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEY-RGD 62
           L  L  +D+++ N +IL+++ S VE+I  V  +L+ SGGKRLRP+LTL TA +  Y + D
Sbjct: 12  LRSLVEQDLQRTNEVILEQLNSPVELITQVGDHLLNSGGKRLRPILTLVTAKLFGYQKAD 71

Query: 63  NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVI 122
            H LLA  +EFIHTATLLHDDVVD S  RRG+  A  VWGN+  +LVGDFL S++F +++
Sbjct: 72  VHALLAAVVEFIHTATLLHDDVVDKSNTRRGQATANSVWGNKAPILVGDFLFSRSFQIMV 131

Query: 123 ETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSL 182
           E      L  +S     ++EGE+ QL  S +L   EE YL VI+ KTA LF++A ++ ++
Sbjct: 132 EHGDLRVLRIVSDCCAIISEGEVMQLVASNDLATDEERYLDVIRHKTASLFASASQLGAV 191

Query: 183 IAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAF 242
           +A   + + Q +  YGM LG A+Q+VDD+LDY  E  ++GKN+G+DF+ GK TLPVI AF
Sbjct: 192 VADQSDEIAQRMYDYGMMLGTAYQVVDDLLDYSAETEKLGKNVGDDFQEGKITLPVIHAF 251

Query: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
           + G   E+ FW+  + D +    +   A  ++ ++ +L  T  +A +   KAK +L  LP
Sbjct: 252 RSGDAEEQAFWRRCLEDEEQDESSFDHARALIAKHGSLDYTMSQARALIVKAKAALAPLP 311

Query: 303 DSSWKKSLMEVVDFCLQR 320
           +S+ +++LM++ D  + R
Sbjct: 312 ESAERQALMDLADLSVDR 329


>gi|310815063|ref|YP_003963027.1| decaprenyl diphosphate synthase [Ketogulonicigenium vulgare Y25]
 gi|308753798|gb|ADO41727.1| decaprenyl diphosphate synthase [Ketogulonicigenium vulgare Y25]
          Length = 325

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 194/310 (62%), Gaps = 2/310 (0%)

Query: 14  KVNFLILKRICSDV-EMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIE 72
           KVN  +   + SD    I  V  +LI +GGKRLRPMLT+A A +  Y G +H+ LA  +E
Sbjct: 17  KVNETLHSYMQSDAAPRIRQVSAHLIDAGGKRLRPMLTVAAARLCGYDGPHHIHLAATVE 76

Query: 73  FIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEA 132
           FIHTATLLHDDVVDDS  RRG+  A L+W N +SVLVGD+L S+AF ++  T S   L A
Sbjct: 77  FIHTATLLHDDVVDDSKQRRGRPTANLLWDNMSSVLVGDYLFSRAFQLMTITGSMPILAA 136

Query: 133 LSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQ 192
           L+  + T+AEGE+ QLS +++L  T E Y+ + + KTA LFSAA  V +++A   +++ Q
Sbjct: 137 LADASATIAEGEVLQLSTARDLSATPETYIRIARGKTAALFSAATRVGAMLAEPGDAIVQ 196

Query: 193 ALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNF 252
           A+  YG  LGIAFQ+ DD+LDY G  + +GKN G+D R GK TLPVI A  +    E+ F
Sbjct: 197 AMHDYGDALGIAFQIADDLLDYTG-TDAIGKNRGDDLREGKLTLPVIWALDKADAAERAF 255

Query: 253 WKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLME 312
           W  TI  G +   +   A  IM +  +L+ T   A  +   AK +L+ LP    +++L E
Sbjct: 256 WTRTIGKGDVQDGDFDAALSIMDKRGSLLATADEARRWAGLAKAALQALPPQPLRETLEE 315

Query: 313 VVDFCLQRLN 322
           + D+ + RL+
Sbjct: 316 LADYVVARLS 325


>gi|53802938|ref|YP_115384.1| octaprenyl-diphosphate synthase [Methylococcus capsulatus str.
           Bath]
 gi|53756699|gb|AAU90990.1| octaprenyl-diphosphate synthase [Methylococcus capsulatus str.
           Bath]
          Length = 340

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 199/306 (65%), Gaps = 2/306 (0%)

Query: 15  VNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFI 74
           V+ LIL+ + SDV +I  + +Y++ SGGKRLRPML L +A  L Y GD+H+ LA  IEFI
Sbjct: 35  VDSLILRELHSDVVLINQIGQYIVGSGGKRLRPMLHLLSAKALGYPGDHHITLAAVIEFI 94

Query: 75  HTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALS 134
           HTATLLHDDVVD+SALRRG+ +A  +WGN  SVLVGD+L S++F +++  +    ++ LS
Sbjct: 95  HTATLLHDDVVDESALRRGQDSANALWGNSASVLVGDYLYSRSFELMVRVQDMRVMDILS 154

Query: 135 LVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQAL 194
                +AEGE+ QL    N    E  YL VI  KTA+LFSAA ++++++AG  ++V ++L
Sbjct: 155 RTTTAIAEGEVLQLLNCNNPATDEGRYLDVISRKTAILFSAAAQLAAVLAGSSHAVEESL 214

Query: 195 KSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWK 254
           K+YG  LGIAFQL DDVLDY+ +  E GKN+G+D   GKPTLP+I A  + +  E    +
Sbjct: 215 KNYGTYLGIAFQLKDDVLDYKADPEEWGKNLGDDLAEGKPTLPLIYALSQSSGAEAELLR 274

Query: 255 STINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVV 314
             I  G+   E+ KK + ++    A+  TE RA     KA + +  LP+S +K +L+ + 
Sbjct: 275 QAIEHGE--REHFKKVYAVIESTDAISYTERRARDAANKAIEQVTHLPESGYKDALIALA 332

Query: 315 DFCLQR 320
            F + R
Sbjct: 333 RFAVDR 338


>gi|331684834|ref|ZP_08385426.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli H299]
 gi|331078449|gb|EGI49655.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli H299]
          Length = 323

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN TSVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNATSVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|124265703|ref|YP_001019707.1| dimethylallyltransferase [Methylibium petroleiphilum PM1]
 gi|124258478|gb|ABM93472.1| Dimethylallyltransferase [Methylibium petroleiphilum PM1]
          Length = 330

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 141/314 (44%), Positives = 195/314 (62%), Gaps = 5/314 (1%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL   DM +V+ LI +R+ SDV +I  +  Y+I +GGKRLRPML L  A  L +RG    
Sbjct: 16  DLVAADMGEVDALIRRRLASDVALINQISHYIISAGGKRLRPMLVLLFAQALGFRGPERF 75

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  +EFIHTATLLHDDVVD+SALRRG+  A   +GN  SVLVGDFL S+AF M++   
Sbjct: 76  ELAATVEFIHTATLLHDDVVDESALRRGRDTANARFGNAASVLVGDFLYSRAFQMMVSVN 135

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
               LE L+     +AEGE+ QL    + D++ +DYL VI+ KTA LF A+  + +++A 
Sbjct: 136 RMRVLEVLADATNVIAEGEVLQLMNMHDPDLSIDDYLRVIRFKTAKLFEASARLGAMLAD 195

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
               V  A   YG  LG AFQLVDD+LDY G  + +GKNIG+D R GKPTLP+++A  RG
Sbjct: 196 ASPGVETACADYGRALGTAFQLVDDLLDYEGATSALGKNIGDDLREGKPTLPLLVAMTRG 255

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +++  ++ I  G+  V+ L +   I+R   AL  T   A +   +A ++L  LPDS 
Sbjct: 256 TPAQRDVVRAAIEQGE--VQRLPEIIEIVRSTGALEATREVARAEVARACEALSVLPDSQ 313

Query: 306 WKKSLMEVVDFCLQ 319
           ++++L+     C Q
Sbjct: 314 YREALLH---LCAQ 324


>gi|89093572|ref|ZP_01166520.1| farnesyl pyrophosphate synthetase [Oceanospirillum sp. MED92]
 gi|89082262|gb|EAR61486.1| farnesyl pyrophosphate synthetase [Oceanospirillum sp. MED92]
          Length = 322

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 197/308 (63%), Gaps = 2/308 (0%)

Query: 13  EKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIE 72
           E VN  I+  + S+V ++  +  Y++ SGGKRLRP+L L  A    Y+GD HV LA  IE
Sbjct: 15  EAVNDYIINHLGSNVPLVEKIGHYIVESGGKRLRPLLVLLAANAAGYKGDKHVPLAAIIE 74

Query: 73  FIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEA 132
           FIHTATLLHDDVVD+S LRRGK  A   WGN  SVLVGDFL S+AF +++E  S + +E 
Sbjct: 75  FIHTATLLHDDVVDNSDLRRGKDTANAKWGNAPSVLVGDFLYSRAFQIMVEIGSMQIMEV 134

Query: 133 LSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQ 192
           +S     +AEGE+ QL  +KN D TEE Y+ VI  KTA+LF AA E  +++A      R+
Sbjct: 135 ISNATNVIAEGEVLQLLNTKNPDTTEEAYMQVILGKTAMLFEAATEAGAILADATAEERE 194

Query: 193 ALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNF 252
            L+ YG++LG AFQL+DDV+DY     EMGKN+G+D   GK TLP+I A + G + ++  
Sbjct: 195 GLRLYGLHLGTAFQLIDDVMDYLSTAEEMGKNVGDDLAEGKATLPLIHAMRAGNEEQRLL 254

Query: 253 WKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLME 312
            +  I  G   +++L+    I++E  A+  T+ +A     KA  +L  L DSS+K++L++
Sbjct: 255 VRQAIRKG--GLDDLQPIMDIVKETGAIEYTQQKAQEEADKAIAALSALSDSSFKETLVQ 312

Query: 313 VVDFCLQR 320
           + +  ++R
Sbjct: 313 LANMAVKR 320


>gi|15803727|ref|NP_289761.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 EDL933]
 gi|15833320|ref|NP_312093.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           Sakai]
 gi|168751593|ref|ZP_02776615.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754169|ref|ZP_02779176.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168765367|ref|ZP_02790374.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769043|ref|ZP_02794050.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168778214|ref|ZP_02803221.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781331|ref|ZP_02806338.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786073|ref|ZP_02811080.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|168800901|ref|ZP_02825908.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|195940043|ref|ZP_03085425.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208813351|ref|ZP_03254680.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818474|ref|ZP_03258794.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396313|ref|YP_002272657.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217327318|ref|ZP_03443401.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254795136|ref|YP_003079973.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261228198|ref|ZP_05942479.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255054|ref|ZP_05947587.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|12517802|gb|AAG58321.1|AE005547_7 octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           EDL933]
 gi|13363539|dbj|BAB37489.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187766779|gb|EDU30623.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014375|gb|EDU52497.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001013|gb|EDU69999.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358538|gb|EDU76957.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361792|gb|EDU80211.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189364885|gb|EDU83301.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189374093|gb|EDU92509.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|189376838|gb|EDU95254.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|208734628|gb|EDZ83315.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738597|gb|EDZ86279.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157713|gb|ACI35146.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209758168|gb|ACI77396.1| octaprenyl diphosphate synthase [Escherichia coli]
 gi|209758170|gb|ACI77397.1| octaprenyl diphosphate synthase [Escherichia coli]
 gi|209758172|gb|ACI77398.1| octaprenyl diphosphate synthase [Escherichia coli]
 gi|209758176|gb|ACI77400.1| octaprenyl diphosphate synthase [Escherichia coli]
 gi|217319685|gb|EEC28110.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254594536|gb|ACT73897.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|320189540|gb|EFW64199.1| Octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320640258|gb|EFX09830.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           G5101]
 gi|320645555|gb|EFX14564.1| octaprenyl diphosphate synthase [Escherichia coli O157:H- str.
           493-89]
 gi|320650865|gb|EFX19322.1| octaprenyl diphosphate synthase [Escherichia coli O157:H- str. H
           2687]
 gi|320666771|gb|EFX33750.1| octaprenyl diphosphate synthase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326337887|gb|EGD61721.1| Octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           1125]
 gi|326347457|gb|EGD71182.1| Octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           1044]
          Length = 323

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      LK     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLKPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|300309704|ref|YP_003773796.1| octaprenyldiphosphate synthase [Herbaspirillum seropedicae SmR1]
 gi|300072489|gb|ADJ61888.1| octaprenyldiphosphate synthase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 309

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 200/309 (64%), Gaps = 2/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           ME VN +I +++ S+V ++  V +Y+I +GGKRLRP+L +  A    Y+G++H  LA  I
Sbjct: 1   MEAVNAVIRRQLYSEVPLVNQVAEYIISAGGKRLRPVLVVLIANAFGYKGEHHHSLAAVI 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S+LRRGK  A  ++GN  SVLVGDFL S+AF M++   +   +E
Sbjct: 61  EFIHTATLLHDDVVDESSLRRGKQTANAMFGNAASVLVGDFLYSRAFQMMVAVGNPRVME 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            ++     +AEGE+ QL    N DV E  YL VI+SKTA LF AA ++ +LIAG   +  
Sbjct: 121 IVADATNVIAEGEVLQLLNMHNPDVDENGYLQVIRSKTAKLFEAASQIGALIAGADEAGI 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +A   YG ++G AFQL+DDVLDY G   E+GKN+G+D R GKPTLP+I   Q GT +++ 
Sbjct: 181 EAAAEYGRSIGTAFQLIDDVLDYSGNSAEIGKNVGDDLREGKPTLPLIWLMQHGTPQQRE 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             ++ I +G    ++  +    +  + AL  T  +A    ++A D++  LPDS +KKSL+
Sbjct: 241 LVRTCIENG--DEQHFDEVLSAITHSGALAYTREQAEIAARRAADAIISLPDSQFKKSLL 298

Query: 312 EVVDFCLQR 320
           E+  F + R
Sbjct: 299 ELSAFAVDR 307


>gi|254785128|ref|YP_003072556.1| octaprenyl-diphosphate synthase [Teredinibacter turnerae T7901]
 gi|237684423|gb|ACR11687.1| octaprenyl-diphosphate synthase [Teredinibacter turnerae T7901]
          Length = 320

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 201/320 (62%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+    +   D + VN LI+ ++ SDV+++ ++ +Y++ +GGKRLRP+L L  A  L Y+
Sbjct: 1   MQSFHKVVEADFDAVNRLIVAKLHSDVDLVENIGQYIVDAGGKRLRPLLVLLAAKALGYQ 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H+ LA  IEFIHTATLLHDDVVD SALRRG+ +A   WGN  SVLVGDFL S+AF M
Sbjct: 61  GQQHIELAAIIEFIHTATLLHDDVVDVSALRRGRPSANAQWGNAPSVLVGDFLYSRAFQM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + +  +S     ++EGE++QL  +K+ DVTE++Y+ VI  KTA LF AA E  
Sbjct: 121 MVGVGNIDVMAIMSDTTNVISEGEVQQLVNAKDPDVTEQNYMAVIHKKTAALFEAACETG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IAGV +  R ++K  G +LG+AFQLVDD LDY G    +GKN+G+D   GKPTLP+I 
Sbjct: 181 AVIAGVSSEQRASIKQIGYHLGVAFQLVDDALDYHGNTESLGKNVGDDLAEGKPTLPLIY 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
              +GT  E    ++ I  G   V+ L++   I+RE   L  T   A  +  +A   +  
Sbjct: 241 TMAQGTPEEAALIRTAIQQG--GVDKLQQIISIVRERGGLEYTMRCANRHADEALTLIDQ 298

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S ++ +L ++  F + R
Sbjct: 299 LPTSPFQSALADLTRFSVSR 318


>gi|208809557|ref|ZP_03251894.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208729358|gb|EDZ78959.1| octaprenyl-diphosphate synthase [Escherichia coli O157:H7 str.
           EC4206]
          Length = 324

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 194/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K   +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y G
Sbjct: 5   KKYNELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYEG 64

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+
Sbjct: 65  NAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMM 124

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S 
Sbjct: 125 TSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSG 184

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ A
Sbjct: 185 ILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLHA 244

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              GT  +    ++ I  G      LK     M    +L  T  RA     KA  +L+ L
Sbjct: 245 MHHGTPEQAQMIRTAIEQGN-GRHLLKPVLEAMNACGSLEWTRQRAEEEADKAIAALQVL 303

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           PD+ W+++L+ +    +QR
Sbjct: 304 PDTPWREALIGLAHIAVQR 322


>gi|307262498|ref|ZP_07544143.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306867875|gb|EFM99706.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 331

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 204/324 (62%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 7   LEQIQTLAKQDMQAVDAEILAQLNSEVVLINQLGNYIIAGGGKRIRPLIAVLAANALGYR 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 67  GNKHVTCAAFIEFVHTATLLHDDVVDESNMRRGRATANATFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S E L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTDVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AGV+ SV  ALK YG  LG AFQL+DD+LDY  +    GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGVEKSVETALKDYGCYLGTAFQLIDDILDYSAKAESFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AF----QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A     ++G + + +  +S I +G    E +     IM E+++L     RA    QKA D
Sbjct: 247 AMHTAQEKGNQAQVDMIRSAIENGG-EREQIPAVLEIMAEHQSLEYAMTRAKQEAQKAVD 305

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L  LP+S +K++L+ +    + R
Sbjct: 306 ALAVLPESEYKQALISLAYLSVDR 329


>gi|258542159|ref|YP_003187592.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633237|dbj|BAH99212.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636296|dbj|BAI02265.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639349|dbj|BAI05311.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642405|dbj|BAI08360.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645460|dbj|BAI11408.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648513|dbj|BAI14454.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651566|dbj|BAI17500.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654557|dbj|BAI20484.1| geranylgeranyl pyrophosphate synthase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 356

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 195/324 (60%), Gaps = 4/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K L D    DM   N +I+ R+ S V +IP +  +L+ +GGKRLRP+LTLA A M  Y 
Sbjct: 31  LKALADYLASDMLACNQVIVDRMQSPVALIPQLAAHLVAAGGKRLRPLLTLAAARMCGYN 90

Query: 61  GDN----HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
             +    HV +A  +EFIHTATLLHDDVVDDS LRRG  +A  ++GN+ SVLVGDFL ++
Sbjct: 91  NQDGRMRHVEIAACVEFIHTATLLHDDVVDDSQLRRGLASANAIFGNKASVLVGDFLFAR 150

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           +F ++    S   +  LS  + TLAEGE+ Q++   +L  + E YL VI  KTA LF+AA
Sbjct: 151 SFQILTADASLGVMAILSAASATLAEGEVMQMTTQNDLSTSVEQYLQVIYGKTAALFAAA 210

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            E  ++I       R+AL+ YG NLG+AFQLVDD LDY  +   +GK +G+DFR GK TL
Sbjct: 211 CESGAVIGEATPEQREALRMYGANLGMAFQLVDDALDYAADQATLGKEVGDDFREGKVTL 270

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           PV+ A+  G + ++ FW+  I +      +L+ A   + +  A+  T   A  Y  KA++
Sbjct: 271 PVLAAYDAGDEEDRIFWRRVIEECDQHPGDLEAALDRIAKTNAIGITLKCAEDYAAKARE 330

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L   PD + K  L+E   +   R
Sbjct: 331 NLSMFPDDTLKNLLLETASYSASR 354


>gi|190151351|ref|YP_001969876.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251769|ref|ZP_07337940.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246933|ref|ZP_07528998.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249070|ref|ZP_07531077.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251268|ref|ZP_07533189.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307255915|ref|ZP_07537716.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260368|ref|ZP_07542075.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307264706|ref|ZP_07546286.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189916482|gb|ACE62734.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302649199|gb|EFL79384.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306852218|gb|EFM84458.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854358|gb|EFM86554.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306856784|gb|EFM88919.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306861183|gb|EFM93176.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865619|gb|EFM97500.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306870018|gb|EFN01782.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 331

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 204/324 (62%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 7   LEQIQTLAKQDMQAVDAEILAQLNSEVVLINQLGNYIIAGGGKRIRPLIAVLAANALGYR 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 67  GNKHVTCAAFIEFVHTATLLHDDVVDESDMRRGRATANATFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S E L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTDVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AGV+ SV  ALK YG  LG AFQL+DD+LDY  +    GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGVEKSVETALKDYGCYLGTAFQLIDDILDYSAKAESFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AF----QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A     ++G + + +  +S I +G    E +     IM E+++L     RA    QKA D
Sbjct: 247 AMHTAQEKGNQAQVDMIRSAIENGG-EREQIPAVLEIMAEHQSLEYAMTRAKQEAQKAVD 305

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L  LP+S +K++L+ +    + R
Sbjct: 306 ALAVLPESEYKQALISLAYLSVDR 329


>gi|46143904|ref|ZP_00133901.2| COG0142: Geranylgeranyl pyrophosphate synthase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209449|ref|YP_001054674.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           L20]
 gi|307258100|ref|ZP_07539852.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|126098241|gb|ABN75069.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306863463|gb|EFM95394.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 331

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 204/324 (62%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 7   LEQIQTLAKQDMQAVDAEILAQLNSEVVLINQLGNYIIAGGGKRIRPLIAVLAANALGYR 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 67  GNKHVTCAAFIEFVHTATLLHDDVVDESDMRRGRATANATFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S E L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTDVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AGV+ SV  ALK YG  LG AFQL+DD+LDY  +    GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGVEKSVETALKDYGCYLGTAFQLIDDILDYSAKAESFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AF----QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A     ++G + + +  +S I +G    E +     IM E+++L     RA    QKA D
Sbjct: 247 AMHTAQEKGNQAQVDIIRSAIENGG-EREQIPAVLEIMAEHQSLEYAMTRAKQEAQKAVD 305

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L  LP+S +K++L+ +    + R
Sbjct: 306 ALAVLPESEYKQALISLAYLSVDR 329


>gi|193065379|ref|ZP_03046450.1| octaprenyl-diphosphate synthase [Escherichia coli E22]
 gi|260846000|ref|YP_003223778.1| octaprenyl diphosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|192927020|gb|EDV81643.1| octaprenyl-diphosphate synthase [Escherichia coli E22]
 gi|257761147|dbj|BAI32644.1| octaprenyl diphosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|323162879|gb|EFZ48714.1| polyprenyl synthetase family protein [Escherichia coli E128010]
          Length = 323

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 202/322 (62%), Gaps = 5/322 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTI--NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
           A   GT  +    ++ I   +G+  +E +++A   M    +L  T  RA     KA  +L
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGNGRHLLEPVQEA---MNACGSLEWTRQRAEEEADKAIAAL 299

Query: 299 RCLPDSSWKKSLMEVVDFCLQR 320
           + LPD+ W+++L+ +    +QR
Sbjct: 300 QVLPDTPWREALIGLAHIAVQR 321


>gi|170683435|ref|YP_001745459.1| octaprenyl diphosphate synthase [Escherichia coli SMS-3-5]
 gi|170521153|gb|ACB19331.1| octaprenyl-diphosphate synthase [Escherichia coli SMS-3-5]
          Length = 323

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKNIG+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNIGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|331664800|ref|ZP_08365705.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli TA143]
 gi|331058048|gb|EGI30030.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli TA143]
          Length = 323

 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD++W+++L+ +    +QR
Sbjct: 302 LPDTTWREALIGLAHIAVQR 321


>gi|26249771|ref|NP_755811.1| octaprenyl diphosphate synthase [Escherichia coli CFT073]
 gi|26110199|gb|AAN82385.1|AE016767_145 Octaprenyl-diphosphate synthase [Escherichia coli CFT073]
          Length = 323

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALVSLAHIAVQR 321


>gi|215488503|ref|YP_002330934.1| octaprenyl diphosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215266575|emb|CAS11014.1| octaprenyl diphosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 323

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAIGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|218550470|ref|YP_002384261.1| octaprenyl diphosphate synthase [Escherichia fergusonii ATCC 35469]
 gi|218358011|emb|CAQ90657.1| octaprenyl diphosphate synthase [Escherichia fergusonii ATCC 35469]
 gi|324115209|gb|EGC09173.1| polyprenyl synthetase [Escherichia fergusonii B253]
 gi|325498768|gb|EGC96627.1| octaprenyl diphosphate synthase [Escherichia fergusonii ECD227]
          Length = 323

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + ++TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPNITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      Q L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEQGLQDYGRYLGTAFQLIDDLLDYSADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMRHGTPEQAQMIRNAIEHGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIKALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|16762067|ref|NP_457684.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16766600|ref|NP_462215.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143556|ref|NP_806898.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415234|ref|YP_152309.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364164|ref|YP_002143801.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205354206|ref|YP_002228007.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858553|ref|YP_002245204.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213053033|ref|ZP_03345911.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213426652|ref|ZP_03359402.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213646987|ref|ZP_03377040.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|238910099|ref|ZP_04653936.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289825815|ref|ZP_06544983.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25314317|pir||AH0903 octaprenyl-diphosphate synthase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16421862|gb|AAL22174.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504370|emb|CAD07822.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139191|gb|AAO70758.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56129491|gb|AAV78997.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197095641|emb|CAR61209.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205273987|emb|CAR38993.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206710356|emb|CAR34714.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248470|emb|CBG26307.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|301159854|emb|CBW19373.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|322684901|gb|EFY80899.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323211311|gb|EFZ96155.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323224032|gb|EGA08325.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230319|gb|EGA14438.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323246927|gb|EGA30893.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254140|gb|EGA37960.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|332990163|gb|AEF09146.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 323

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMRHGTPEQSAMIRTAIEQGN-GRHLLEPVLEAMTTCGSLEWTRQRAEEEADKAISALQI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|323966367|gb|EGB61801.1| polyprenyl synthetase [Escherichia coli M863]
 gi|327251278|gb|EGE62967.1| polyprenyl synthetase family protein [Escherichia coli STEC_7v]
          Length = 323

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCSPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|254038351|ref|ZP_04872409.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Escherichia
           sp. 1_1_43]
 gi|226839975|gb|EEH71996.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Escherichia
           sp. 1_1_43]
          Length = 340

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 20  LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 79

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 80  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 139

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 140 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 199

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 200 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 259

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 260 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 318

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 319 LPDTPWREALIGLAHIAVQR 338


>gi|161616314|ref|YP_001590279.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194443184|ref|YP_002042563.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449256|ref|YP_002047334.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472845|ref|ZP_03078829.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736065|ref|YP_002116255.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195873559|ref|ZP_02697387.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197250149|ref|YP_002148230.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264749|ref|ZP_03164823.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197301014|ref|ZP_02663064.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|198241919|ref|YP_002217276.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200386848|ref|ZP_03213460.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204931208|ref|ZP_03222002.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205357197|ref|ZP_02345799.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205358083|ref|ZP_02575589.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205358511|ref|ZP_02656973.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205359199|ref|ZP_02668072.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205359738|ref|ZP_02831626.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205360595|ref|ZP_02684656.2| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|224585102|ref|YP_002638901.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|161365678|gb|ABX69446.1| hypothetical protein SPAB_04122 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401847|gb|ACF62069.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407560|gb|ACF67779.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194459209|gb|EDX48048.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194711567|gb|ACF90788.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633125|gb|EDX51539.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213852|gb|ACH51249.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243004|gb|EDY25624.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289078|gb|EDY28447.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197936435|gb|ACH73768.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603946|gb|EDZ02491.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204319975|gb|EDZ05181.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205323255|gb|EDZ11094.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327615|gb|EDZ14379.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333924|gb|EDZ20688.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205337771|gb|EDZ24535.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205343490|gb|EDZ30254.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348475|gb|EDZ35106.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|224469630|gb|ACN47460.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|312914332|dbj|BAJ38306.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087750|emb|CBY97514.1| octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321225271|gb|EFX50330.1| Octaprenyl-diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322615309|gb|EFY12230.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618332|gb|EFY15223.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622863|gb|EFY19707.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626815|gb|EFY23612.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631384|gb|EFY28144.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635349|gb|EFY32063.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643348|gb|EFY39912.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647080|gb|EFY43581.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648883|gb|EFY45328.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655075|gb|EFY51386.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657678|gb|EFY53946.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664174|gb|EFY60372.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667457|gb|EFY63619.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674705|gb|EFY70797.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675662|gb|EFY71735.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682298|gb|EFY78321.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|323131665|gb|ADX19095.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195894|gb|EFZ81065.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199011|gb|EFZ84108.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204289|gb|EFZ89298.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207636|gb|EFZ92583.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323214747|gb|EFZ99496.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221227|gb|EGA05653.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323233295|gb|EGA17389.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239332|gb|EGA23382.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242417|gb|EGA26443.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323255257|gb|EGA39034.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262720|gb|EGA46276.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264030|gb|EGA47538.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269416|gb|EGA52871.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625055|gb|EGE31400.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629328|gb|EGE35671.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 370

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+
Sbjct: 50  LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQ 109

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 110 GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 169

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 170 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 229

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 230 GILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEGKPTLPLLH 289

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 290 AMRHGTPEQSAMIRTAIEQGN-GRHLLEPVLEAMTTCGSLEWTRQRAEEEADKAISALQI 348

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 349 LPDTPWREALIGLAHIAVQR 368


>gi|322513608|ref|ZP_08066706.1| octaprenyl-diphosphate synthase [Actinobacillus ureae ATCC 25976]
 gi|322120568|gb|EFX92468.1| octaprenyl-diphosphate synthase [Actinobacillus ureae ATCC 25976]
          Length = 331

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 201/324 (62%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 7   LEKIQALAKQDMQAVDAEILAQLNSEVVLINQLGHYIIAGGGKRIRPLIAVLAANALGYR 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 67  GDKHVTCAAFIEFVHTATLLHDDVVDESDMRRGRATANATFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S E L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTSVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AGV+ SV  ALK YG  LG AFQL+DD+LDY  +    GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGVEKSVETALKDYGCYLGTAFQLIDDILDYSAKAESFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AFQ----RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A      +G + + +  +S I +G    E +     IM E+++L     RA    QKA D
Sbjct: 247 AMHAAQAKGNQAQVDMIRSAIENGG-EREQIPAVLEIMAEHQSLDYAMARAKQEAQKAVD 305

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L  LP+S +K++L+ +      R
Sbjct: 306 ALAVLPESEYKQALISLAYLSADR 329


>gi|187476774|ref|YP_784798.1| octaprenyl-diphosphate synthase [Bordetella avium 197N]
 gi|115421360|emb|CAJ47865.1| octaprenyl-diphosphate synthase [Bordetella avium 197N]
          Length = 321

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 195/310 (62%), Gaps = 3/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I +R+ S+V +I  +  Y+I +GGKR+RP + L  A  L Y G +H LLA  
Sbjct: 13  DMKAVDAVIRERLNSEVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYEGTHHQLLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S   +
Sbjct: 73  VEFIHTATLLHDDVVDESDLRRGRETANAVFGNAASVLVGDYLYSRSFEMMVEANSMRIM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QL    + +V++E YL V++ KTA LF AA +V +++AG     
Sbjct: 133 QILSEATTVIAEGEVLQLLNVHDPEVSQERYLQVVRYKTAKLFEAAAQVGAVLAGATPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             A  +YG ++G AFQL+DDVLDY G+   +GKN+G+D R GKPTLP+I   + G+  ++
Sbjct: 193 EAAAAAYGRHIGTAFQLIDDVLDYSGDALALGKNVGDDLREGKPTLPLIRVMEVGSPEQQ 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G+     +  A   +R+  AL      A    QKA+D+L C P S ++KSL
Sbjct: 253 ALIRQAIETGQADFAAVAAA---IRDTDALAHARRAAEVEAQKARDALSCYPASIFQKSL 309

Query: 311 MEVVDFCLQR 320
           +E   F ++R
Sbjct: 310 LEFCAFAVER 319


>gi|197104247|ref|YP_002129624.1| polyprenyl synthetase family protein [Phenylobacterium zucineum
           HLK1]
 gi|196477667|gb|ACG77195.1| polyprenyl synthetase family protein [Phenylobacterium zucineum
           HLK1]
          Length = 335

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 205/314 (65%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  V+ LI + + S V +IP +  +LI    KRLRP+LT+A A +   R D+ + 
Sbjct: 20  LAGPDMAAVDALIREHMDSPVPVIPALADHLIAGSAKRLRPLLTIAAARLAGARDDSCLK 79

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA A+EFIHTATLLHDDVVD S LRRG+VAA L+WG  +SVLVGDFL ++AF +++   S
Sbjct: 80  LAAAVEFIHTATLLHDDVVDSSQLRRGRVAAHLIWGAPSSVLVGDFLFARAFELMVGAGS 139

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
             ALE L+  +  ++EGE+ QL+ S +LD+T+E Y+ +I +KTA LF+AA E  ++ AG 
Sbjct: 140 MAALEILARASRVISEGEVLQLTRSHDLDLTQEVYIEIIGAKTAELFAAAAEAGAVAAGA 199

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                +AL+ +G +LG+AFQLVDD LDY G+   +GKN G+DFR GK TLP++ A  R  
Sbjct: 200 SPERCRALRRFGQDLGLAFQLVDDALDYSGDAKTLGKNAGDDFREGKVTLPLLYAMARTG 259

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E++FW+ T++  + +  +  +A  +M + RAL DT   A  Y   AK +L   P +SW
Sbjct: 260 AAERDFWQRTVDRREQTEADFDRARELMGQTRALDDTLALAARYADSAKAALADFPSNSW 319

Query: 307 KKSLMEVVDFCLQR 320
           + +L ++ DF + R
Sbjct: 320 RPALEDLADFSVAR 333


>gi|187730997|ref|YP_001881898.1| octaprenyl diphosphate synthase [Shigella boydii CDC 3083-94]
 gi|187427989|gb|ACD07263.1| octaprenyl-diphosphate synthase [Shigella boydii CDC 3083-94]
          Length = 323

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|323495811|ref|ZP_08100879.1| octaprenyl-diphosphate synthase [Vibrio sinaloensis DSM 21326]
 gi|323319027|gb|EGA71970.1| octaprenyl-diphosphate synthase [Vibrio sinaloensis DSM 21326]
          Length = 323

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 198/319 (62%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKR+RPML + +A  L Y+G
Sbjct: 4   KAIQALTADDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRIRPMLAVLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H   A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NAHTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V +AL++YG  LG AFQL+DDV+DY  + ++MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPEDVERALQNYGKYLGTAFQLIDDVMDYTSDGDDMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G++++ +  +  I      ++ LK+    M E  +L  T  +AY    KA   L  L
Sbjct: 244 MQNGSEQQASMIREAIEKAN-GMDKLKEILAAMDETGSLEYTRQQAYKEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            +S +K++L+ +    + R
Sbjct: 303 EESEYKQALITLAHMSVHR 321


>gi|16131077|ref|NP_417654.1| octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24114476|ref|NP_708986.1| octaprenyl diphosphate synthase [Shigella flexneri 2a str. 301]
 gi|30064525|ref|NP_838696.1| octaprenyl diphosphate synthase [Shigella flexneri 2a str. 2457T]
 gi|74313724|ref|YP_312143.1| octaprenyl diphosphate synthase [Shigella sonnei Ss046]
 gi|82545575|ref|YP_409522.1| octaprenyl diphosphate synthase [Shigella boydii Sb227]
 gi|89109950|ref|AP_003730.1| octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr.
           W3110]
 gi|110807053|ref|YP_690573.1| octaprenyl diphosphate synthase [Shigella flexneri 5 str. 8401]
 gi|157155105|ref|YP_001464663.1| octaprenyl diphosphate synthase [Escherichia coli E24377A]
 gi|170018563|ref|YP_001723517.1| octaprenyl diphosphate synthase [Escherichia coli ATCC 8739]
 gi|170082722|ref|YP_001732042.1| octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170765991|ref|ZP_02900802.1| octaprenyl-diphosphate synthase [Escherichia albertii TW07627]
 gi|188492215|ref|ZP_02999485.1| polyprenyl synthetase [Escherichia coli 53638]
 gi|194434492|ref|ZP_03066752.1| octaprenyl-diphosphate synthase [Shigella dysenteriae 1012]
 gi|194439175|ref|ZP_03071256.1| octaprenyl-diphosphate synthase [Escherichia coli 101-1]
 gi|209920662|ref|YP_002294746.1| octaprenyl diphosphate synthase [Escherichia coli SE11]
 gi|218555757|ref|YP_002388670.1| octaprenyl diphosphate synthase [Escherichia coli IAI1]
 gi|218696892|ref|YP_002404559.1| octaprenyl diphosphate synthase [Escherichia coli 55989]
 gi|218701956|ref|YP_002409585.1| octaprenyl diphosphate synthase [Escherichia coli IAI39]
 gi|218706807|ref|YP_002414326.1| octaprenyl diphosphate synthase [Escherichia coli UMN026]
 gi|238902289|ref|YP_002928085.1| octaprenyl diphosphate synthase [Escherichia coli BW2952]
 gi|253771979|ref|YP_003034810.1| octaprenyl diphosphate synthase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163129|ref|YP_003046237.1| octaprenyl diphosphate synthase [Escherichia coli B str. REL606]
 gi|256018894|ref|ZP_05432759.1| octaprenyl diphosphate synthase [Shigella sp. D9]
 gi|256024238|ref|ZP_05438103.1| octaprenyl diphosphate synthase [Escherichia sp. 4_1_40B]
 gi|260857314|ref|YP_003231205.1| octaprenyl diphosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|260869938|ref|YP_003236340.1| octaprenyl diphosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|291284561|ref|YP_003501379.1| hypothetical protein G2583_3912 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406796|ref|ZP_06650722.1| octaprenyl diphosphate synthase [Escherichia coli FVEC1412]
 gi|298382537|ref|ZP_06992134.1| octaprenyl diphosphate synthase [Escherichia coli FVEC1302]
 gi|300817559|ref|ZP_07097775.1| polyprenyl synthetase [Escherichia coli MS 107-1]
 gi|300823848|ref|ZP_07103972.1| polyprenyl synthetase [Escherichia coli MS 119-7]
 gi|300897953|ref|ZP_07116330.1| polyprenyl synthetase [Escherichia coli MS 198-1]
 gi|300904377|ref|ZP_07122226.1| polyprenyl synthetase [Escherichia coli MS 84-1]
 gi|300918947|ref|ZP_07135503.1| polyprenyl synthetase [Escherichia coli MS 115-1]
 gi|300926070|ref|ZP_07141891.1| polyprenyl synthetase [Escherichia coli MS 182-1]
 gi|300929881|ref|ZP_07145324.1| polyprenyl synthetase [Escherichia coli MS 187-1]
 gi|300938101|ref|ZP_07152876.1| polyprenyl synthetase [Escherichia coli MS 21-1]
 gi|300948840|ref|ZP_07162906.1| polyprenyl synthetase [Escherichia coli MS 116-1]
 gi|300955774|ref|ZP_07168117.1| polyprenyl synthetase [Escherichia coli MS 175-1]
 gi|301022044|ref|ZP_07185986.1| polyprenyl synthetase [Escherichia coli MS 69-1]
 gi|301025932|ref|ZP_07189417.1| polyprenyl synthetase [Escherichia coli MS 196-1]
 gi|301301753|ref|ZP_07207887.1| polyprenyl synthetase [Escherichia coli MS 124-1]
 gi|301326382|ref|ZP_07219744.1| polyprenyl synthetase [Escherichia coli MS 78-1]
 gi|307139873|ref|ZP_07499229.1| octaprenyl diphosphate synthase [Escherichia coli H736]
 gi|307313108|ref|ZP_07592734.1| Trans-hexaprenyltranstransferase [Escherichia coli W]
 gi|309793766|ref|ZP_07688192.1| polyprenyl synthetase [Escherichia coli MS 145-7]
 gi|312968475|ref|ZP_07782684.1| polyprenyl synthetase family protein [Escherichia coli 2362-75]
 gi|312972539|ref|ZP_07786713.1| polyprenyl synthetase family protein [Escherichia coli 1827-70]
 gi|331643885|ref|ZP_08345016.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli H736]
 gi|331648987|ref|ZP_08350075.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli M605]
 gi|331654791|ref|ZP_08355791.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli M718]
 gi|331670014|ref|ZP_08370859.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli TA271]
 gi|331679266|ref|ZP_08379938.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli H591]
 gi|332279982|ref|ZP_08392395.1| octaprenyl diphosphate synthase [Shigella sp. D9]
 gi|83286883|sp|P0AD57|ISPB_ECOLI RecName: Full=Octaprenyl-diphosphate synthase; AltName:
           Full=All-trans-octaprenyl-diphosphate synthase; AltName:
           Full=Octaprenyl pyrophosphate synthase; Short=OPP
           synthase
 gi|83286884|sp|P0AD58|ISPB_SHIFL RecName: Full=Octaprenyl-diphosphate synthase; AltName:
           Full=All-trans-octaprenyl-diphosphate synthase; AltName:
           Full=Octaprenyl pyrophosphate synthase; Short=OPP
           synthase
 gi|606125|gb|AAA57988.1| ORF_o323 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789578|gb|AAC76219.1| octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24053659|gb|AAN44693.1| octaprenyl diphosphate synthase [Shigella flexneri 2a str. 301]
 gi|30042784|gb|AAP18507.1| octaprenyl diphosphate synthase [Shigella flexneri 2a str. 2457T]
 gi|73857201|gb|AAZ89908.1| octaprenyl diphosphate synthase [Shigella sonnei Ss046]
 gi|81246986|gb|ABB67694.1| octaprenyl diphosphate synthase [Shigella boydii Sb227]
 gi|85675981|dbj|BAE77231.1| octaprenyl diphosphate synthase [Escherichia coli str. K12 substr.
           W3110]
 gi|110616601|gb|ABF05268.1| octaprenyl diphosphate synthase [Shigella flexneri 5 str. 8401]
 gi|157077135|gb|ABV16843.1| octaprenyl-diphosphate synthase [Escherichia coli E24377A]
 gi|169753491|gb|ACA76190.1| Polyprenyl synthetase [Escherichia coli ATCC 8739]
 gi|169890557|gb|ACB04264.1| octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170125137|gb|EDS94068.1| octaprenyl-diphosphate synthase [Escherichia albertii TW07627]
 gi|188487414|gb|EDU62517.1| polyprenyl synthetase [Escherichia coli 53638]
 gi|194417271|gb|EDX33380.1| octaprenyl-diphosphate synthase [Shigella dysenteriae 1012]
 gi|194421871|gb|EDX37877.1| octaprenyl-diphosphate synthase [Escherichia coli 101-1]
 gi|209758174|gb|ACI77399.1| octaprenyl diphosphate synthase [Escherichia coli]
 gi|209913921|dbj|BAG78995.1| octaprenyl-diphosphate synthase [Escherichia coli SE11]
 gi|218353624|emb|CAU99827.1| octaprenyl diphosphate synthase [Escherichia coli 55989]
 gi|218362525|emb|CAR00149.1| octaprenyl diphosphate synthase [Escherichia coli IAI1]
 gi|218371942|emb|CAR19798.1| octaprenyl diphosphate synthase [Escherichia coli IAI39]
 gi|218433904|emb|CAR14821.1| octaprenyl diphosphate synthase [Escherichia coli UMN026]
 gi|238861931|gb|ACR63929.1| octaprenyl diphosphate synthase [Escherichia coli BW2952]
 gi|242378730|emb|CAQ33520.1| octaprenyl diphosphate synthase [Escherichia coli BL21(DE3)]
 gi|253323023|gb|ACT27625.1| Trans-hexaprenyltranstransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975030|gb|ACT40701.1| octaprenyl diphosphate synthase [Escherichia coli B str. REL606]
 gi|253979186|gb|ACT44856.1| octaprenyl diphosphate synthase [Escherichia coli BL21(DE3)]
 gi|257755963|dbj|BAI27465.1| octaprenyl diphosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|257766294|dbj|BAI37789.1| octaprenyl diphosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|260447786|gb|ACX38208.1| Polyprenyl synthetase [Escherichia coli DH1]
 gi|281180229|dbj|BAI56559.1| octaprenyl-diphosphate synthase [Escherichia coli SE15]
 gi|281602570|gb|ADA75554.1| Octaprenyl-diphosphate synthase [Shigella flexneri 2002017]
 gi|284923209|emb|CBG36303.1| octaprenyl-diphosphate synthase [Escherichia coli 042]
 gi|290764434|gb|ADD58395.1| hypothetical protein G2583_3912 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291426802|gb|EFE99834.1| octaprenyl diphosphate synthase [Escherichia coli FVEC1412]
 gi|298277677|gb|EFI19193.1| octaprenyl diphosphate synthase [Escherichia coli FVEC1302]
 gi|299879904|gb|EFI88115.1| polyprenyl synthetase [Escherichia coli MS 196-1]
 gi|300317358|gb|EFJ67142.1| polyprenyl synthetase [Escherichia coli MS 175-1]
 gi|300358334|gb|EFJ74204.1| polyprenyl synthetase [Escherichia coli MS 198-1]
 gi|300397718|gb|EFJ81256.1| polyprenyl synthetase [Escherichia coli MS 69-1]
 gi|300403684|gb|EFJ87222.1| polyprenyl synthetase [Escherichia coli MS 84-1]
 gi|300413928|gb|EFJ97238.1| polyprenyl synthetase [Escherichia coli MS 115-1]
 gi|300417874|gb|EFK01185.1| polyprenyl synthetase [Escherichia coli MS 182-1]
 gi|300451683|gb|EFK15303.1| polyprenyl synthetase [Escherichia coli MS 116-1]
 gi|300456907|gb|EFK20400.1| polyprenyl synthetase [Escherichia coli MS 21-1]
 gi|300462199|gb|EFK25692.1| polyprenyl synthetase [Escherichia coli MS 187-1]
 gi|300523616|gb|EFK44685.1| polyprenyl synthetase [Escherichia coli MS 119-7]
 gi|300529857|gb|EFK50919.1| polyprenyl synthetase [Escherichia coli MS 107-1]
 gi|300842734|gb|EFK70494.1| polyprenyl synthetase [Escherichia coli MS 124-1]
 gi|300846914|gb|EFK74674.1| polyprenyl synthetase [Escherichia coli MS 78-1]
 gi|306907019|gb|EFN37527.1| Trans-hexaprenyltranstransferase [Escherichia coli W]
 gi|308122723|gb|EFO59985.1| polyprenyl synthetase [Escherichia coli MS 145-7]
 gi|309703613|emb|CBJ02953.1| octaprenyl-diphosphate synthase [Escherichia coli ETEC H10407]
 gi|310334916|gb|EFQ01121.1| polyprenyl synthetase family protein [Escherichia coli 1827-70]
 gi|312286693|gb|EFR14604.1| polyprenyl synthetase family protein [Escherichia coli 2362-75]
 gi|313648570|gb|EFS13012.1| polyprenyl synthetase family protein [Shigella flexneri 2a str.
           2457T]
 gi|315062493|gb|ADT76820.1| octaprenyl diphosphate synthase [Escherichia coli W]
 gi|315137773|dbj|BAJ44932.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|315257114|gb|EFU37082.1| polyprenyl synthetase [Escherichia coli MS 85-1]
 gi|315617270|gb|EFU97879.1| polyprenyl synthetase family protein [Escherichia coli 3431]
 gi|320174552|gb|EFW49688.1| Octaprenyl-diphosphate synthase [Shigella dysenteriae CDC 74-1112]
 gi|320181462|gb|EFW56380.1| Octaprenyl-diphosphate synthase [Shigella boydii ATCC 9905]
 gi|320186674|gb|EFW61398.1| Octaprenyl-diphosphate synthase [Shigella flexneri CDC 796-83]
 gi|320194672|gb|EFW69302.1| Octaprenyl-diphosphate synthase [Escherichia coli WV_060327]
 gi|320202101|gb|EFW76676.1| Octaprenyl-diphosphate synthase [Escherichia coli EC4100B]
 gi|320656246|gb|EFX24158.1| octaprenyl diphosphate synthase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661936|gb|EFX29344.1| octaprenyl diphosphate synthase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|323154401|gb|EFZ40602.1| polyprenyl synthetase family protein [Escherichia coli EPECa14]
 gi|323165148|gb|EFZ50938.1| polyprenyl synthetase family protein [Shigella sonnei 53G]
 gi|323173553|gb|EFZ59182.1| polyprenyl synthetase family protein [Escherichia coli LT-68]
 gi|323178637|gb|EFZ64213.1| polyprenyl synthetase family protein [Escherichia coli 1180]
 gi|323183141|gb|EFZ68539.1| polyprenyl synthetase family protein [Escherichia coli 1357]
 gi|323189192|gb|EFZ74476.1| polyprenyl synthetase family protein [Escherichia coli RN587/1]
 gi|323376919|gb|ADX49187.1| Polyprenyl synthetase [Escherichia coli KO11]
 gi|323936119|gb|EGB32413.1| polyprenyl synthetase [Escherichia coli E1520]
 gi|323941713|gb|EGB37892.1| polyprenyl synthetase [Escherichia coli E482]
 gi|323946959|gb|EGB42975.1| polyprenyl synthetase [Escherichia coli H120]
 gi|323970250|gb|EGB65521.1| polyprenyl synthetase [Escherichia coli TA007]
 gi|323979096|gb|EGB74174.1| polyprenyl synthetase [Escherichia coli TW10509]
 gi|324018330|gb|EGB87549.1| polyprenyl synthetase [Escherichia coli MS 117-3]
 gi|324119552|gb|EGC13434.1| polyprenyl synthetase [Escherichia coli E1167]
 gi|330909241|gb|EGH37755.1| octaprenyl-diphosphate synthase [Escherichia coli AA86]
 gi|331037356|gb|EGI09580.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli H736]
 gi|331042734|gb|EGI14876.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli M605]
 gi|331048173|gb|EGI20250.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli M718]
 gi|331062927|gb|EGI34841.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli TA271]
 gi|331073331|gb|EGI44654.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli H591]
 gi|332086238|gb|EGI91396.1| polyprenyl synthetase family protein [Shigella boydii 5216-82]
 gi|332086522|gb|EGI91669.1| polyprenyl synthetase family protein [Shigella dysenteriae 155-74]
 gi|332090693|gb|EGI95787.1| polyprenyl synthetase family protein [Shigella boydii 3594-74]
 gi|332102334|gb|EGJ05680.1| octaprenyl diphosphate synthase [Shigella sp. D9]
 gi|332345144|gb|AEE58478.1| polyprenyl synthetase [Escherichia coli UMNK88]
 gi|332752346|gb|EGJ82736.1| polyprenyl synthetase family protein [Shigella flexneri 4343-70]
 gi|332752872|gb|EGJ83257.1| polyprenyl synthetase family protein [Shigella flexneri K-671]
 gi|332754473|gb|EGJ84839.1| polyprenyl synthetase family protein [Shigella flexneri 2747-71]
 gi|332765183|gb|EGJ95410.1| octaprenyl-diphosphate synthase [Shigella flexneri 2930-71]
 gi|332998829|gb|EGK18425.1| polyprenyl synthetase family protein [Shigella flexneri VA-6]
 gi|332999266|gb|EGK18852.1| polyprenyl synthetase family protein [Shigella flexneri K-272]
 gi|333000017|gb|EGK19600.1| polyprenyl synthetase family protein [Shigella flexneri K-218]
 gi|333014533|gb|EGK33880.1| polyprenyl synthetase family protein [Shigella flexneri K-304]
 gi|333014990|gb|EGK34334.1| polyprenyl synthetase family protein [Shigella flexneri K-227]
          Length = 323

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|157162671|ref|YP_001459989.1| octaprenyl diphosphate synthase [Escherichia coli HS]
 gi|157068351|gb|ABV07606.1| octaprenyl-diphosphate synthase [Escherichia coli HS]
          Length = 323

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVISEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|237706062|ref|ZP_04536543.1| LOW QUALITY PROTEIN: octaprenyl diphosphate synthase [Escherichia
           sp. 3_2_53FAA]
 gi|226899102|gb|EEH85361.1| LOW QUALITY PROTEIN: octaprenyl diphosphate synthase [Escherichia
           sp. 3_2_53FAA]
          Length = 340

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 20  LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 79

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 80  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 139

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 140 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 199

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 200 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 259

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 260 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 318

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 319 LPDTPWREALVGLAHIAVQR 338


>gi|91212610|ref|YP_542596.1| octaprenyl diphosphate synthase [Escherichia coli UTI89]
 gi|110643427|ref|YP_671157.1| octaprenyl diphosphate synthase [Escherichia coli 536]
 gi|117625480|ref|YP_858803.1| octaprenyl diphosphate synthase [Escherichia coli APEC O1]
 gi|191174477|ref|ZP_03035977.1| octaprenyl-diphosphate synthase [Escherichia coli F11]
 gi|218560257|ref|YP_002393170.1| octaprenyl diphosphate synthase [Escherichia coli S88]
 gi|218691477|ref|YP_002399689.1| octaprenyl diphosphate synthase [Escherichia coli ED1a]
 gi|227887908|ref|ZP_04005713.1| possible trans-hexaprenyltranstransferase [Escherichia coli 83972]
 gi|300980004|ref|ZP_07174826.1| polyprenyl synthetase [Escherichia coli MS 200-1]
 gi|300990877|ref|ZP_07179365.1| polyprenyl synthetase [Escherichia coli MS 45-1]
 gi|301047968|ref|ZP_07195012.1| polyprenyl synthetase [Escherichia coli MS 185-1]
 gi|331659474|ref|ZP_08360416.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli TA206]
 gi|91074184|gb|ABE09065.1| octaprenyl diphosphate synthase [Escherichia coli UTI89]
 gi|110345019|gb|ABG71256.1| octaprenyl-diphosphate synthase [Escherichia coli 536]
 gi|115514604|gb|ABJ02679.1| octaprenyl diphosphate synthase [Escherichia coli APEC O1]
 gi|190905232|gb|EDV64871.1| octaprenyl-diphosphate synthase [Escherichia coli F11]
 gi|218367026|emb|CAR04797.1| octaprenyl diphosphate synthase [Escherichia coli S88]
 gi|218429041|emb|CAR09987.2| octaprenyl diphosphate synthase [Escherichia coli ED1a]
 gi|227835304|gb|EEJ45770.1| possible trans-hexaprenyltranstransferase [Escherichia coli 83972]
 gi|294490790|gb|ADE89546.1| octaprenyl-diphosphate synthase [Escherichia coli IHE3034]
 gi|300300164|gb|EFJ56549.1| polyprenyl synthetase [Escherichia coli MS 185-1]
 gi|300307867|gb|EFJ62387.1| polyprenyl synthetase [Escherichia coli MS 200-1]
 gi|300407044|gb|EFJ90582.1| polyprenyl synthetase [Escherichia coli MS 45-1]
 gi|307555280|gb|ADN48055.1| octaprenyl-diphosphate synthase [Escherichia coli ABU 83972]
 gi|307625214|gb|ADN69518.1| octaprenyl diphosphate synthase [Escherichia coli UM146]
 gi|315288960|gb|EFU48358.1| polyprenyl synthetase [Escherichia coli MS 110-3]
 gi|315294881|gb|EFU54220.1| polyprenyl synthetase [Escherichia coli MS 153-1]
 gi|315297896|gb|EFU57166.1| polyprenyl synthetase [Escherichia coli MS 16-3]
 gi|323951294|gb|EGB47169.1| polyprenyl synthetase [Escherichia coli H252]
 gi|323957666|gb|EGB53380.1| polyprenyl synthetase [Escherichia coli H263]
 gi|324008745|gb|EGB77964.1| polyprenyl synthetase [Escherichia coli MS 57-2]
 gi|324012137|gb|EGB81356.1| polyprenyl synthetase [Escherichia coli MS 60-1]
 gi|331054056|gb|EGI26085.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Escherichia
           coli TA206]
          Length = 323

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALVGLAHIAVQR 321


>gi|254491038|ref|ZP_05104219.1| polyprenyl synthetase superfamily [Methylophaga thiooxidans DMS010]
 gi|224463551|gb|EEF79819.1| polyprenyl synthetase superfamily [Methylophaga thiooxydans DMS010]
          Length = 322

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 198/313 (63%), Gaps = 8/313 (2%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+ LI +R+ SDV +I  +  Y+I SGGKRLRP + + +A    Y GD H+ LA  
Sbjct: 13  DMTAVDNLIQQRLQSDVALINQLGFYIINSGGKRLRPAIAILSAKACGYEGDKHINLATI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTATLLHDDVVD+SA+RRGK  A  +WGN+ SVLVGDFL +++F M++E  S   +
Sbjct: 73  IEFIHTATLLHDDVVDNSAMRRGKETANNLWGNEASVLVGDFLYTRSFEMMVEMDSMRLM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QL    + D TE  YL VI  KTA LF AA ++ ++I+   + +
Sbjct: 133 RILSSTTNIIAEGEVLQLLNCHDADTTEARYLEVIHHKTAKLFEAAGQLGAVISRSADDI 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            QA+  Y M+LG AFQLVDD+LDY      +GKNIG+D   GKPTLP+I A ++GT ++ 
Sbjct: 193 EQAMARYAMHLGSAFQLVDDLLDYSQSSETIGKNIGDDLAEGKPTLPLIHAMRQGTDQQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQK---AKDSLRCLPDSSWK 307
              +  I  G+   + + +   I+ E  A+   +Y A++  Q+   AK +L  LP++ +K
Sbjct: 253 AIIREAIEQGQ--RDRIDEIITIINETGAI---DYTAHAAAQEVAHAKQALATLPETDYK 307

Query: 308 KSLMEVVDFCLQR 320
           ++L+ + DF + R
Sbjct: 308 QALLSLADFSISR 320


>gi|82778501|ref|YP_404850.1| octaprenyl diphosphate synthase [Shigella dysenteriae Sd197]
 gi|309785515|ref|ZP_07680146.1| polyprenyl synthetase family protein [Shigella dysenteriae 1617]
 gi|81242649|gb|ABB63359.1| octaprenyl diphosphate synthase [Shigella dysenteriae Sd197]
 gi|308926635|gb|EFP72111.1| polyprenyl synthetase family protein [Shigella dysenteriae 1617]
          Length = 323

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNIIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|62181813|ref|YP_218230.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|62129446|gb|AAX67149.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|267995503|gb|ACY90388.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|322716302|gb|EFZ07873.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 381

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+
Sbjct: 61  LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQ 120

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 121 GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 180

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 181 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 240

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 241 GILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEGKPTLPLLH 300

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 301 AMRHGTPEQSAMIRTAIEQGN-GRHLLEPVLEAMTTCGSLEWTRQRAEEEADKAISALQI 359

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 360 LPDTPWREALIGLAHIAVQR 379


>gi|33591927|ref|NP_879571.1| octaprenyl-diphosphate synthase [Bordetella pertussis Tohama I]
 gi|33571571|emb|CAE41057.1| octaprenyl-diphosphate synthase [Bordetella pertussis Tohama I]
 gi|332381344|gb|AEE66191.1| octaprenyl-diphosphate synthase [Bordetella pertussis CS]
          Length = 321

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 193/310 (62%), Gaps = 3/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I  R+ SDV +I  +  Y+I +GGKR+RP + L  A  L Y+G +H LLA  
Sbjct: 13  DMKAVDTVIRDRLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYQGTHHQLLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S   +
Sbjct: 73  VEFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDYLYSRSFEMMVEADSMRIM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QL    + DV++E YL V++ KTA LF AA +V +++AG     
Sbjct: 133 QILSQATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKLFEAAAQVGAVLAGASPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             A  +YG ++G AFQLVDDVLDY G+ + +GKN+G+D R GKPTLP+I   + GT  ++
Sbjct: 193 ETAAAAYGRHVGTAFQLVDDVLDYSGDAHALGKNVGDDLREGKPTLPLIRVMETGTPEQR 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G+     + +A   ++   AL      A +  + A+ +L   P S ++KSL
Sbjct: 253 ELIREAIKTGQADFAAVAQA---IQATDALAHARQAAENEAELARQALSAFPVSLYQKSL 309

Query: 311 MEVVDFCLQR 320
           +E   F + R
Sbjct: 310 LEFCAFAVNR 319


>gi|331004838|ref|ZP_08328256.1| Octaprenyl-diphosphate synthase [gamma proteobacterium IMCC1989]
 gi|330421369|gb|EGG95617.1| Octaprenyl-diphosphate synthase [gamma proteobacterium IMCC1989]
          Length = 321

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 204/313 (65%), Gaps = 2/313 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D E VN LIL +I SDV ++ D+ +YLI +GGKRLRP+L L  +  L+Y+GD H  LA 
Sbjct: 11  RDFEAVNQLILGQIHSDVGLVEDIGQYLIEAGGKRLRPLLVLLVSNALQYQGDKHHDLAA 70

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEFIH+ATLLHDDVVD S LRRG++ A   WGN  SVLVGDFL S+AF M++       
Sbjct: 71  IIEFIHSATLLHDDVVDMSDLRRGRLTANAKWGNAPSVLVGDFLYSRAFQMMVAVGDMSI 130

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ LS     ++EGE++QL  +K  D++E+ Y  VI  KTA+LF AA E ++ ++G + +
Sbjct: 131 MKILSDTTNLISEGEVQQLINAKKPDISEKGYFEVIHKKTAILFEAACETAATLSGAEET 190

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           +R+ L +YG ++GIAFQL+DD LDY G   E+GKN+G+D   GKPTLP+I A    ++ +
Sbjct: 191 LRRQLTAYGYHVGIAFQLIDDALDYTGNTEELGKNVGDDLAEGKPTLPLIYAMSNSSEEQ 250

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
                 +I +G  S   L +   I+R++ AL  T   A  +   A  +L  LPDS++K++
Sbjct: 251 SAMIADSIRNGDKS--QLSQIINIIRDSGALDYTLNLAKEHAMSAIKTLDALPDSTYKQA 308

Query: 310 LMEVVDFCLQRLN 322
           ++++ +F + R N
Sbjct: 309 MIDLAEFSISRSN 321


>gi|240950200|ref|ZP_04754487.1| octaprenyl-diphosphate synthase [Actinobacillus minor NM305]
 gi|240295287|gb|EER46073.1| octaprenyl-diphosphate synthase [Actinobacillus minor NM305]
          Length = 327

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 201/320 (62%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ VN  IL ++ S+V +I  +  Y+I  GGKR+RP++T+  A  L Y+
Sbjct: 7   LEQIQALAAEDMQAVNAEILAQLNSEVPLINQLGFYIISGGGKRIRPLITVLAARALGYQ 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G   +  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGD++ +++F M
Sbjct: 67  GAKQITTAAFIEFVHTATLLHDDVVDESDMRRGRETANAAFGNAASVLVGDYIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S E L+ +S     LAEGE++QL    + + TEE+Y+ VI +KTA LF AA +  
Sbjct: 127 MTSVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEENYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A     +  ALK+YG  LG AFQLVDD+LDY      +GKN+G+DF  GKPT+P++ 
Sbjct: 187 AIVANASKEIEIALKNYGCYLGTAFQLVDDILDYSANAQALGKNVGDDFVEGKPTMPLLH 246

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G + + N  +  I  G    EN+ +   IM E+++L  T  +A +  QKA D+L  
Sbjct: 247 AMRHGNEAQANMIRQAIEQGG-DRENIDEVLAIMAEHKSLDYTMSKAKAEAQKAVDALAI 305

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 306 LPESEYKQALISLAYLSVDR 325


>gi|213622139|ref|ZP_03374922.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 317

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 194/315 (61%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+G+ HV
Sbjct: 2   ELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQGNAHV 61

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+    
Sbjct: 62  TIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLG 121

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S ++AG
Sbjct: 122 SLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSGILAG 181

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                 + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ A + G
Sbjct: 182 CTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEGKPTLPLLHAMRHG 241

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ LPD+ 
Sbjct: 242 TPEQSAMIRTAIEQGN-GRHLLEPVLEAMTTCGSLEWTRQRAEEEADKAISALQILPDTP 300

Query: 306 WKKSLMEVVDFCLQR 320
           W+++L+ +    +QR
Sbjct: 301 WREALIGLAHIAVQR 315


>gi|92112606|ref|YP_572534.1| trans-hexaprenyltranstransferase [Chromohalobacter salexigens DSM
           3043]
 gi|91795696|gb|ABE57835.1| Trans-hexaprenyltranstransferase [Chromohalobacter salexigens DSM
           3043]
          Length = 337

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 186/302 (61%), Gaps = 2/302 (0%)

Query: 19  ILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTAT 78
           IL ++ S V ++  + +Y+I SGGKRLRP+L L  A  L Y GD HV LA  IEF+HT+T
Sbjct: 36  ILAQLASRVPLVETIGRYIIESGGKRLRPLLVLLAARSLNYPGDRHVTLATLIEFMHTST 95

Query: 79  LLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVAC 138
           LLHDDVVD+S LRRGK  A   WGN  SVLVGDFL S++F M++E  S   +E LS   C
Sbjct: 96  LLHDDVVDESHLRRGKATANDAWGNAPSVLVGDFLYSRSFQMMVEVGSMRVMEILSGATC 155

Query: 139 TLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYG 198
            +AEGE+ QL+   N D+ E  Y   I+ KTA+LF AA    +++A    +  +ALK YG
Sbjct: 156 VIAEGEVLQLTNIGNPDIDEAAYFDTIQGKTAMLFEAASHSGAVLAEATPAQEEALKLYG 215

Query: 199 MNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTIN 258
             LG+AFQLVDD+LDY+G+ + MGKN+G+D   GKPTLP+I A   G   + +  +  I 
Sbjct: 216 RYLGLAFQLVDDLLDYQGDADAMGKNVGDDLAEGKPTLPLIHAMANGNAEQVSVVRQAIR 275

Query: 259 DGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCL 318
            G +  ++L +   I+ +  AL  T  RA     +A   L  LP+S ++ S+  +    +
Sbjct: 276 QGGL--DHLDEVLAIVHDTGALDYTRRRAEEMADRALAQLELLPESRYRDSMAALAHLAV 333

Query: 319 QR 320
           +R
Sbjct: 334 ER 335


>gi|306816471|ref|ZP_07450603.1| octaprenyl diphosphate synthase [Escherichia coli NC101]
 gi|222034904|emb|CAP77647.1| Octaprenyl-diphosphate synthase [Escherichia coli LF82]
 gi|305850036|gb|EFM50495.1| octaprenyl diphosphate synthase [Escherichia coli NC101]
 gi|312947744|gb|ADR28571.1| octaprenyl diphosphate synthase [Escherichia coli O83:H1 str. NRG
           857C]
          Length = 323

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNVHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALVGLAHIAVQR 321


>gi|33599305|ref|NP_886865.1| octaprenyl-diphosphate synthase [Bordetella bronchiseptica RB50]
 gi|33575351|emb|CAE30814.1| octaprenyl-diphosphate synthase [Bordetella bronchiseptica RB50]
          Length = 321

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 193/310 (62%), Gaps = 3/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I  R+ SDV +I  +  Y+I +GGKR+RP + L  A  L Y+G +H LLA  
Sbjct: 13  DMKAVDAVIRDRLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYQGTHHQLLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S   +
Sbjct: 73  VEFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDYLYSRSFEMMVEADSMRIM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QL    + DV++E YL V++ KTA LF AA +V +++AG     
Sbjct: 133 QILSQATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKLFEAAAQVGAVLAGASPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             A  +YG ++G AFQLVDDVLDY G+ + +GKN+G+D R GKPTLP+I   + GT  ++
Sbjct: 193 ETAAAAYGRHVGAAFQLVDDVLDYSGDAHALGKNVGDDLREGKPTLPLIRVMETGTPEQR 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G+     + +A   ++   AL      A +  + A+ +L   P S ++KSL
Sbjct: 253 ELIREAIKTGQADFAAVAQA---IQATDALAHARQAAENEAELARQALSAFPVSLYQKSL 309

Query: 311 MEVVDFCLQR 320
           +E   F + R
Sbjct: 310 LEFCAFAVNR 319


>gi|303250376|ref|ZP_07336575.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253685|ref|ZP_07535552.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650846|gb|EFL81003.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306858921|gb|EFM90967.1| Octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 331

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 203/324 (62%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 7   LEQIQTLAKQDMQAVDAEILAQLNSEVVLINQLGNYIIAGGGKRIRPLIAVLAANALGYR 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 67  GNKHVTCAAFIEFVHTATLLHDDVVDESDMRRGRATANATFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S E L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTDVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AGV+ SV  ALK YG  LG AFQL+DD+LDY  +    GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGVEKSVETALKDYGCYLGTAFQLIDDILDYSAKAENFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AF----QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A     ++G + + +  +S I +G    E +     IM E+++L     RA    QKA D
Sbjct: 247 AMHTAQEKGNQAQVDMIRSAIENGG-EREQIPAVLEIMAEHQSLEYAMTRAKQEAQKAVD 305

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L  LP+S + ++L+ +    + R
Sbjct: 306 ALAVLPESEYTQALISLAYLSVDR 329


>gi|165977439|ref|YP_001653032.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165877540|gb|ABY70588.1| octaprenyl-diphosphate synthase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 331

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 203/324 (62%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 7   LEQIQTLAKQDMQAVDAEILAQLNSEVVLINQLGNYIIAGGGKRIRPLIAVLAANALGYR 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 67  GNKHVTCAAFIEFVHTATLLHDDVVDESDMRRGRATANATFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S E L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTDVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AGV+ SV  ALK YG  LG AFQL+DD+LDY  +    GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGVEKSVETALKDYGCYLGTAFQLIDDILDYSAKAESFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AF----QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A     ++G + + +  +S I +G    E +     IM E+++L     RA    QKA D
Sbjct: 247 AMHTAQEKGNQAQVDIIRSAIENGG-EREQIPAVLEIMAEHQSLEYAMTRAKQEAQKAVD 305

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           +L  LP+S + ++L+ +    + R
Sbjct: 306 ALAVLPESEYTQALISLAYLSVDR 329


>gi|33595027|ref|NP_882670.1| octaprenyl-diphosphate synthase [Bordetella parapertussis 12822]
 gi|33565103|emb|CAE40054.1| octaprenyl-diphosphate synthase [Bordetella parapertussis]
          Length = 321

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 192/310 (61%), Gaps = 3/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I  R+ SDV +I  +  Y+I +GGKR+RP + L  A  L Y+G +H LLA  
Sbjct: 13  DMKAVDAVIRDRLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYQGTHHQLLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S   +
Sbjct: 73  VEFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDYLYSRSFEMMVEADSMRIM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QL    + DV++E YL V++ KTA LF AA +V +++AG     
Sbjct: 133 QILSQATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKLFEAAAQVGAVLAGASPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             A  +YG  +G AFQLVDDVLDY G+ + +GKN+G+D R GKPTLP+I   + GT  ++
Sbjct: 193 ETAAAAYGRRVGTAFQLVDDVLDYSGDAHALGKNVGDDLREGKPTLPLIRVMETGTPEQR 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G+     + +A   ++   AL      A +  + A+ +L   P S ++KSL
Sbjct: 253 ELIREAIKTGQADFAAVAQA---IQATDALAHARQAAENEAELARQALSAFPVSLYQKSL 309

Query: 311 MEVVDFCLQR 320
           +E   F + R
Sbjct: 310 LEFCAFAVNR 319


>gi|257465194|ref|ZP_05629565.1| octaprenyl-diphosphate synthase [Actinobacillus minor 202]
 gi|257450854|gb|EEV24897.1| octaprenyl-diphosphate synthase [Actinobacillus minor 202]
          Length = 327

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 130/320 (40%), Positives = 202/320 (63%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ VN  IL ++ S+V +I  +  Y+I  GGKR+RP++T+  A  L Y+
Sbjct: 7   LEQIQALAAEDMQAVNAEILAQLNSEVPLINQLGFYIISGGGKRIRPLITVLAARALGYQ 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G   +  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGD++ +++F M
Sbjct: 67  GAKQITTAAFIEFVHTATLLHDDVVDESDMRRGRETANAAFGNAASVLVGDYIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S E L+ +S     LAEGE++QL    + + TEE+Y+ VI +KTA LF AA +  
Sbjct: 127 MTSVDSLEVLKVMSAATNALAEGEVQQLMNVNDPNTTEENYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A     +  ALK+YG  LG AFQLVDD+LDY      +GKN+G+DF  GKPT+P++ 
Sbjct: 187 AIVANASKEIEIALKNYGCYLGTAFQLVDDILDYSANAQALGKNVGDDFVEGKPTMPLLH 246

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G + + N  +  I  G  + EN+ +   IM E+++L  T  +A +  QKA D++  
Sbjct: 247 AMRHGNEAQANMIRQAIEQGG-NRENIDEVLAIMAEHKSLDYTMEKAKAEAQKAVDAIAI 305

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 306 LPESEYKQALISLAYLSVDR 325


>gi|312883913|ref|ZP_07743630.1| octaprenyl-diphosphate synthase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368371|gb|EFP95906.1| octaprenyl-diphosphate synthase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 323

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/317 (41%), Positives = 197/317 (62%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKR+RP+L + +A  L Y+G  
Sbjct: 6   IQALTADDMAKVNETIHAQLNSDVTLINQLGFYIVSGGGKRVRPLLAIISAKALGYKGQG 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H L A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+ E
Sbjct: 66  HTLSAAFIEFIHTATLLHDDVVDESDMRRGKATANSAFGNAASVLVGDYIYTRSFQMMTE 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S + L+ +S     +AEGE++QL    + +V+EE Y+ VI SKTA LF  A +V +++
Sbjct: 126 LGSMKILKLMSDAVNVIAEGEVQQLMNCNDPNVSEESYMQVIYSKTARLFEVATQVGAVL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           +   + +  ALK+YG  LG AFQL+DDV+DY     EMGKN+G+D   GKPTLP+I A Q
Sbjct: 186 SEAPSEIEIALKNYGRYLGTAFQLIDDVMDYTSTGKEMGKNVGDDLAEGKPTLPLIHAMQ 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
             +  +    K  I +    +++L++   IM++  +L     +AY    KA   L C+P+
Sbjct: 246 TSSPEQSQLIKQAIENAN-GMDHLQEILDIMKQTGSLDYARQKAYQEADKAISELNCIPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 305 SDYKQALITLAHMSVNR 321


>gi|311277840|ref|YP_003940071.1| Polyprenyl synthetase [Enterobacter cloacae SCF1]
 gi|308747035|gb|ADO46787.1| Polyprenyl synthetase [Enterobacter cloacae SCF1]
          Length = 323

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKILEVMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            L+AG  ++  + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GLLAGCSDAQEKGLQDYGRYLGTAFQLIDDLLDYSSDGETLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G+  +    +  I +G      L+     M +  +L  T  RA     KA  +L  
Sbjct: 243 AMRHGSAAQSAMIRQAIEEGN-GRHLLEPVLEAMADCGSLEWTRQRAEEEADKAIAALSV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALISLAHIAVQR 321


>gi|269137746|ref|YP_003294446.1| octaprenyl diphosphate synthase [Edwardsiella tarda EIB202]
 gi|267983406|gb|ACY83235.1| octaprenyl diphosphate synthase [Edwardsiella tarda EIB202]
 gi|304557803|gb|ADM40467.1| Octaprenyl-diphosphate synthase [Edwardsiella tarda FL6-60]
          Length = 323

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEQITELTAQDMADVNARILHQLNSDVALINQLGYYIISGGGKRIRPMIAVLAARALGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDRHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE++QL    + D++EE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENYMQVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG   +  QAL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAGADTAQEQALQDYGRYLGTAFQLIDDLLDYDADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G+       +  I  G      L+     M++  +L  T  RA     KA  +L  
Sbjct: 243 AMHHGSAERSAMIRQAIEQGN-GRHLLEPVLETMQQAGSLDYTRSRAEEEADKAIAALAP 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPDS  K++L+ + +  + R
Sbjct: 302 LPDSPHKQALIGLANLAVNR 321


>gi|161506132|ref|YP_001573244.1| hypothetical protein SARI_04320 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867479|gb|ABX24102.1| hypothetical protein SARI_04320 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 498

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+
Sbjct: 178 LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQ 237

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 238 GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 297

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 298 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 357

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 358 GILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGKHLGKNVGDDLNEGKPTLPLLH 417

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L      M    +L  T  RA     KA  +L+ 
Sbjct: 418 AMRHGTPEQSTMIRTAIEQGN-GRHLLDPVLEAMTTCGSLEWTRQRAEEEADKAISALQI 476

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 477 LPDTPWREALIGLAHIAVQR 496


>gi|153874225|ref|ZP_02002523.1| Polyprenyl synthetase [Beggiatoa sp. PS]
 gi|152069311|gb|EDN67477.1| Polyprenyl synthetase [Beggiatoa sp. PS]
          Length = 337

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 142/323 (43%), Positives = 197/323 (60%), Gaps = 12/323 (3%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  VN LI KR+ S+V ++  +  Y++ SGGKRLRPML L +A    Y+G +H+ LA 
Sbjct: 13  QDMRAVNVLIQKRLYSEVALVNQIGDYIVNSGGKRLRPMLLLLSARAFAYQGTHHIDLAA 72

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD S LRRG+  A  +WGN+ SVLVGDFL S+AF M+++  +   
Sbjct: 73  IVEFIHTATLLHDDVVDASLLRRGQETANNIWGNEASVLVGDFLYSRAFQMMVDINNMRV 132

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ LS     +AEGE+ QL      D TE DYL VI +KTA LF AA ++ ++I+   + 
Sbjct: 133 MKILSEATNVMAEGEVLQLLNCYEPDTTEMDYLRVICAKTAKLFEAAAQLGAVISEQPSE 192

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +A+  YGM+LGIAFQL+DD LDY   +  +GKNIG+D   GKPTLP+I A +  T  +
Sbjct: 193 YEKAMAMYGMHLGIAFQLIDDALDYNATMENLGKNIGDDLTEGKPTLPLIYALKHATPSQ 252

Query: 250 KNFWKSTIN-DG----------KISVENL-KKAFIIMRENRALVDTEYRAYSYGQKAKDS 297
           +   +  I+ DG          K SV+ L KK  +I+    A+  T   A     KA  +
Sbjct: 253 QKILREGISQDGQLHDAIKQNDKTSVDELIKKVIVIVESTGAIRYTMQVAQKEADKAIIA 312

Query: 298 LRCLPDSSWKKSLMEVVDFCLQR 320
           L  LP S + ++L  + DF + R
Sbjct: 313 LTELPQSPYTEALRSLADFSVNR 335


>gi|193070326|ref|ZP_03051269.1| octaprenyl-diphosphate synthase [Escherichia coli E110019]
 gi|192956385|gb|EDV86845.1| octaprenyl-diphosphate synthase [Escherichia coli E110019]
          Length = 323

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++ G      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILVGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|301644900|ref|ZP_07244870.1| polyprenyl synthetase [Escherichia coli MS 146-1]
 gi|301076794|gb|EFK91600.1| polyprenyl synthetase [Escherichia coli MS 146-1]
          Length = 320

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 195/319 (61%), Gaps = 1/319 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQ 319
           LPD+ W+++L+ +    +Q
Sbjct: 302 LPDTPWREALIGLAHIAVQ 320


>gi|157374092|ref|YP_001472692.1| trans-hexaprenyltranstransferase [Shewanella sediminis HAW-EB3]
 gi|157316466|gb|ABV35564.1| trans-hexaprenyltranstransferase [Shewanella sediminis HAW-EB3]
          Length = 323

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 137/322 (42%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  +  L   DM+ VN LI K++ SDV +I  +  Y+I  GGKR+RP+L++  A  ++Y+
Sbjct: 3   LNAIRQLADNDMQNVNKLIYKQLESDVALINQLGFYIINGGGKRMRPLLSILAARAIDYK 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ H+ LA  IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 63  GEAHLKLAAIIEFIHTASLLHDDVVDESMLRRGRETANALFGNSASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E  + E LE L+     LAEGE+ QL    + D TEE Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELGNMEVLEVLADATNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATRLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A      + AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I 
Sbjct: 183 GVLAQSPIEAQNALADYGKFLGTAFQLTDDLLDYTADTEELGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT++E+   ++ I  G    +N+++    +    AL  T  RA     KA ++L  
Sbjct: 243 AMAHGTEKEQELIRTAIEKGD-GTQNIEEILNALHSCGALDYTFRRALEESDKAIEALSI 301

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           +P+S +K++L+ +    ++R N
Sbjct: 302 IPESDYKQALISLAKIAVERSN 323


>gi|330831008|ref|YP_004393960.1| trans-hexaprenyltranstransferase [Aeromonas veronii B565]
 gi|328806144|gb|AEB51343.1| Trans-hexaprenyltranstransferase [Aeromonas veronii B565]
          Length = 323

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 194/314 (61%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LIL R+ SDV +I  +  Y++ +GGKR+RPMLT+  A  L Y G++H+ 
Sbjct: 9   LCAADMTAVNELILARLQSDVSLINQLGFYIVSAGGKRMRPMLTVMAARALGYEGEDHLK 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IEFIHT+TLLHDDVVD+S LRRG+  A  ++GN  SVLVGD+L S++F M+ E  +
Sbjct: 69  LAAIIEFIHTSTLLHDDVVDESDLRRGRETANAMFGNAASVLVGDYLYSRSFQMMAELSN 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E LS    T+AEGE+ QL    + D TEE Y+ VI  KTA LF AA  +++++   
Sbjct: 129 LRVMEILSDATNTIAEGEVLQLMNCNDPDTTEESYMTVIYCKTAKLFEAATRLAAVLTHQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              V QA+  YG  LG AFQ++DDV+DY  +  EMGKN+G+D   GKPTLP++ A + GT
Sbjct: 189 PEPVEQAMTDYGKYLGTAFQIIDDVMDYCSQSEEMGKNVGDDLAEGKPTLPLLRAMEVGT 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+   +  I + +  +E+L++   I+    AL  +  RA     KA  +L  LPDS  
Sbjct: 249 PEERQLVRDAI-EHRNGMEHLEQILGILDRTGALEYSRMRAREEADKAIAALAILPDSPH 307

Query: 307 KKSLMEVVDFCLQR 320
           K +L  +    +QR
Sbjct: 308 KHALETLAHMAVQR 321


>gi|84394037|ref|ZP_00992774.1| octaprenyl-diphosphate synthase [Vibrio splendidus 12B01]
 gi|84375323|gb|EAP92233.1| octaprenyl-diphosphate synthase [Vibrio splendidus 12B01]
          Length = 323

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 195/319 (61%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L L +A  L Y+G
Sbjct: 4   KAIQTLTANDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLALLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H+  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  EAHITSAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S + LE +S     +AEGE++QL    N D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TTLGSLKILELMSEAVNVIAEGEVQQLMNCNNPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           +++     +  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILSESSPEIETAMQNYGKYLGTAFQLIDDVMDYTADGKEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G+  + +  +  I      +E L     +M+E  +L  T  +AY    KA   L  L
Sbjct: 244 MHNGSPEQTSMIREAIEKAN-GMERLDDIMAVMKETGSLEYTTNKAYEEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           PDS +K++L  +    ++R
Sbjct: 303 PDSEYKQALTTLAHLAVKR 321


>gi|114319994|ref|YP_741677.1| trans-hexaprenyltranstransferase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226388|gb|ABI56187.1| Trans-hexaprenyltranstransferase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 322

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 200/318 (62%), Gaps = 4/318 (1%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + +L   DM  VN LI +R+ S+V +I  +  Y++ SGGKRLRP+L L  A    YRG++
Sbjct: 6   IRNLAADDMAAVNRLIQERLSSEVVLIDQMGHYIVNSGGKRLRPLLVLLAARAAGYRGEH 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA  +EFIHTATLLHDDVVD+S LRRG+  A  +WGN+ +VLVGDFL ++AF M++E
Sbjct: 66  HIKLAAVVEFIHTATLLHDDVVDESTLRRGQDTANSIWGNEAAVLVGDFLYTRAFEMMVE 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
                 ++ ++    T+AEGE+ QL    + DV+E  Y  VI  KTA LF AA  +   I
Sbjct: 126 VGLLPIMQVMARTTNTIAEGEVMQLLNCHDPDVSEARYRDVIYRKTASLFEAACCLGGTI 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG+  +    L +YG++LG A+QLVDD LDY G+  E+GKNIG+D   GKPT+P+I A  
Sbjct: 186 AGLPQAQTDHLAAYGLHLGTAYQLVDDALDYAGKAEEIGKNIGDDLAEGKPTMPLIYAMA 245

Query: 244 RGTKREKNFWKSTINDGKIS-VENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
           RG+  E+   +  I++G IS +  +++A   +    A+  T+  A    ++A + L  LP
Sbjct: 246 RGSAEERQVIREAISEGGISRIAAVQQA---IENTGAIPYTQRLARDEAEEAVNRLAHLP 302

Query: 303 DSSWKKSLMEVVDFCLQR 320
           DS WK++L  +  F + R
Sbjct: 303 DSEWKQALEALARFSVAR 320


>gi|74316881|ref|YP_314621.1| trans-hexaprenyltranstransferase [Thiobacillus denitrificans ATCC
           25259]
 gi|74056376|gb|AAZ96816.1| trans-hexaprenyltranstransferase [Thiobacillus denitrificans ATCC
           25259]
          Length = 343

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 197/320 (61%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L+     DM  V+ +I +R+ SDV +I  V +Y+I SGGKRLRP L L +A    YR
Sbjct: 24  LESLQSFLADDMRAVDHVIRERLYSDVVLIRQVSEYIINSGGKRLRPALVLLSAGCFGYR 83

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H  LA  +EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL S+AF M
Sbjct: 84  GQAHHELAAVVEFIHTATLLHDDVVDESELRRGRETANALFGNAASVLVGDFLYSRAFQM 143

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + E +  LS    T+AEGE+ QL    + D+ EE+YL VI+ KTA LF AA  + 
Sbjct: 144 MVGVDNMEVMRILSDATNTIAEGEVLQLLNCHDPDIDEENYLRVIRYKTAKLFEAAGRLG 203

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I G   + + AL  YGM+LG AFQL+DDVLDY G+  + GKNIG+D   GKPTLP++ 
Sbjct: 204 AVIGGGSEADKDALARYGMHLGTAFQLIDDVLDYSGDFLKTGKNIGDDLAEGKPTLPLLY 263

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G+  +    +  I  G ++    +     +++  AL  T   A    Q A  ++  
Sbjct: 264 AMKHGSAAQAASIRHAIEHGGLT--EFQSVLAAIKDTNALQYTREVAQREVQTANAAISR 321

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPDS+ K +L+++  F ++R
Sbjct: 322 LPDSNSKTALLQLAAFAVER 341


>gi|317493609|ref|ZP_07952030.1| polyprenyl synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918552|gb|EFV39890.1| polyprenyl synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 323

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ S+V +I  +  Y+I  GGKR+RPM+ + +A  L Y 
Sbjct: 3   LEQITELTAQDMADVNATILQQLNSEVSLINQLGYYIISGGGKRIRPMIAVLSARALNYT 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M
Sbjct: 63  GDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   LE +S     +AEGE+ QL    + ++TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLQSLRVLELMSEATNVIAEGEVLQLMNVNDPNITEENYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG  +    AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAGATHEQEIALQDYGRYLGTAFQLIDDLLDYDADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G+       +  I +G      L+     M E  +L  T  RA     KA  +L  
Sbjct: 243 AMQNGSPERSAMIRKAIEEGN-GRHLLEPVLETMHEVGSLTYTRQRAEEEADKAISALDV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ + +  + R
Sbjct: 302 LPESPYKEALIGLANMAVDR 321


>gi|260775534|ref|ZP_05884431.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608715|gb|EEX34880.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 323

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 192/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKR+RP+L + +A  L Y+G
Sbjct: 4   KAIQALTADDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRIRPLLAVLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
             H   A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  QAHTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNIIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++    + V  AL++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPSEVETALQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q GT  +    +  I      +E L      M +  +L  T  +AY    KA   L  L
Sbjct: 244 MQHGTPEQTQMIREAIEKAN-GMEKLDSIMEAMEQTGSLEYTRQKAYQEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            +S +K++L+ +    + R
Sbjct: 303 SESPYKEALVTLAHMSVHR 321


>gi|88859033|ref|ZP_01133674.1| Octaprenyl-diphosphate synthase (Octaprenyl pyrophosphate
           synthetase)(OPP synthetase) [Pseudoalteromonas tunicata
           D2]
 gi|88819259|gb|EAR29073.1| Octaprenyl-diphosphate synthase (Octaprenyl pyrophosphate
           synthetase)(OPP synthetase) [Pseudoalteromonas tunicata
           D2]
          Length = 323

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 205/322 (63%), Gaps = 5/322 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ LT  DM++VN LI K++ SDV ++  +  Y++ SGGKR+RPML++ +A  L Y 
Sbjct: 3   IKSIQALTDNDMQRVNQLIYKQLQSDVALVNQLGLYIVSSGGKRVRPMLSILSAKALGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ LA  +EFIHTATLLHDDVVD+S LRRG   A   +GN  SVLVGDF+ ++AF +
Sbjct: 63  GDAHITLAAIVEFIHTATLLHDDVVDESDLRRGNATANAEFGNAASVLVGDFIYTRAFQL 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++  +    ++ L+     +AEGE+ QL    + D TE+ Y+ VI SKTA LF AA +++
Sbjct: 123 MVGLEEMRVMKILADATNVIAEGEVLQLMNCNDPDTTEQSYMQVIYSKTAKLFEAATQLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I     +  + LK YGM+LG AFQLVDDVLDY  +  E+GK++G+D   GKPTLP+I 
Sbjct: 183 AVITRKDAATEEQLKLYGMHLGTAFQLVDDVLDYSADQAELGKSLGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTI--NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
           A Q GTK +    +  I   +G+  ++++ KA   + +  AL  T  +A    Q+A   L
Sbjct: 243 AMQHGTKEQVALIRQVIEQGNGRAFLDDVLKA---LADTDALNFTLNKAKEESQRAIACL 299

Query: 299 RCLPDSSWKKSLMEVVDFCLQR 320
             LPDS +K++L+ +    + R
Sbjct: 300 ALLPDSEYKEALIGLARLAVDR 321


>gi|292490245|ref|YP_003525684.1| trans-hexaprenyltranstransferase [Nitrosococcus halophilus Nc4]
 gi|291578840|gb|ADE13297.1| Trans-hexaprenyltranstransferase [Nitrosococcus halophilus Nc4]
          Length = 322

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 199/315 (63%), Gaps = 2/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL   DM+ VN LI KR+ SDV +I  +  Y+I SGGKRLRP++ L +A   +Y+G  H+
Sbjct: 8   DLIADDMQAVNGLIQKRLHSDVVLINQLGHYIINSGGKRLRPVVVLLSARAFDYQGSCHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD S LRRG+  A  +WG++ SVLVGDFL S+AF M+++  
Sbjct: 68  DIATIIEFIHTATLLHDDVVDSSELRRGQKTANSIWGSEASVLVGDFLYSRAFEMMVDVN 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   +E L+    T+AEGE+ QL    + D TEE YL VI+SKTA LF AA ++ ++++ 
Sbjct: 128 SMRVMEILARTTNTIAEGEVMQLLNCHDPDTTEERYLDVIRSKTAKLFEAATQLGAVLSC 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +  +A+ +YGM+LG AFQL DDVLDY    +++GKNIG+D   GKPTLP+I A + G
Sbjct: 188 RPAAEEEAMAAYGMHLGTAFQLTDDVLDYSASSDDLGKNIGDDLAEGKPTLPLIYAMRNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
                   ++ I  G    +NL +    +  + A+  T   A    +KA  +++ +P S 
Sbjct: 248 IPSHAEVIRNAIEGG--GRDNLAEVIEAIESSGAIAYTAKTARREAEKAIQAIKKIPASP 305

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L+ +  F + R
Sbjct: 306 YQEALLNLAKFAVYR 320


>gi|126173210|ref|YP_001049359.1| polyprenyl synthetase [Shewanella baltica OS155]
 gi|152999569|ref|YP_001365250.1| polyprenyl synthetase [Shewanella baltica OS185]
 gi|160874188|ref|YP_001553504.1| polyprenyl synthetase [Shewanella baltica OS195]
 gi|304410433|ref|ZP_07392051.1| Polyprenyl synthetase [Shewanella baltica OS183]
 gi|307304525|ref|ZP_07584275.1| Polyprenyl synthetase [Shewanella baltica BA175]
 gi|125996415|gb|ABN60490.1| Trans-hexaprenyltranstransferase [Shewanella baltica OS155]
 gi|151364187|gb|ABS07187.1| Polyprenyl synthetase [Shewanella baltica OS185]
 gi|160859710|gb|ABX48244.1| Polyprenyl synthetase [Shewanella baltica OS195]
 gi|304350917|gb|EFM15317.1| Polyprenyl synthetase [Shewanella baltica OS183]
 gi|306911927|gb|EFN42351.1| Polyprenyl synthetase [Shewanella baltica BA175]
 gi|315266420|gb|ADT93273.1| Polyprenyl synthetase [Shewanella baltica OS678]
          Length = 331

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 191/310 (61%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  + Y G+ H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVSYEGEAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S + L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDSMKVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + D TEE Y+ VI  KTA LF AA  ++ ++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATLLAGVLAGATPEQ 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL +YG  LG AFQL DD+LDY  + +E+GKNIG+D   GKPTLP+I A   GT  EK
Sbjct: 201 ETALGNYGKYLGTAFQLTDDLLDYTADSDELGKNIGDDLAEGKPTLPLIYAIAHGTDEEK 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
           +  +  I  G    + + K    +    AL  T+ +A    +KA ++L  LPDS +K++L
Sbjct: 261 HLIRQAIEQGD-GTQAIDKIVAALHHCGALNYTQQKAIEESEKAIEALSILPDSDYKQAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 VALAKISVDR 329


>gi|295097675|emb|CBK86765.1| Geranylgeranyl pyrophosphate synthase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 323

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAILAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   +  + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCSEAQEKGLQDYGRYLGTAFQLIDDLLDYSADGETLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    +  I  G      L+     M    +L  T  RA     KA  +++ 
Sbjct: 243 AMRNGTPEQAKMIREAIEQGN-GRHLLEPVLETMAICGSLEWTRQRAEEEADKAIAAIQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           +PDS W+ +L+ +    +QR
Sbjct: 302 IPDSPWRDALIGLAHIAVQR 321


>gi|300115547|ref|YP_003762122.1| trans-hexaprenyltranstransferase [Nitrosococcus watsonii C-113]
 gi|299541484|gb|ADJ29801.1| Trans-hexaprenyltranstransferase [Nitrosococcus watsonii C-113]
          Length = 322

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 193/315 (61%), Gaps = 2/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL   DM  V+ LI +R+ SDV +I  +  Y+I SGGKRLRPM+ L +A   +Y+G  H+
Sbjct: 8   DLVADDMRSVDALIQQRLHSDVVLINQLGHYIINSGGKRLRPMVVLLSARAFDYQGSYHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD S LRRG+  A  +WG++ SVLVGDFL S+AF M++   
Sbjct: 68  DIAAIIEFIHTATLLHDDVVDSSELRRGRKTANNIWGSEASVLVGDFLYSRAFEMMVGVD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   +E L+    T+AEGE+ QL      D TEE YL +I+SKTA LF AA ++ +++  
Sbjct: 128 SMRVMEILARTTNTIAEGEVMQLLNCHEPDTTEECYLEIIRSKTAKLFEAATQLGAVLCH 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             ++  + + +YGM+LG AFQL DDVLDY     ++GKNIG+D   GKPTLP+I A  +G
Sbjct: 188 RSSAEEKLMATYGMHLGTAFQLTDDVLDYSAFSEDLGKNIGDDLAEGKPTLPLIYAMSKG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T       ++ I  G    ENL +    +  + A+  T   A     +A  +++ +P S 
Sbjct: 248 TAPHVKVIRNAIESG--GRENLAEVIEAIESSGAIAYTAEAARREADRAMQAVKSIPPSP 305

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L+ +  F   R
Sbjct: 306 YQEALLNLAKFAAYR 320


>gi|238918407|ref|YP_002931921.1| hypothetical protein NT01EI_0448 [Edwardsiella ictaluri 93-146]
 gi|238867975|gb|ACR67686.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 323

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEQITELTAQDMADVNAKILHQLNSDVALINQLGYYIISGGGKRIRPMIAILAARTLGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDHHLTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE++QL    + D++EE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENYMQVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG   +  QAL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAGADPAQEQALQDYGRYLGTAFQLIDDLLDYDADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G+       +  I  G      L+     M++  +L  T  RA     KA  +L  
Sbjct: 243 AMHHGSAERSAMIRQAIEQGN-GRHLLELVLETMQQAGSLDYTRSRAEEEADKAIAALTL 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPDS  K++L+ + +  + R
Sbjct: 302 LPDSPHKQALIGLANLAVNR 321


>gi|148977829|ref|ZP_01814384.1| octaprenyl-diphosphate synthase [Vibrionales bacterium SWAT-3]
 gi|145962898|gb|EDK28169.1| octaprenyl-diphosphate synthase [Vibrionales bacterium SWAT-3]
          Length = 323

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L L +A  L Y+G
Sbjct: 4   KAIQTLTANDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLALLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H+  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  EAHITSAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S   LE +S     +AEGE++QL    N D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TTLGSLRILELMSEAVNVIAEGEVQQLMNCNNPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      +  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILTESSPEIETAMQNYGKYLGTAFQLIDDVMDYTADGKEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G+  + +  +  I      +E L     +M+E  +L  T  +AY    KA   L  L
Sbjct: 244 MHNGSPEQASMIREAIEKAN-GMERLDDIMAVMKETGSLEYTTNKAYEEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           PDS +K++L  +    ++R
Sbjct: 303 PDSEYKQALTTLAHLAVKR 321


>gi|319778972|ref|YP_004129885.1| Octaprenyl-diphosphate synthase [Taylorella equigenitalis MCE9]
 gi|317108996|gb|ADU91742.1| Octaprenyl-diphosphate synthase [Taylorella equigenitalis MCE9]
          Length = 321

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 194/311 (62%), Gaps = 3/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I  R+ S+V +I  + +Y+I +GGKR+RP + L  +  L Y G  H L+A 
Sbjct: 12  EDMSAVDKVIRSRLNSEVVLIRTIGEYIISAGGKRIRPAMLLMMSKALGYEGSLHHLMAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEFIHT+TLLHDDVVD+S +RRG   A  V+GN  SVLVGD+L S++F M++E  S   
Sbjct: 72  VIEFIHTSTLLHDDVVDESDMRRGSATANAVFGNAASVLVGDYLYSRSFEMMVEADSMRI 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ +S     +AEGE+ QL    + +V  + Y+ VIKSKTA LF AA  V++++AG  ++
Sbjct: 132 MQIMSEATTVIAEGEVLQLLNVHDPNVDFDRYMDVIKSKTAKLFEAATRVAAVLAGADDA 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           V Q    YG ++G AFQ++DDVLDY G   ++GKN+G+D R GKPTLP+I     GT  +
Sbjct: 192 VEQKAALYGTHVGTAFQVIDDVLDYSGSAEDLGKNVGDDLREGKPTLPLIRVMSVGTPEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           K   +  I +G    E + +A   +R   AL  T   A      A  +L  LPDS++KKS
Sbjct: 252 KALIRHAIEEGDADFERVAQA---IRSTDALDYTRNIAQEQANIALSALDGLPDSAYKKS 308

Query: 310 LMEVVDFCLQR 320
           L ++V+F L R
Sbjct: 309 LQDLVNFSLAR 319


>gi|117617957|ref|YP_855472.1| octaprenyl-diphosphate synthase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559364|gb|ABK36312.1| octaprenyl-diphosphate synthase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 323

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/314 (43%), Positives = 195/314 (62%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LIL R+ SDV +I  +  Y++ +GGKR+RPMLT+  A  L Y G++H+ 
Sbjct: 9   LCAADMTAVNELILARLQSDVSLINQLGFYIVSAGGKRMRPMLTVMAARALGYEGEDHLK 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IEFIHT+TLLHDDVVD+S LRRG+  A  ++GN  SVLVGD+L S++F M+ E  +
Sbjct: 69  LAAIIEFIHTSTLLHDDVVDESDLRRGRETANALFGNAASVLVGDYLYSRSFQMMSELSN 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E LS    T+AEGE+ QL    + D TEE Y+ VI  KTA LF AA  +++++   
Sbjct: 129 LRVMEILSDATNTIAEGEVLQLMNCNDPDTTEESYMTVIYCKTAKLFEAATRLAAVLTHQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              V QA+  YG  LG AFQ++DDV+DY  + +EMGKN+G+D   GKPTLP++ A + G+
Sbjct: 189 PEPVEQAMTDYGKYLGTAFQIIDDVMDYCSQSDEMGKNVGDDLAEGKPTLPLLRAMEVGS 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+   +  I + +  +E+L +   I+    AL  +  RA     KA  +L  LPDS  
Sbjct: 249 PEERQLVRDAI-EHRNGMEHLDRILAILDRTGALEYSRMRAREEADKAIAALAILPDSRH 307

Query: 307 KKSLMEVVDFCLQR 320
           K++L  +    +QR
Sbjct: 308 KQALETLAHMAVQR 321


>gi|71906297|ref|YP_283884.1| polyprenyl synthetase [Dechloromonas aromatica RCB]
 gi|71845918|gb|AAZ45414.1| Polyprenyl synthetase [Dechloromonas aromatica RCB]
          Length = 341

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 137/320 (42%), Positives = 201/320 (62%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ L  L   DM+ V+ +I  R+ SDV ++  V +Y+I SGGKR+RP L L  A  L+Y+
Sbjct: 22  LEQLYALIGPDMKAVDAVIRDRLYSDVVLVRQVAEYIISSGGKRMRPALVLLAAGALDYQ 81

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H  +A  +EFIHTATLLHDDVVD+SALRRG+  A  ++GN  SVLVGDFL S+AF M
Sbjct: 82  GTRHQEMAAVVEFIHTATLLHDDVVDESALRRGRDTANAMFGNAASVLVGDFLYSRAFQM 141

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   +   ++ LS     +AEGE+ QL    + DV E  Y+ VI  KTA LF AA ++ 
Sbjct: 142 MVAVDNMRVMQVLSDATNVIAEGEVLQLMNCHDADVDEARYMQVIHYKTAKLFEAAAQLG 201

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++      V +AL +YGM+LG AFQL+DDVLDY G+  + GK+IG+D   GKPTLP+I 
Sbjct: 202 AILGQATPEVEKALTAYGMHLGTAFQLIDDVLDYSGQEADTGKHIGDDLAEGKPTLPLIY 261

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
             Q GT  +    +  I +G    ++  +    +R + AL   + RA    + AK +++C
Sbjct: 262 VMQHGTPEQAACVRKAIEEG--GRDDFPQVLDAIRNSGALDHAKARAIQEAELAKSAIQC 319

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L DS++KK+L+++  F ++R
Sbjct: 320 LGDSNYKKALLQLTLFAVER 339


>gi|119897305|ref|YP_932518.1| octaprenyl-diphosphate synthase [Azoarcus sp. BH72]
 gi|119669718|emb|CAL93631.1| octaprenyl-diphosphate synthase [Azoarcus sp. BH72]
          Length = 341

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 195/310 (62%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ LI K + SDV +I  V +Y+I SGGKRLRP L L +A  + YRG  H  LA  
Sbjct: 32  DMQAVDALIRKALYSDVVLIRQVAEYIINSGGKRLRPALVLFSAGAVGYRGTQHHRLAAV 91

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHT+TLLHDDVVD+S LRRG   A  ++GN  SVLVGDFL ++AF M++E  S   +
Sbjct: 92  VEFIHTSTLLHDDVVDESELRRGNKTANALFGNAASVLVGDFLYTRAFQMMVEVDSMRVM 151

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+     +AEGE+ QL    N DV  EDYL VI+ KTA LF AA  + +++ G   ++
Sbjct: 152 QILADATNIIAEGEVLQLLNCHNADVEVEDYLRVIRYKTAKLFEAASRLGAVLGGADPAL 211

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +++ ++GM+LG AFQL+DDVLDY  +  + GK++G+D   GKPTLP+I   Q G+  + 
Sbjct: 212 EESMAAFGMHLGTAFQLIDDVLDYSADEADTGKHLGDDLAEGKPTLPLIHVMQHGSAEQA 271

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I +G    ++       +++  AL  T   A     +A  +L+ LP S++K+SL
Sbjct: 272 ALVRGAIENG--GRDDFAAVLAAIQQTGALEVTRRHAREEADRAIAALQGLPPSNFKESL 329

Query: 311 MEVVDFCLQR 320
           +++ DF ++R
Sbjct: 330 LQLSDFAVER 339


>gi|217974480|ref|YP_002359231.1| polyprenyl synthetase [Shewanella baltica OS223]
 gi|217499615|gb|ACK47808.1| Polyprenyl synthetase [Shewanella baltica OS223]
          Length = 331

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 191/310 (61%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  + Y G+ H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVSYEGEAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S + L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDSMKVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + D TEE Y+ VI  KTA LF AA  ++ ++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATLLAGVLAGATLEQ 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL +YG  LG AFQL DD+LDY  + +E+GKNIG+D   GKPTLP+I A   GT  EK
Sbjct: 201 ETALGNYGKYLGTAFQLTDDLLDYTADSDELGKNIGDDLAEGKPTLPLIYAIAHGTDEEK 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
           +  +  I  G    + + K    +    AL  T+ +A    +KA ++L  LPDS +K++L
Sbjct: 261 HLIRQAIEQGD-GTQAIDKIVAALHHCGALNYTQQKAIEESEKAIEALSILPDSDYKQAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 VALAKISVDR 329


>gi|261342632|ref|ZP_05970490.1| octaprenyl-diphosphate synthase [Enterobacter cancerogenus ATCC
           35316]
 gi|288315280|gb|EFC54218.1| octaprenyl-diphosphate synthase [Enterobacter cancerogenus ATCC
           35316]
          Length = 323

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 198/319 (62%), Gaps = 5/319 (1%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+G+ 
Sbjct: 6   INELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAILAARAVGYQGNA 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+  
Sbjct: 66  HVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTS 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S + LE +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S ++
Sbjct: 126 LGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAAAQCSGIL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
            G  +   + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ A +
Sbjct: 186 GGCTDVQEKGLQDYGRYLGTAFQLIDDLLDYSADGETLGKNVGDDLNEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTI--NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            GT  +    +  I   +G+  +E + +A  I   + +L  T  RA     KA  +L+ +
Sbjct: 246 NGTPEQAKMIREAIEQGNGRHLLEPVLEAMAI---SGSLEWTRQRAEEEADKAIAALQVI 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           PDS W+ +L+ +    +QR
Sbjct: 303 PDSPWRDALIGLAHIAVQR 321


>gi|213582666|ref|ZP_03364492.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 319

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 193/311 (62%), Gaps = 1/311 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMRHGTPEQSAMIRTAIEQGN-GRHLLEPVLEAMTTCGSLEWTRQRAEEEADKAISALQI 301

Query: 301 LPDSSWKKSLM 311
           LPD+ W+++L+
Sbjct: 302 LPDTPWREALI 312


>gi|213859721|ref|ZP_03385425.1| octaprenyl diphosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 318

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 193/311 (62%), Gaps = 1/311 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y+I  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMRHGTPEQSAMIRTAIEQGN-GRHLLEPVLEAMTTCGSLEWTRQRAEEEADKAISALQI 301

Query: 301 LPDSSWKKSLM 311
           LPD+ W+++L+
Sbjct: 302 LPDTPWREALI 312


>gi|146313257|ref|YP_001178331.1| octaprenyl diphosphate synthase [Enterobacter sp. 638]
 gi|145320133|gb|ABP62280.1| Trans-hexaprenyltranstransferase [Enterobacter sp. 638]
          Length = 323

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 195/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + +LT +DM  VN +IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+GD 
Sbjct: 6   INELTAQDMAGVNAVILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAILAARAVGYQGDA 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+  
Sbjct: 66  HVNIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTS 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S ++
Sbjct: 126 LGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSGIL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ A +
Sbjct: 186 AGCTEAQERGLQDYGRYLGTAFQLIDDLLDYSADGETLGKNVGDDLNEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G+  +    +  I  G      L+     M    +L  T  RA     KA  +++ +PD
Sbjct: 246 NGSPDQAKLIREAIEQGN-GRHLLEPVLETMAICGSLEWTRQRAEEEADKAITAIQVIPD 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S W+ +L+ +    +QR
Sbjct: 305 SPWRDALIGLAHIAVQR 321


>gi|217970068|ref|YP_002355302.1| trans-hexaprenyltranstransferase [Thauera sp. MZ1T]
 gi|217507395|gb|ACK54406.1| Trans-hexaprenyltranstransferase [Thauera sp. MZ1T]
          Length = 322

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 192/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I  R+ SDV +I  + +Y++ SGGKRLRP L L  A  L+YRG +H  LA  
Sbjct: 13  DMQAVDTVIRNRLHSDVALIRRIAEYIVGSGGKRLRPALVLYAAGALDYRGVHHHELAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTA+LLHDDVVD+S LRRGK  A   +GN ++VLVGDFL S+AF M++       +
Sbjct: 73  VEFIHTASLLHDDVVDESDLRRGKRTANAAFGNASAVLVGDFLYSRAFQMMVGVDEMRVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     +AEGE+ QL    N DV  EDYL VI+ KTA LF AA  +  ++AG  +++
Sbjct: 133 RVLADATNIIAEGEVLQLLNCHNADVVIEDYLRVIRYKTAKLFEAAARLGGIVAGADDAL 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            Q L ++GM+LG AFQL+DDVLDY  +  + GK++G+D   GKPTLP+I   Q GT  + 
Sbjct: 193 EQRLAAFGMHLGTAFQLIDDVLDYSADEADTGKHLGDDLAEGKPTLPLIHVMQHGTAEQG 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G     +       ++   AL +T   A +  + A D++  LP S +K++L
Sbjct: 253 ALVRHAIEGGGRG--DFAAVLAAIQSTGALEETRRYAEAEAKLAIDAISVLPPSIFKEAL 310

Query: 311 MEVVDFCLQR 320
           +++ DF ++R
Sbjct: 311 LQLSDFAVRR 320


>gi|163802656|ref|ZP_02196547.1| malate dehydrogenase [Vibrio sp. AND4]
 gi|159173544|gb|EDP58364.1| malate dehydrogenase [Vibrio sp. AND4]
          Length = 323

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 196/319 (61%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYHG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    N D TEE+Y+ VI SKTA LF +A ++ +
Sbjct: 124 TELGSIKILKLMSDAVNVIAEGEVQQLMNCNNPDTTEENYMQVIYSKTARLFESATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++     +V  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPENVEVALQNYGKFLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
               T       +  I      ++ L++   +M++  +L  TE +A     KA   L  L
Sbjct: 244 MHNTTPENAAMIREAIEKAN-GMDRLEEILAVMQDAGSLAYTEQKAVEEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 303 PESDYKQALITLAHMAVKR 321


>gi|323493611|ref|ZP_08098732.1| octaprenyl-diphosphate synthase [Vibrio brasiliensis LMG 20546]
 gi|323312134|gb|EGA65277.1| octaprenyl-diphosphate synthase [Vibrio brasiliensis LMG 20546]
          Length = 323

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 192/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKR+RP+L + +A  L Y+G
Sbjct: 4   KAIQALTADDMAKVNETIHAQLNSDVSLINQLGFYIVSGGGKRIRPLLAVLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H   A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  EAHTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSLKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  AL++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNEAPAEVELALQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            + GT+ +    +  I      +E L      M E  +L  T  +AY    KA   L  L
Sbjct: 244 MEHGTEEQTQMIREAIEKAN-GMERLNDILATMEETGSLEYTRKKAYQEADKAIAELDVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            DS +K++L+ +    + R
Sbjct: 303 DDSVYKQALITLAHMSVHR 321


>gi|326423749|ref|NP_759657.2| Octaprenyl-diphosphate synthase [Vibrio vulnificus CMCP6]
 gi|319999111|gb|AAO09184.2| Octaprenyl-diphosphate synthase [Vibrio vulnificus CMCP6]
          Length = 333

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 14  KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSARALGYQG 73

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H   A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 74  NAHTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 133

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE+ QL    + D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 134 TELGSMKILKLMSDAVNIIAEGEVLQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGA 193

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  AL++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 194 ILNDAPAEVETALQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLHA 253

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +          +  I +    +E L     +M++  +L  TE +A     KA   L+ L
Sbjct: 254 MRHTNAENAQMIREAIENAN-GMERLDDILAVMQQAGSLTYTEAKAMEEADKAIAELQVL 312

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 313 PESEYKQALIALAHMAVKR 331


>gi|237730107|ref|ZP_04560588.1| octaprenyl diphosphate synthase [Citrobacter sp. 30_2]
 gi|226908713|gb|EEH94631.1| octaprenyl diphosphate synthase [Citrobacter sp. 30_2]
          Length = 370

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 50  LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 109

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            + HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 110 ENAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 169

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 170 MTSLGSLKVLEVMSKAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 229

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 230 GILAGCSEEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEQLGKNVGDDLNEGKPTLPLLH 289

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    +  I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 290 AMRHGTPEQALMIRQAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 348

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 349 LPDTPWREALIGLAHIAVQR 368


>gi|242240764|ref|YP_002988945.1| octaprenyl diphosphate synthase [Dickeya dadantii Ech703]
 gi|242132821|gb|ACS87123.1| Trans-hexaprenyltranstransferase [Dickeya dadantii Ech703]
          Length = 323

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 190/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  L+ +DM  VN +IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEQITALSAQDMAAVNQIILEQLNSDVALINQLGHYIISGGGKRIRPMIAVLAARALNYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GNKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLSSLRVLAVMSDAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +   AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILADADTTCENALRDYGRYLGTAFQLIDDLLDYNADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   ++   +  I  G      L      M+E  +L  T  RA     KA  +L+C
Sbjct: 243 AMHHGNPEQRRMIRQAIEQGN-GRHLLIPVLAAMQECGSLEYTRQRAEEEADKAIAALQC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S +K +L  +    +QR
Sbjct: 302 LPRSDFKTALESLAHLAVQR 321


>gi|50119637|ref|YP_048804.1| octaprenyl diphosphate synthase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610163|emb|CAG73603.1| octaprenyl-diphosphate synthase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 323

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  LT +DM  VN +IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y 
Sbjct: 3   LEQITTLTTQDMAAVNKVILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLAARALAYN 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           S++AG      +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 SILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A ++G   + +  +  I +G      L+     M++  +L  T  RA     KA ++L+ 
Sbjct: 243 AMRQGNAEQSSLIRQAIEEGN-GRHLLEPILAAMQQCGSLDYTRQRAEEEADKAINALQL 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP + ++ +L  +    +QR
Sbjct: 302 LPKTPYRMALEGLAHLAVQR 321


>gi|197287216|ref|YP_002153088.1| octaprenyl diphosphate synthase [Proteus mirabilis HI4320]
 gi|227357090|ref|ZP_03841460.1| possible Farnesyltranstransferase [Proteus mirabilis ATCC 29906]
 gi|194684703|emb|CAR46670.1| octaprenyl-diphosphate synthase [Proteus mirabilis HI4320]
 gi|227162782|gb|EEI47745.1| possible Farnesyltranstransferase [Proteus mirabilis ATCC 29906]
          Length = 323

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 190/314 (60%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ + T   L+Y+GD H+ 
Sbjct: 9   LTSADMAAVNDAILYQLNSDVSLINQLGYYIISGGGKRIRPMIAVLTGRALDYQGDKHIS 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           +A  IEFIHTATLLHDDVVD+S +RRGK  A  V+GN  SVLVGDF+ +++F M+ +  S
Sbjct: 69  VAALIEFIHTATLLHDDVVDESDMRRGKQTANAVFGNAASVLVGDFIYTRSFQMMTDLDS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ +S     +AEGE+ QL    + D+TE+DY+ VI SKTA LF AA   S+++ G 
Sbjct: 129 MRVLKLMSSATNVIAEGEVLQLMNCNDPDITEDDYMQVIYSKTARLFEAASHASAILCGA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                +A + YG  LG AFQL+DD+LDY  +  ++GKN G+D   GKPTLP++ A   G 
Sbjct: 189 TPEQEKAFQDYGRYLGTAFQLIDDLLDYDADNTQLGKNTGDDLDEGKPTLPLLHAMHHGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E    +  I  G      L      M++  +L  T  +A     KA ++L  +PDSS+
Sbjct: 249 ETESQLIRQAIEKGN-GRHLLDTVLKTMKQCGSLEYTRQKAEEEADKAIEALAIIPDSSY 307

Query: 307 KKSLMEVVDFCLQR 320
           K +L+ +    +QR
Sbjct: 308 KDALIGLAHVAVQR 321


>gi|104780055|ref|YP_606553.1| octaprenyl-diphosphate synthase [Pseudomonas entomophila L48]
 gi|95109042|emb|CAK13738.1| octaprenyl-diphosphate synthase [Pseudomonas entomophila L48]
          Length = 322

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 196/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG  +  
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTTEEIYMDVIRGKTAMLFEASTHSAAALAGASDEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I A + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSETLGKNVGDDLAEGKPTLPLIYAMREGTAEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  I +  + AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLEQIRIAVEASGALAYTAQMARDYVARAIACLEVLPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|320157514|ref|YP_004189893.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e [Vibrio vulnificus MO6-24/O]
 gi|319932826|gb|ADV87690.1| octaprenyl-diphosphate synthase / dimethylallyltransferase /
           geranyltranstransferase (farnesyldiphosphate synthase) /
           geranylgeranyl pyrophosphate synthetase [Vibrio
           vulnificus MO6-24/O]
          Length = 323

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H   A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NAHTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE+ QL    + D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNIIAEGEVLQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  AL++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPAEVETALQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +          +  I +    +E L     +M++  +L  TE +A     KA   L+ L
Sbjct: 244 MRHTNAENAQMIREAIENAN-GMERLDDILAVMQQAGSLTYTEAKAMEEADKAIAELQVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 303 PESEYKQALIALAHMAVKR 321


>gi|253686958|ref|YP_003016148.1| Trans-hexaprenyltranstransferase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753536|gb|ACT11612.1| Trans-hexaprenyltranstransferase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 323

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  LT +DM  VN +IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L+Y 
Sbjct: 3   LEQITTLTAQDMAAVNNVILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLAARALDYN 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           S++AG      +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 SILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   + +  +  I +G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 243 AMHNGNAEQSSLIRKAIEEGN-GRHLLEPVLAAMQQCGSLDYTRQRAEEEADKAISALQQ 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ ++ +L  +    +QR
Sbjct: 302 LPETPYRIALEGLAHLAVQR 321


>gi|157148758|ref|YP_001456077.1| hypothetical protein CKO_04590 [Citrobacter koseri ATCC BAA-895]
 gi|157085963|gb|ABV15641.1| hypothetical protein CKO_04590 [Citrobacter koseri ATCC BAA-895]
          Length = 498

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 178 LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 237

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            + HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 238 ENAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 297

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 298 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 357

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            L+AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 358 GLLAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEQLGKNVGDDLNEGKPTLPLLH 417

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    ++ I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 418 AMRNGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMTACGSLEWTRQRAEDEADKAIAALQI 476

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 477 LPDTPWREALIGLAHIAVQR 496


>gi|294139556|ref|YP_003555534.1| octaprenyl-diphosphate synthase [Shewanella violacea DSS12]
 gi|293326025|dbj|BAJ00756.1| octaprenyl-diphosphate synthase [Shewanella violacea DSS12]
          Length = 323

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 194/310 (62%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI  ++ SDV +I  +  Y+I  GGKR+RP+LT+  A  ++Y+G+ H+ LA  
Sbjct: 13  DMQDVNKLIYSQLESDVALINQLGFYIINGGGKRMRPLLTILAARAIDYQGEAHLKLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S + L
Sbjct: 73  IEFIHTASLLHDDVVDESMLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELGSMKVL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E L+     LAEGE+ QL    + D +EE+Y+ VI  KTA LF AA  ++ ++A     +
Sbjct: 133 EMLADATNVLAEGEVLQLMNCNDPDTSEENYMRVIYCKTAKLFEAATRLAGVLADSPIEI 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           + AL  YG  LG AFQL DD+LDY     E+GKNIG+D   GKPTLP+I A   GT++E+
Sbjct: 193 QTALADYGKYLGTAFQLTDDLLDYTANTEELGKNIGDDLAEGKPTLPLIYAIANGTEKEQ 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    + + +    + +  AL  T  RA     KA ++L C+PDS +K++L
Sbjct: 253 ALIRKAIELGD-GTQYIDEILTALNKCGALEYTLNRALEESDKAIEALSCIPDSDYKQAL 311

Query: 311 MEVVDFCLQR 320
           + +    ++R
Sbjct: 312 ISLAKIAVER 321


>gi|227113758|ref|ZP_03827414.1| octaprenyl diphosphate synthase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 323

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  LT +DM  VN +IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L+Y 
Sbjct: 3   LEQITALTAQDMAAVNNVILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLAARALDYN 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           S++AG      +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 SILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G   + +  +  I +G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 243 AMRHGNAEQSSLIRKAIEEGN-GRHLLEPVLSAMQQCGSLDYTRQRAEEEADKAISALQQ 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ ++ +L  +    +QR
Sbjct: 302 LPETPYRMALEGLAHLAVQR 321


>gi|329997657|ref|ZP_08302894.1| octaprenyl pyrophosphate synthetase [Klebsiella sp. MS 92-3]
 gi|328538933|gb|EGF64988.1| octaprenyl pyrophosphate synthetase [Klebsiella sp. MS 92-3]
          Length = 323

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GSAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + +
Sbjct: 123 MTQLGSLKILEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAASQCA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            L+A       +AL+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GLLADCTAEEERALQDYGRYLGTAFQLIDDLLDYSSDGERLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I  G      L      M    +L  T+ RA     KA  +L+ 
Sbjct: 243 AMHHGTPDQSAMIRGAIEQGN-GRHLLDAVLETMATCGSLEWTQKRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|56477995|ref|YP_159584.1| polyprenyl synthetase [Aromatoleum aromaticum EbN1]
 gi|56314038|emb|CAI08683.1| Polyprenyl synthetase (EC 2.5.1.-), gene: ISPB OR NE1915
           [Aromatoleum aromaticum EbN1]
          Length = 322

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 192/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I +R+ SDV +I  V +Y+I SGGKRLRP L L +A  + YRG +H  LA  
Sbjct: 13  DMQAVDAVIRERLHSDVVLIRQVAEYIIHSGGKRLRPALVLFSAGAMGYRGQSHHQLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG   A  ++GN  SVLVGDFL ++AF M++       +
Sbjct: 73  VEFIHTATLLHDDVVDESELRRGNKTANALFGNAASVLVGDFLYTRAFQMMVGVGDMRVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+     +AEGE+ QL    N DV  EDYL VI+ KTA LF AA  + +++ G     
Sbjct: 133 QVLADATNIIAEGEVLQLLNCHNADVDIEDYLRVIRYKTAKLFEAATRLGAILGGANEEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            + + ++GM+LG AFQ++DDVLDY  +    GK++G+D   GKPTLP+I A + GT  + 
Sbjct: 193 ERKVAAFGMHLGTAFQIIDDVLDYSSDEAATGKHLGDDLAEGKPTLPLIHAMKHGTAEQS 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              ++ I  G    ++ +     +RE  AL +    A + GQ A D+L  LP S +K +L
Sbjct: 253 ARVRNAIESG--GRDDFEAVLAAIRETGALEEARRWARAEGQFAIDALEVLPPSIFKDAL 310

Query: 311 MEVVDFCLQR 320
           +++ DF + R
Sbjct: 311 LQLSDFAVVR 320


>gi|307129369|ref|YP_003881385.1| octaprenyl diphosphate synthase [Dickeya dadantii 3937]
 gi|306526898|gb|ADM96828.1| octaprenyl diphosphate synthase [Dickeya dadantii 3937]
          Length = 323

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 192/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  L+ +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ + TA  L Y+
Sbjct: 3   LEQITALSAQDMAAVNQTILDQLNSDVVLINQLGNYIISGGGKRIRPMIAVLTARALNYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   +  +S     +AEGE+ QL    + D+TE+ Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLASLRVMSVMSDAVNVIAEGEVLQLMNCNDPDITEDSYMRVIYSKTARLFEAAAQAS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++++G  +    AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILSGASSEQELALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G + ++   +  I +G      L+     M+   +L  T  RA     KA  +++C
Sbjct: 243 AMHHGNEEQRTMIRQAIEEGN-GRHLLEPVLAAMQSCGSLTYTRQRAEEEADKAITAIQC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S ++ +L  +    +QR
Sbjct: 302 LPASDFRTALEGLAHLAVQR 321


>gi|291086510|ref|ZP_06571551.1| octaprenyl-diphosphate synthase [Citrobacter youngae ATCC 29220]
 gi|291067630|gb|EFE05739.1| octaprenyl-diphosphate synthase [Citrobacter youngae ATCC 29220]
          Length = 498

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 178 LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 237

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            + HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 238 ENAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 297

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 298 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 357

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG      + L+ YG  LG AFQL+DD+LDY  +  ++GKN+G+D   GKPTLP++ 
Sbjct: 358 GILAGCSAEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEQLGKNVGDDLNEGKPTLPLLH 417

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    +  I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 418 AMRHGTPEQAQMIRQAIEQGN-GRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQV 476

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 477 LPDTPWREALIGLAHIAVQR 496


>gi|152972111|ref|YP_001337257.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238896694|ref|YP_002921439.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae NTUH-K2044]
 gi|262042746|ref|ZP_06015900.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150956960|gb|ABR78990.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238549021|dbj|BAH65372.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259039971|gb|EEW41088.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 323

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GSAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + +
Sbjct: 123 MTQLGSLKILEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAASQCA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            L+A       +AL+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GLLADCTAEEERALQDYGRYLGTAFQLIDDLLDYSSDGERLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I  G      L      M    +L  T+ RA     KA  +L+ 
Sbjct: 243 AMHHGTPDQSAMIRGAIEQGN-GRHLLDAVLETMATCGSLEWTQKRAEEEADKAIAALQI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|304396333|ref|ZP_07378214.1| Trans-hexaprenyltranstransferase [Pantoea sp. aB]
 gi|308189085|ref|YP_003933216.1| octaprenyl diphosphate synthase [Pantoea vagans C9-1]
 gi|304355842|gb|EFM20208.1| Trans-hexaprenyltranstransferase [Pantoea sp. aB]
 gi|308059595|gb|ADO11767.1| octaprenyl diphosphate synthase [Pantoea vagans C9-1]
          Length = 323

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 191/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ + +A  + Y+
Sbjct: 3   LEQINELTAQDMAAVNQTILDQLNSDVSLINQLGYYIISGGGKRIRPMIAVLSARAMGYK 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDLHVTNAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSMGSLRILALMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAASQAS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A       +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAEATPEEEKALQDYGRYLGTAFQLIDDLLDYSADGETLGKNTGDDLSEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G+  +    +  I  G      L+     M +  +L  T  RA     KA ++LR 
Sbjct: 243 AMQHGSPEQAKMIREAIEQGN-GRHLLEPVLEAMNQCGSLEWTRSRAEQEADKAIEALRI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S W+ +L  +    +QR
Sbjct: 302 LPESPWRSALESLAHMSVQR 321


>gi|261250197|ref|ZP_05942773.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           orientalis CIP 102891]
 gi|260939313|gb|EEX95299.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           orientalis CIP 102891]
          Length = 345

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 192/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKR+RP+L + +A  L Y+G
Sbjct: 26  KAIQALTADDMAKVNETIHAQLNSDVSLINQLGFYIVSGGGKRIRPLLAVLSARALGYQG 85

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H   A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 86  EAHTTSAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 145

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    N D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 146 TELGSLKILKLMSDAVNVIAEGEVQQLMNCNNPDTTEESYMQVIYSKTARLFEAATQIGA 205

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  AL++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 206 ILNDAPEDVELALQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 265

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            + G+  +    +  I      +E L      M +  +L  T  +AY    KA   L  L
Sbjct: 266 MKNGSAEQTAMIREAIEKAN-GMERLNDILAAMEQTGSLEYTRQKAYQEADKAIAELNVL 324

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            +S +K++L+ +    + R
Sbjct: 325 EESVYKQALVTIAHMAVHR 343


>gi|114330832|ref|YP_747054.1| farnesyltranstransferase [Nitrosomonas eutropha C91]
 gi|114307846|gb|ABI59089.1| Farnesyltranstransferase [Nitrosomonas eutropha C91]
          Length = 322

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 200/320 (62%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + ++  KDM +V+ +I +++ S V ++  V +Y+I SGGKRLRP L +  A + +Y+
Sbjct: 3   IESIRNVIAKDMGEVDNVIQQKLHSQVVLVRQVSEYIIHSGGKRLRPALVILAAGLYDYK 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H  LA  +EFIHTATLLHDDVVD+S LRR +  A  ++GN  SVLVGDFL S+AF M
Sbjct: 63  GTHHYNLAAVVEFIHTATLLHDDVVDESQLRRNQATANALFGNAASVLVGDFLYSRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  +   +E L+    T+AEGE+ QL   ++ DV EE+YL VI+ KTA LF AA  + 
Sbjct: 123 MVEVDNMRVMEVLADATNTIAEGEVLQLLNCRDPDVEEENYLQVIRFKTAKLFEAAGRLG 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++ G   +  +AL +YGM+LG AFQLVDD+LDY G  ++ GKN+G+D   GKPTLP+I 
Sbjct: 183 AILGGATPAEEEALAAYGMHLGTAFQLVDDLLDYSGNDHDTGKNLGDDLAEGKPTLPLIF 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  + N  +  I  G    +       I+++  AL   +  A      A   +  
Sbjct: 243 AMRAGTTDQANTVRHAIESG--GKDGFGPVLEIIQKTGALDYAKQCAQKEANMATSVIST 300

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L DS +K+ L+E+ +F + R
Sbjct: 301 LRDSIYKQCLLELAEFAVSR 320


>gi|226329701|ref|ZP_03805219.1| hypothetical protein PROPEN_03613 [Proteus penneri ATCC 35198]
 gi|225202887|gb|EEG85241.1| hypothetical protein PROPEN_03613 [Proteus penneri ATCC 35198]
          Length = 323

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 191/314 (60%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ + T   L+Y+GD H+ 
Sbjct: 9   LTSADMTAVNEAILYQLNSDVSLINQLGYYIISGGGKRIRPMIAVLTGRALDYQGDKHIS 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           +A  IEFIHTATLLHDDVVD+S +RRGK  A  V+GN  SVLVGDF+ +++F M+ +  S
Sbjct: 69  VAALIEFIHTATLLHDDVVDESDMRRGKQTANAVFGNAASVLVGDFIYTRSFQMMTDLDS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ +S     +AEGE+ QL    + D++E+DY+ VI SKTA LF AA   S++++G 
Sbjct: 129 MRVLKLMSSATNVIAEGEVLQLMNCNDPDISEDDYMQVIYSKTARLFEAASHASAILSGA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                +A + YG  LG AFQL+DD+LDY  + N++GKN G+D   GKPTLP++ A   G 
Sbjct: 189 TPEQEKAFQDYGRYLGTAFQLIDDLLDYDADNNQLGKNTGDDLDEGKPTLPLLHAMHNGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + E    +  I  G      L      M++  +L  T  +A     KA ++L  +P+S +
Sbjct: 249 EEESKLIRQAIEQGN-GRHLLDTVLNTMKQCGSLEYTRQKAEEEADKAIEALSIIPNSPY 307

Query: 307 KKSLMEVVDFCLQR 320
           K +L+ +    +QR
Sbjct: 308 KDALIGLAHVAVQR 321


>gi|261820112|ref|YP_003258218.1| octaprenyl diphosphate synthase [Pectobacterium wasabiae WPP163]
 gi|261604125|gb|ACX86611.1| Trans-hexaprenyltranstransferase [Pectobacterium wasabiae WPP163]
          Length = 323

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  LT +DM  VN +IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y 
Sbjct: 3   LEQITKLTTQDMAAVNKVILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLAARALAYD 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           S++AG      +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 SILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   + +  ++ I +G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGNAEQSSLIRNAIEEGN-GRHLLEPVLAAMQQCGSLDYTRQRAEEEADKAISALQR 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ ++ +L  +    +QR
Sbjct: 302 LPETPYRVALEGLAHLAVQR 321


>gi|296104900|ref|YP_003615046.1| octaprenyl diphosphate synthase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059359|gb|ADF64097.1| octaprenyl diphosphate synthase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 323

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAILAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GKAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   +  + L+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGCTAAQEKGLQDYGRYLGTAFQLIDDLLDYSADGETLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G+  +    +  I  G      L+     M    +L  T  RA     KA  +L+ 
Sbjct: 243 AMHNGSADQAKMIREAIEQGN-GRHLLEPVLETMAICGSLEWTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           +PDS W+ +L+ +    +QR
Sbjct: 302 IPDSPWRDALIGLAHIAVQR 321


>gi|254435950|ref|ZP_05049457.1| polyprenyl synthetase superfamily [Nitrosococcus oceani AFC27]
 gi|207089061|gb|EDZ66333.1| polyprenyl synthetase superfamily [Nitrosococcus oceani AFC27]
          Length = 322

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 193/315 (61%), Gaps = 2/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL   DM+ V+ LI +R+ SDV +I  +  Y+I SGGKRLRPM+ L +A    Y+G  H+
Sbjct: 8   DLVADDMQAVDALIQQRLHSDVVLINQLGHYIINSGGKRLRPMVVLLSARAFGYQGSYHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD S LRRG+  A  +WG++ SVLVGDFL S+AF M++   
Sbjct: 68  DIAAIIEFIHTATLLHDDVVDSSDLRRGRKTANNIWGSEASVLVGDFLYSRAFEMMVGVD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   +E L+    T+AEGE+ QL      D TEE YL +I+SKTA LF AA ++ +++  
Sbjct: 128 SMRVMEILARTTNTIAEGEVMQLLNCHEPDTTEECYLEIIRSKTAKLFEAATQLGAVLCH 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             ++  + + +YGM+LG AFQL DDVLDY     ++GKNIG+D   GKPTLP+I A  +G
Sbjct: 188 RPSAEEKLMAAYGMHLGTAFQLTDDVLDYSSFSEDLGKNIGDDLAEGKPTLPLIYAMSKG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +       ++ I  G    ENL +    +  + A+  T   A     KA  +++ +P S 
Sbjct: 248 STSHVKVIRNAIESG--GRENLAEVIEAIESSGAIAYTAEAARREADKAMQAVKNIPASP 305

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L+ +  F   R
Sbjct: 306 YQEALLNLAKFAAYR 320


>gi|320540162|ref|ZP_08039817.1| putative octaprenyl diphosphate synthase [Serratia symbiotica str.
           Tucson]
 gi|320029828|gb|EFW11852.1| putative octaprenyl diphosphate synthase [Serratia symbiotica str.
           Tucson]
          Length = 333

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 193/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  LT +DM  VN  IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y 
Sbjct: 13  LEQITALTAQDMMAVNAAILEQLHSDVTLINQLCYYIISGGGKRIRPMIAVLAARALNYE 72

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 73  GNKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 132

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   KS   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 133 MTSLKSLRVLALMSEAVNVIAEGEVLQLMNVHDPDITEESYMQVIYSKTARLFEAAAQSS 192

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++++G   +  +AL+ YG  LG AFQL+DD+LDY    + +GKN G+D   GKPTLP++ 
Sbjct: 193 AILSGANQAEEKALQDYGRYLGTAFQLIDDLLDYSANGSTLGKNTGDDLNEGKPTLPLLH 252

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G + +++  +  I  G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 253 AMHHGDEAQRSMIREAIEQGN-RRHLLEPVLQAMQQCASLEYTHNRAEEEANKAIAALQA 311

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S ++ +L  +    +QR
Sbjct: 312 LPKSPYRDALEGLARLAVQR 331


>gi|145300249|ref|YP_001143090.1| octaprenyl-diphosphate synthase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853021|gb|ABO91342.1| octaprenyl-diphosphate synthase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 323

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 137/314 (43%), Positives = 194/314 (61%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LIL R+ SDV +I  +  Y++ +GGKR+RPMLT+  A  L Y G +H+ 
Sbjct: 9   LCAADMTAVNELILARLQSDVSLINQLGFYIVSAGGKRMRPMLTVMAARALGYEGQDHLK 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IEFIHT+TLLHDDVVD+S LRRG+  A  ++GN  SVLVGD+L S++F M+ E  +
Sbjct: 69  LAAIIEFIHTSTLLHDDVVDESDLRRGRETANALFGNAASVLVGDYLYSRSFQMMSELSN 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E LS    T+AEGE+ QL    + D TE+ Y+ VI  KTA LF AA  +++++   
Sbjct: 129 LRVMEILSDATNTIAEGEVLQLMNCNDPDTTEQSYMTVIYCKTAKLFEAATRLAAVLTHQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              V QA+  YG  LG AFQ++DDV+DY  + +EMGKN+G+D   GKPTLP++ A + G+
Sbjct: 189 PEPVEQAMTDYGKYLGTAFQIIDDVMDYCSQSDEMGKNVGDDLAEGKPTLPLLRAMEVGS 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             E+   +  I + +  +E+L +   I+    AL  +  RA     KA  +L  LPDS  
Sbjct: 249 PEERQLVRDAI-EHRNGMEHLDQILGILDRTGALEYSRMRAREEADKAIAALAILPDSQH 307

Query: 307 KKSLMEVVDFCLQR 320
           K++L  +    +QR
Sbjct: 308 KQALETLAQMAVQR 321


>gi|119775962|ref|YP_928702.1| trans-hexaprenyltranstransferase [Shewanella amazonensis SB2B]
 gi|119768462|gb|ABM01033.1| Trans-hexaprenyltranstransferase [Shewanella amazonensis SB2B]
          Length = 333

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 196/324 (60%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  +  L   DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  + Y 
Sbjct: 13  LNAIRQLADADMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVNYN 72

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ H+ LA  IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 73  GEGHLKLAAIIEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQM 132

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E  S + L+ L+     LAEGE+ QL    + + TEE Y+ VI  KTA LF AA  ++
Sbjct: 133 MTELGSMKVLQVLADATNVLAEGEVLQLMNCNDPNTTEESYMRVIYCKTAKLFEAATRLA 192

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG    V +AL  YG  LG AFQL+DD+LDY  +  E+GKNIG+D   GKPTLP+I 
Sbjct: 193 AVLAGSDEKVEEALADYGKYLGTAFQLIDDLLDYTSDAEELGKNIGDDLAEGKPTLPLIY 252

Query: 241 AFQRGTKREKNFWKSTIN--DGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
           A   G +RE+   ++ I   DG  ++E +  A   +    AL  T  RA     KA  +L
Sbjct: 253 AIGHGNEREQGLIRNAIEKADGTGAIEEILTA---LHRCGALDYTRRRAEEEADKAIAAL 309

Query: 299 RCLPDSSWKKSLMEVVDFCLQRLN 322
             LP+  +K +L  +    + R N
Sbjct: 310 SVLPEGDFKTALESLARIAVSRSN 333


>gi|152978590|ref|YP_001344219.1| polyprenyl synthetase [Actinobacillus succinogenes 130Z]
 gi|150840313|gb|ABR74284.1| Polyprenyl synthetase [Actinobacillus succinogenes 130Z]
          Length = 330

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM+KVN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ L  A  L Y 
Sbjct: 10  IKAIQALIEPDMQKVNTEILAQLNSDVALINQLGFYIIQGGGKRIRPMIALLAARALNYE 69

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+   + A  IEFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 70  GEKMPVCAAFIEFIHTASLLHDDVVDESDMRRGRATANAAFGNAASVLVGDFIYTRAFQL 129

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S + L  +S     LAEGE++QL    + + TEE+Y+ VI  KTA LF  + + +
Sbjct: 130 MAKLNSLKMLTIMSDATNVLAEGEVQQLMNVNDPETTEENYMKVIYRKTARLFEVSTQAA 189

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A     +  AL+ YG  LG AFQLVDDVLDY  +   MGKN+G+D   GKPTLP++ 
Sbjct: 190 AIMANADEKIESALQQYGRYLGTAFQLVDDVLDYSAQAETMGKNVGDDLAEGKPTLPLLH 249

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT+ +    +S I  G    E + +   IM ++++L     RA +  QKA D+L  
Sbjct: 250 AMRHGTEEQSALIRSAIEQGG-KREIIAEVLAIMAQHKSLDHAMERAKAEAQKAVDALTI 308

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ +K++L+ +    + R
Sbjct: 309 LPDNEYKRALISLAYQSVNR 328


>gi|206578772|ref|YP_002236401.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae 342]
 gi|288933385|ref|YP_003437444.1| dimethylallyltranstransferase [Klebsiella variicola At-22]
 gi|290511564|ref|ZP_06550933.1| octaprenyl diphosphate synthase [Klebsiella sp. 1_1_55]
 gi|206567830|gb|ACI09606.1| octaprenyl-diphosphate synthase [Klebsiella pneumoniae 342]
 gi|288888114|gb|ADC56432.1| Dimethylallyltranstransferase [Klebsiella variicola At-22]
 gi|289776557|gb|EFD84556.1| octaprenyl diphosphate synthase [Klebsiella sp. 1_1_55]
          Length = 323

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  + Y+
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GSAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S + LE +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + +
Sbjct: 123 MTQLGSLKILEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAASQCA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A       +AL+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GMLADCSAEEERALQDYGRYLGTAFQLIDDLLDYSSDGERLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I  G      L      M    +L  T+ RA     KA  +L+ 
Sbjct: 243 AMHHGTPDQAAMIRGAIEQGN-GRHLLDAVLETMATCGSLEWTQKRAEEEADKAIAALQI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ W+++L+ +    +QR
Sbjct: 302 LPDTPWREALIGLAHIAVQR 321


>gi|188532487|ref|YP_001906284.1| Octaprenyl diphosphate synthase [Erwinia tasmaniensis Et1/99]
 gi|188027529|emb|CAO95376.1| Octaprenyl diphosphate synthase [Erwinia tasmaniensis Et1/99]
          Length = 324

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 196/321 (61%), Gaps = 2/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLT-LATALMLEY 59
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+  LA   + +Y
Sbjct: 3   LEQINELTAQDMADVNATILDQLNSDVSLINQLGYYIINGGGKRIRPMIAVLAARAINDY 62

Query: 60  RGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC 119
            G  H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF 
Sbjct: 63  AGKQHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQ 122

Query: 120 MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           M+    S + L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + 
Sbjct: 123 MMTSLGSLKVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQS 182

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
           S+++AG   S  QAL+ YG  +G AFQL+DD+LDY  + + +GKN+G+D   GKPTLP++
Sbjct: 183 SAILAGATASQEQALQDYGRYIGTAFQLIDDLLDYSADGDTLGKNVGDDLSEGKPTLPLL 242

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
            A + GT  + +  ++ I +G      L+     M +  +L  T   A     KA  +L+
Sbjct: 243 HAMRNGTPEQASLIRTAIEEGN-GRHLLETVLETMNQCGSLEWTRNAAEQEADKAIAALK 301

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            LP+S W+ +L  +    +QR
Sbjct: 302 VLPESPWRSALEALAHMSVQR 322


>gi|77166478|ref|YP_345003.1| trans-hexaprenyltranstransferase [Nitrosococcus oceani ATCC 19707]
 gi|76884792|gb|ABA59473.1| Trans-hexaprenyltranstransferase [Nitrosococcus oceani ATCC 19707]
          Length = 345

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 193/315 (61%), Gaps = 2/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL   DM+ V+ LI +R+ SDV +I  +  Y+I SGGKRLRPM+ L +A    Y+G  H+
Sbjct: 31  DLVADDMQAVDALIQQRLHSDVVLINQLGHYIINSGGKRLRPMVVLLSARAFGYQGSYHI 90

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD S LRRG+  A  +WG++ SVLVGDFL S+AF M++   
Sbjct: 91  DIAAIIEFIHTATLLHDDVVDSSDLRRGRKTANNIWGSEASVLVGDFLYSRAFEMMVGVD 150

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   +E L+    T+AEGE+ QL      D TEE YL +I+SKTA LF AA ++ +++  
Sbjct: 151 SMRVMEILARTTNTIAEGEVMQLLNCHEPDTTEECYLEIIRSKTAKLFEAATQLGAVLCH 210

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             ++  + + +YGM+LG AFQL DDVLDY     ++GKNIG+D   GKPTLP+I A  +G
Sbjct: 211 RPSAEEKLMAAYGMHLGTAFQLTDDVLDYSSFSEDLGKNIGDDLAEGKPTLPLIYAMSKG 270

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           +       ++ I  G    ENL +    +  + A+  T   A     KA  +++ +P S 
Sbjct: 271 STSHVKVIRNAIESG--GRENLAEVIEAIESSGAIAYTAEAARREADKAMQAVKNIPASP 328

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L+ +  F   R
Sbjct: 329 YQEALLNLAKFAAYR 343


>gi|315127756|ref|YP_004069759.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase)(OPP synthetase) [Pseudoalteromonas sp.
           SM9913]
 gi|315016270|gb|ADT69608.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase)(OPP synthetase) [Pseudoalteromonas sp.
           SM9913]
          Length = 323

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM  VN LI  ++ SDV ++  +  Y++ SGGKR+RPML +  A  L Y+
Sbjct: 3   IKAIQALIESDMNDVNQLIHAQMRSDVALVNQLGLYIVNSGGKRVRPMLAILAAKALGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H+ LA  IEFIHTATLLHDDVVD+S LRRG   A   +GN  SVLVGDF+ +++F +
Sbjct: 63  GKDHITLATIIEFIHTATLLHDDVVDESNLRRGTPTANAEFGNAASVLVGDFIYTRSFQL 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++     + ++ L+     +AEGE+ QL    + D TE  Y+ VI SKTA LF AA  ++
Sbjct: 123 MVGLGKMQIMQVLADATNIIAEGEVLQLMNCNDPDTTEASYMQVIYSKTAKLFEAATGLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I    +SV +AL  YGM+LG AFQLVDDVLDY  + +++GKNIG+D   GKPTLP+I 
Sbjct: 183 AIITDQDDSVLEALNLYGMHLGTAFQLVDDVLDYNADADQLGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G++ +    +  I      +E+L +    ++   AL  T  +A     KA   L C
Sbjct: 243 AMQHGSEHQTQLIRDAIEHCN-GMEHLDEILAALKHTNALEFTMKKAEQEANKAIACLDC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L +SS+K++L+ +    + R
Sbjct: 302 LAESSYKQALISLARIAVDR 321


>gi|85712490|ref|ZP_01043538.1| Geranylgeranyl pyrophosphate synthase [Idiomarina baltica OS145]
 gi|85693624|gb|EAQ31574.1| Geranylgeranyl pyrophosphate synthase [Idiomarina baltica OS145]
          Length = 323

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 194/321 (60%), Gaps = 1/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K + DL  KDM+ VN LI +++ SDV +I  +  Y++ SGGKRLRP+L + +   L Y 
Sbjct: 3   LKSINDLAQKDMQGVNALIGEQLSSDVALINQLGMYIVNSGGKRLRPLLAVLSCRALGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H+ LA  IEFIHTATLLHDDVVD+S LRRG+  A  V+GN+ SVLVGDFL ++AF M
Sbjct: 63  GRAHLSLATIIEFIHTATLLHDDVVDESELRRGRKTANAVFGNEASVLVGDFLYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S   L  L+     +AEGE+ QL    + D TE  Y  VI  KTA LF AA +++
Sbjct: 123 MVQLDSMTILSILADATNVIAEGEVLQLMNCNDPDTTEARYFDVIYGKTAKLFEAATQLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++    ++V + L  YG  LG AFQLVDD++DY  +   MGKN G+D   GKPTLP++ 
Sbjct: 183 GVLTEQDSTVTEQLADYGRYLGTAFQLVDDLMDYTSDSQTMGKNAGDDLAEGKPTLPLLY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G +  +   +  I  G    E+L+     M    AL  T  +A    Q+A++SL  
Sbjct: 243 AMWHGDEAARKLIREAIEQGD-GREHLETVLAAMHATGALEYTRQKALEVAQQARESLAV 301

Query: 301 LPDSSWKKSLMEVVDFCLQRL 321
           LP+S +K++L+ +    + R+
Sbjct: 302 LPESDYKQALIALTHLAVDRV 322


>gi|121593262|ref|YP_985158.1| dimethylallyltranstransferase [Acidovorax sp. JS42]
 gi|120605342|gb|ABM41082.1| Dimethylallyltranstransferase [Acidovorax sp. JS42]
          Length = 327

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 192/303 (63%), Gaps = 2/303 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM +V+ +I  R+ S V ++  V +Y+I +GGKRLRP L L T   LEY+G+    
Sbjct: 14  LIADDMREVDKVIAARLQSSVPLVGSVAQYIISAGGKRLRPALLLLTCGALEYKGEQRFN 73

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL +++F M++E  S
Sbjct: 74  LAAVVEFIHTATLLHDDVVDESTLRRGRPTANETFGNPASVLVGDFLHTRSFQMMVEAGS 133

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ L+     +AEGE++QL  + +  + E  YLHVI+SKTA LF A+  +++++AG 
Sbjct: 134 MRILQVLADATNVIAEGEVQQLMNTHDASLDEAGYLHVIRSKTAKLFEASARLAAILAGS 193

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              + QA   YG  LG AFQ++DDVLDY G+  EMGKN+G+D R GK TLP+I+A QRG+
Sbjct: 194 TPDIEQACADYGQALGTAFQVIDDVLDYDGDAQEMGKNLGDDLREGKVTLPLIIAMQRGS 253

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + ++   ++ I  G  S + L+    I+RE  AL  T   A +  + A D+   LP + +
Sbjct: 254 QAQRELLRNVIETG--SADELQPVIAIIRETGALTATRDAAAAQARLAMDAAAKLPANPY 311

Query: 307 KKS 309
            K 
Sbjct: 312 TKG 314


>gi|260596184|ref|YP_003208755.1| octaprenyl-diphosphate synthase [Cronobacter turicensis z3032]
 gi|260215361|emb|CBA27367.1| Octaprenyl-diphosphate synthase [Cronobacter turicensis z3032]
          Length = 323

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 189/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  L Y 
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARALGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GKAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSIKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   +  +AL+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGASEAQERALQDYGRYLGTAFQLIDDLLDYSADGERLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I  G      L      M    +L  T  RA     KA  +L  
Sbjct: 243 AMHNGTPAQAQMIREAIEQGN-GRHLLDPVLETMAACGSLEWTRTRAEEEADKAIAALEI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L  S W+ +L+ +    +QR
Sbjct: 302 LSPSPWRDALIALAHMSVQR 321


>gi|238756420|ref|ZP_04617729.1| Octaprenyl-diphosphate synthase [Yersinia ruckeri ATCC 29473]
 gi|238705350|gb|EEP97758.1| Octaprenyl-diphosphate synthase [Yersinia ruckeri ATCC 29473]
          Length = 323

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 191/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L+Y+G+ H+
Sbjct: 8   ELTAQDMAAVNATILDQLNSDVTLINQLGYYIISGGGKRIRPMIAVLAARALDYQGNKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+   +
Sbjct: 68  KIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ +S     +AEGE+ QL    N D+TE+ Y+ VI SKTA LF AA + SS++A 
Sbjct: 128 SLRVLQLMSEATNVIAEGEVMQLMNCNNPDITEDSYMRVIYSKTARLFEAASQSSSILAD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  A + YG  LG AFQL+DD+LDY  + + +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ASPEQEMAFQDYGRYLGTAFQLIDDLLDYSADGSTLGKNTGDDLNEGKPTLPLLHAMNNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I +G      L+     MR+  +L  T  RA     KA  +L+ LPD+ 
Sbjct: 248 TAEQAAMIRKAIEEGN-GRHLLEPVLEAMRQCGSLDYTRQRAEEEADKAIAALQILPDTP 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L  +    +QR
Sbjct: 307 YRQALEGLAHIAVQR 321


>gi|218708400|ref|YP_002416021.1| octaprenyl-diphosphate synthase [Vibrio splendidus LGP32]
 gi|218321419|emb|CAV17369.1| Octaprenyl-diphosphate synthase [Vibrio splendidus LGP32]
          Length = 323

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L L +A  L Y+G
Sbjct: 4   KAIQTLTANDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLALLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H+  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  EAHITSAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S   LE +S     +AEGE++QL    N D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TTLGSLRILELMSESVNVIAEGEVQQLMNCNNPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      +  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILTESSPEIETAMQNYGKYLGTAFQLIDDVMDYTADGKEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G+  + +  +  I      +E L     +M+E  +L  T  +AY    KA   L  L
Sbjct: 244 MHNGSPDQASMIREAIEKAN-GMERLDDIMSVMKETGSLEYTTNKAYEEADKAIAELSIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L  +    ++R
Sbjct: 303 PESEYKQALTTLAHLAVKR 321


>gi|156935711|ref|YP_001439627.1| hypothetical protein ESA_03580 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533965|gb|ABU78791.1| hypothetical protein ESA_03580 [Cronobacter sakazakii ATCC BAA-894]
          Length = 323

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 189/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV++I  +  Y++  GGKR+RPM+ +  A  L Y 
Sbjct: 3   LEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARALGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GKAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + LE +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   +  +AL+ YG  LG AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 GILAGASEAQERALQDYGRYLGTAFQLIDDLLDYSADGERLGKNVGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I  G      L      M    +L  T  RA     KA  +L  
Sbjct: 243 AMHNGTPAQAQMIREAIEQGN-GRHLLDPVLETMAACGSLEWTRARAEEEADKAIAALEI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L  S W+ +L+ +    +QR
Sbjct: 302 LSPSPWRDALIALAHMSVQR 321


>gi|317046711|ref|YP_004114359.1| polyprenyl synthetase [Pantoea sp. At-9b]
 gi|316948328|gb|ADU67803.1| Polyprenyl synthetase [Pantoea sp. At-9b]
          Length = 323

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 193/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ + +A  L Y+
Sbjct: 3   LEQINELTAQDMAAVNQTILDQLNSDVSLINQLGYYIISGGGKRIRPMIAVLSARALNYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H+  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GSQHITNAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + L  +S     +AEGE+ QL    + D+TEE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSMGSLKILALMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAASQAS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +  +AL+ YG  +G AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAEATPAQEKALQDYGRYIGTAFQLIDDLLDYSADGETLGKNTGDDLSEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I +G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 243 AMHHGTPEQAQMIRRAIEEGN-GRHLLEPVLEAMQQCGSLAWTRQRAEEEADKAIAALKI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ W+ +L  +    +QR
Sbjct: 302 LPETPWRSALEALAHMSVQR 321


>gi|86147820|ref|ZP_01066126.1| octaprenyl-diphosphate synthase [Vibrio sp. MED222]
 gi|85834347|gb|EAQ52499.1| octaprenyl-diphosphate synthase [Vibrio sp. MED222]
          Length = 323

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 194/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L L +A  L Y+G
Sbjct: 4   KAIQTLTANDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLALLSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H+  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  EAHITSAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S   LE +S     +AEGE++QL    N D TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TTLGSLRILELMSESVNVIAEGEVQQLMNCNNPDTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      +  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILTESTPEIETAMQNYGKYLGTAFQLIDDVMDYTADGKEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            + G+  + +  +  I      +E L     +M+E  +L  T  +AY    KA   L  L
Sbjct: 244 MRNGSPDQASMIREAIEKAN-GMERLDDIMSVMKETGSLEYTTNKAYEEADKAIAELSIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L  +    ++R
Sbjct: 303 PESEYKQALTTLAHLAVKR 321


>gi|330823512|ref|YP_004386815.1| trans-hexaprenyltranstransferase [Alicycliphilus denitrificans
           K601]
 gi|329308884|gb|AEB83299.1| Trans-hexaprenyltranstransferase [Alicycliphilus denitrificans
           K601]
          Length = 349

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 135/302 (44%), Positives = 192/302 (63%), Gaps = 2/302 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM +V+ +I  R+ S V ++  V +Y+I +GGKRLRP L L T   LEY+G+    
Sbjct: 36  LIADDMREVDKVIAARLQSSVPLVGSVAQYIISAGGKRLRPALLLLTCGALEYKGEQRFN 95

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL +++F M++E  S
Sbjct: 96  LAAVVEFIHTATLLHDDVVDESTLRRGRPTANEAFGNPASVLVGDFLHTRSFQMMVEAGS 155

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ L+     +AEGE++QL  + +  + E  YLHVI+SKTA LF A+  +++++AG 
Sbjct: 156 MRILQVLADATNVIAEGEVQQLMNTHDASLDEAGYLHVIRSKTAKLFEASARLAAILAGS 215

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              + QA   YG  LG AFQ++DDVLDY G+  EMGKN+G+D R GK TLP+I+A QRG+
Sbjct: 216 TPDIEQACADYGQALGTAFQVIDDVLDYDGDAQEMGKNLGDDLREGKVTLPLIIAMQRGS 275

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + ++   ++ I  G  S + L+    I+RE  AL  T   A +  + A D+   LP + +
Sbjct: 276 QAQRELLRNVIETG--SADELQPVIAIIRETGALTATRDAAAAQARLAMDAAAKLPANPY 333

Query: 307 KK 308
            K
Sbjct: 334 TK 335


>gi|293393170|ref|ZP_06637485.1| octaprenyl-diphosphate synthase [Serratia odorifera DSM 4582]
 gi|291424316|gb|EFE97530.1| octaprenyl-diphosphate synthase [Serratia odorifera DSM 4582]
          Length = 381

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 191/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ S+V +I  +  Y+I  GGKR+RPM+ +  A  L+Y+
Sbjct: 61  LEQITELTAQDMAAVNATILEQLNSEVTLINQLGYYIISGGGKRIRPMIAVLAARALQYQ 120

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 121 GDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 180

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 181 MTSLESLRVLALMSEAVNVIAEGEVLQLMNVHDPDITEESYMRVIYSKTARLFEAAAQSS 240

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++++G   +  Q L+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 241 AILSGATEAQEQGLQDYGRYLGTAFQLIDDLLDYSADGVTLGKNTGDDLNEGKPTLPLLH 300

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G  ++    +  I  G      L+     M +  +L  T  RA     KA  +L  
Sbjct: 301 AMHHGNAQQTAMIRGAIEQGN-GRHLLEPVLTAMEQCGSLSYTRQRAEEEADKAIAALHV 359

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S ++ +L  +    +QR
Sbjct: 360 LPQSPFRDALEGLAHLAVQR 379


>gi|170723659|ref|YP_001751347.1| polyprenyl synthetase [Pseudomonas putida W619]
 gi|169761662|gb|ACA74978.1| Polyprenyl synthetase [Pseudomonas putida W619]
          Length = 322

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 197/312 (63%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   +EE Y+ VI+ KTA+LF A+   ++ +AG  +  
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTSEEVYMEVIRGKTAMLFEASTHSAAALAGATDEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  + +  + AL  T   A  Y ++A + L  LP S ++ +L
Sbjct: 253 ALVRKAIQKG--GLEDLEQIRVAVEASGALDYTAQLARDYVKRAIECLEVLPASQYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|33151879|ref|NP_873232.1| octaprenyl pyrophosphate synthetase [Haemophilus ducreyi 35000HP]
 gi|33148100|gb|AAP95621.1| octaprenyl-diphosphate synthase [Haemophilus ducreyi 35000HP]
          Length = 327

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ V+  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L Y 
Sbjct: 7   LEQIQALAQQDMQAVDQEILAQLNSEVPLINQLGHYIISGGGKRIRPLIAVLAANALCYT 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H+  A  IEF+HTATLLHDDVVD+SALRRG+  A  ++GN  SVLVGDF+ +++F M
Sbjct: 67  GRKHLTCAAFIEFVHTATLLHDDVVDESALRRGRETANAIFGNAASVLVGDFIYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S E L+ +S     LAEGE++QL    +   TE +Y+ VI +KTA LF AA +  
Sbjct: 127 MTSVDSLEVLKVMSAATNALAEGEVQQLMNINDPHTTEANYMRVIYNKTARLFEAATQCV 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG    + QALK+YG  LG AFQLVDD+LDY  +  + GKN+G+DF  GKPTLP++ 
Sbjct: 187 AIVAGASQQIEQALKAYGCYLGTAFQLVDDILDYSAKAEQFGKNVGDDFVEGKPTLPLLH 246

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q   + + +  +  I  G    + +     IM E+++L     RA    QKA  +L  
Sbjct: 247 ALQHANEAQASMIREAIEHGGERAK-IPMVLAIMAEHKSLEYAMARAKQEAQKAVAALDI 305

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L D+ +KK+L+ +    + R
Sbjct: 306 LADTEYKKALISLAYLSVDR 325


>gi|319761641|ref|YP_004125578.1| polyprenyl synthetase [Alicycliphilus denitrificans BC]
 gi|317116202|gb|ADU98690.1| Polyprenyl synthetase [Alicycliphilus denitrificans BC]
          Length = 349

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 192/303 (63%), Gaps = 2/303 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM +V+ +I  R+ S V ++  V +Y+I +GGKRLRP L L T   LEY+G+    
Sbjct: 36  LIADDMREVDKVIAARLQSSVPLVGSVAQYIISAGGKRLRPALLLLTCGALEYKGEQRFN 95

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL +++F M++E  S
Sbjct: 96  LAAVVEFIHTATLLHDDVVDESTLRRGRPTANEAFGNPASVLVGDFLHTRSFQMMVEAGS 155

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ L+     +AEGE++QL  + +  + E  YLHVI+SKTA LF A+  +++++AG 
Sbjct: 156 MRILQVLADATNVIAEGEVQQLMNTHDASLDEAGYLHVIRSKTAKLFEASARLAAILAGS 215

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              + QA   YG  LG AFQ++DDVLDY G+  EMGKN+G+D R GK TLP+I+A QRG+
Sbjct: 216 TPDIEQACADYGQALGTAFQVIDDVLDYDGDAQEMGKNLGDDLREGKVTLPLIIAMQRGS 275

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           + ++   ++ I  G  S + L+    I+RE  AL  T   A +  + A D+   LP + +
Sbjct: 276 QAQRELLRNVIETG--SADELQPVIAIIRETGALTATRDAAAAQARLAMDAAAKLPANPY 333

Query: 307 KKS 309
            K 
Sbjct: 334 TKG 336


>gi|269964673|ref|ZP_06178911.1| octaprenyl-diphosphate synthase [Vibrio alginolyticus 40B]
 gi|269830572|gb|EEZ84793.1| octaprenyl-diphosphate synthase [Vibrio alginolyticus 40B]
          Length = 323

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 195/319 (61%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF +A ++ +
Sbjct: 124 TELGSMKILKLMSNAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFESATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPEHVEIAMQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +  T       +  I      ++ L++   +M+E  +L  T  +A     KA   L  L
Sbjct: 244 MRNTTPENAIMIREAIEKAN-GMDRLEEILAVMKEAGSLEYTTQKALEEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    +QR
Sbjct: 303 PESEYKQALVTLAHVAVQR 321


>gi|262392448|ref|YP_003284302.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio sp.
           Ex25]
 gi|262336042|gb|ACY49837.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio sp.
           Ex25]
          Length = 323

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 195/319 (61%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF +A ++ +
Sbjct: 124 TELGSMKILKLMSNAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFESATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPEHVEIAMQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +  T       +  I      ++ L+    +M+E  +L  T  +A     KA + L  L
Sbjct: 244 MRNTTPDNALMIREAIEKAN-GMDRLEDILAVMKEAGSLEYTTQKALEEADKAIEELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    +QR
Sbjct: 303 PESEYKQALITLAHVAVQR 321


>gi|30249867|ref|NP_841937.1| polyprenyl synthetase [Nitrosomonas europaea ATCC 19718]
 gi|30180904|emb|CAD85826.1| Polyprenyl synthetase [Nitrosomonas europaea ATCC 19718]
          Length = 322

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 204/321 (63%), Gaps = 4/321 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + ++  KDM +V+ +I +++ S V ++  V +Y+I SGGKRLRP L +  A + +Y+
Sbjct: 3   IESIRNVIAKDMGEVDNVIQQKLHSQVALVRQVSEYIIHSGGKRLRPALVILAAGLFDYK 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H  LA  +EFIHTATLLHDDVVD+S LRR +  A  ++GN  SVLVGDFL S+AF M
Sbjct: 63  GLHHHNLAAVVEFIHTATLLHDDVVDESELRRNQATANALFGNAASVLVGDFLYSRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  +   +E L+    T+AEGE+ QL   ++ DV EE+YL VI+ KTA LF AA  + 
Sbjct: 123 MVEVGNMRVMEVLADATNTIAEGEVLQLLNCRDPDVEEENYLQVIRFKTAKLFEAAARLG 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++ G   +  +AL +YGM+LG AFQLVDD+LDY G   + GKN+G+D   GKPTLP+I 
Sbjct: 183 AILGGATPAEEEALAAYGMHLGTAFQLVDDLLDYSGNDQDTGKNLGDDLAEGKPTLPLIF 242

Query: 241 AFQRGTKREKNFWKSTI-NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
           A + G   + +  +  I   GK   E + K   I++E+ AL   +  A +    A  ++ 
Sbjct: 243 AMRSGIPEQVDTVRHAIETGGKDGFEPILK---IIQESGALDYAKQCAQNEANMAISAIT 299

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            + DS +K+ L+E+ +F + R
Sbjct: 300 AIRDSIYKQCLLELAEFAITR 320


>gi|294634497|ref|ZP_06713032.1| octaprenyl-diphosphate synthase [Edwardsiella tarda ATCC 23685]
 gi|291092011|gb|EFE24572.1| octaprenyl-diphosphate synthase [Edwardsiella tarda ATCC 23685]
          Length = 323

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 192/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEKITELTAQDMADVNAKILHQLNSDVTLINQLGYYIISGGGKRIRPMIAVLAARALHYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDRHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   LE +S     +AEGE+ QL    + D++EE+Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLQSLRILELMSAATNVIAEGEVMQLMNVNDPDISEENYMQVIYSKTARLFEAAAQCS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG       AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAGADTHQELALQDYGRYLGTAFQLIDDLLDYDADGATLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G+       +  I  G      L      M++  +L  T  RA     KA  +L  
Sbjct: 243 AMRHGSPERSAMIRQAIEQGN-GRHLLDPVLETMQQVGSLDYTRRRAEEEADKAIAALAV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L DS +K++L+ + +  + R
Sbjct: 302 LDDSPYKQALIGLANLSVNR 321


>gi|332308087|ref|YP_004435938.1| Polyprenyl synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175416|gb|AEE24670.1| Polyprenyl synthetase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 323

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 197/315 (62%), Gaps = 1/315 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LI K++ SDV +I  +  Y++ SGGKRLRP+LT+  A  L  + + H  
Sbjct: 9   LAEPDMLAVNQLIQKQVNSDVSLINQLGFYIVNSGGKRLRPLLTVLAARALNIQTEQHHT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IEFIHTATLLHDDVVD+S +RRG+  A  V+GNQ SVLVGDFL +++F M++   S
Sbjct: 69  LAAIIEFIHTATLLHDDVVDESTMRRGRETANEVFGNQASVLVGDFLYTRSFQMMVTLDS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              ++ LS     +AEGE+ QL    + + TEE Y+ VI SKTA LF AA  +++++   
Sbjct: 129 MRVMQILSDATNVIAEGEVLQLMNCNDPNTTEESYMEVIYSKTARLFEAATLLAAVLTKQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             ++  A++ YG  LG AFQLVDD++DY  +  +MGKN+G+D   GKPTLP++ A   G 
Sbjct: 189 SEAIENAMQDYGKYLGTAFQLVDDIMDYASDSEDMGKNMGDDLAEGKPTLPLLYAMWHGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           +++    +  I  G   ++NL      M +  AL  T+++A    Q+A D+L  +P+S +
Sbjct: 249 EQQAAMIREAIESGN-GMDNLTLILEAMEQTNALGYTKHQALKASQQAVDALAPIPESHY 307

Query: 307 KKSLMEVVDFCLQRL 321
           K++L+ +    ++R+
Sbjct: 308 KQALIGLAHVAVERV 322


>gi|301154821|emb|CBW14284.1| octaprenyl diphosphate synthase [Haemophilus parainfluenzae T3T1]
          Length = 331

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  ++ LT  DM+KVN  IL +I SDV M+  +  Y++  GGKR+RP++ +  A  L Y 
Sbjct: 11  MHAIQALTDADMQKVNQAILAQINSDVPMVNQLGFYIVQGGGKRIRPLIAVLAARALGYE 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D     A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 71  SDKVATCATFVEFIHTASLLHDDVVDESDMRRGRATANSAFGNAASVLVGDFIYTRAFQL 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           V + +S + L  ++     LAEGE++QL    + D TEE Y+ VI SKTA LF  A +  
Sbjct: 131 VAQLQSLDILRIMADATNVLAEGEVQQLMNVNDPDTTEESYMRVIYSKTARLFEVAAQSV 190

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG + S+  A + YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ 
Sbjct: 191 AIVAGAEKSIETAFQEYGRYLGTAFQLVDDVLDYSANAAALGKNVGDDLAEGKPTLPLLH 250

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G  ++    +  I  G    + + +   IM E+++L     RA    QKA D+++ 
Sbjct: 251 AMRHGNPQQAALIREAIEQGG-KRDAIDEVLAIMAEHKSLDYAMDRAKQEAQKAVDAIQI 309

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 310 LPESEYKQALISLAYLSVSR 329


>gi|238898823|ref|YP_002924505.1| octaprenyl diphosphate synthase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229466582|gb|ACQ68356.1| octaprenyl diphosphate synthase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 310

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 196/309 (63%), Gaps = 1/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M  +N +I+ ++ SD+E++  +  Y+I  GGKR+RPM+++ +A  L Y+GD H+++A  I
Sbjct: 1   MAALNVIIIDQMHSDIELVNQLSAYIINGGGKRIRPMISILSARALNYKGDQHIIVAALI 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD S LRRGK  A  V+GN  SVLVGDF+ ++AF M+ +  S   L+
Sbjct: 61  EFIHTATLLHDDVVDKSDLRRGKKTANTVFGNSASVLVGDFIYTRAFQMMTDLGSMRILK 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            +S     ++EGE++QL    N+++TE DY+ VI SKTA LF AA + ++++A       
Sbjct: 121 VMSSATNVISEGEVQQLMYCNNVNITEYDYMKVIYSKTARLFEAASQSAAILAKASPEQE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
            AL+SYG  LG  +QL+DD+LDY  + N  GK+IG+D   GK TLP++ A   GT+ +K 
Sbjct: 181 SALQSYGCYLGTTYQLIDDLLDYNSKGNLFGKDIGDDLDEGKATLPLLHAMHHGTEEQKQ 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
                I  G  + ++L +   IM++  +L  T  RA     KA  +L+ LP +S++ +L 
Sbjct: 241 MISFAIKRGN-ARQSLPQILNIMKQCGSLGYTLNRAKEEANKAISALQILPKNSYRTALE 299

Query: 312 EVVDFCLQR 320
            +  F ++R
Sbjct: 300 SLAYFAVKR 308


>gi|315181275|gb|ADT88189.1| octaprenyl-diphosphate synthase [Vibrio furnissii NCTC 11218]
          Length = 396

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 191/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 77  KAIQTLTANDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAVLSAKALGYQG 136

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
             H L A  IEF HTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+
Sbjct: 137 QGHTLAAAFIEFTHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMM 196

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 197 VELGSMKILQLMSEAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 256

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++A     +  AL++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 257 ILADASPEIETALQNYGKYLGTAFQLIDDVMDYTADGKEMGKNVGDDLAEGKPTLPLLYA 316

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            + G   +    +  I      +  L +    M+E  +L  T  +A     KA   L  L
Sbjct: 317 MRHGNAEQAAMIREAIEQAN-GMARLDEILAAMKETGSLEYTVAKANEEADKAITELAIL 375

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 376 PESDYKQALIALAHMAVNR 394


>gi|163749221|ref|ZP_02156471.1| octaprenyl-diphosphate synthase [Shewanella benthica KT99]
 gi|161331291|gb|EDQ02180.1| octaprenyl-diphosphate synthase [Shewanella benthica KT99]
          Length = 323

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 196/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  +  L   DM+ VN LI  ++ SDV +I  +  Y+I  GGKR+RP+L++  A  ++Y+
Sbjct: 3   LNAIRQLADSDMQDVNKLIYAQLESDVALINQLGFYIINGGGKRMRPLLSILAARAIDYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H+ LA  +EFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 63  GVAHLKLAAIVEFIHTASLLHDDVVDESMLRRGRDTANALFGNSASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E  S + L+ L+     LAEGE+ QL    + D +EE Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELGSMKVLKMLADATNVLAEGEVLQLMNCNDPDTSEESYMRVIYCKTAKLFEAATRLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A     ++ AL  YG  LG AFQL DD+LDY     E+GKNIG+D   GKPTLP+I 
Sbjct: 183 GVLADSPIEIQTALADYGKYLGTAFQLTDDLLDYTANTEELGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT++E+   +  +  G    +N+++  + +    AL  T  RA     KA  +L C
Sbjct: 243 AIAHGTEKEQALIRKAVELGD-GTQNIEEILVALNNCGALKYTHDRALEESDKAVAALAC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           +PDS +K++L+ +    ++R
Sbjct: 302 IPDSEYKQALISLAKIAVER 321


>gi|332289056|ref|YP_004419908.1| octaprenyl diphosphate synthase [Gallibacterium anatis UMN179]
 gi|330431952|gb|AEC17011.1| octaprenyl diphosphate synthase [Gallibacterium anatis UMN179]
          Length = 323

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 199/317 (62%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L+ KDM+ VN +I +++ SDV +I  +  Y+I  GGKR+RP++ +  A  L Y+GD 
Sbjct: 6   IQALSAKDMQAVNAMISQQLQSDVALINQLSFYIINGGGKRIRPLIAVLVANALNYQGDR 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+  A  IEFIHTATLLHDDVVD+S LRRGK  A  ++GN  SVLVGDF+ ++AF ++  
Sbjct: 66  HITCATFIEFIHTATLLHDDVVDESTLRRGKDTANAIFGNAASVLVGDFIYTRAFQLMAR 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S   ++ +S     +A GE+ QL    + D TE+ Y+ VI SKTA LF  A E S+L+
Sbjct: 126 LGSLPVMQVMSDAVNVIAAGEVLQLMNCNDPDTTEQSYMQVIYSKTARLFEVAAECSALL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           +       QA+K YG  LG AFQL+DDVLDY  +V+++GKN+G+D   GKPTLP++ A Q
Sbjct: 186 SEATEQQVQAMKLYGRYLGTAFQLIDDVLDYCADVDKLGKNLGDDLEEGKPTLPLLHAMQ 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
             ++ E+   +S I  G    + L +   +M + ++L  T  +A    QKA DSL  + D
Sbjct: 246 HASEDERQLIRSIIEHGH-GRKYLAEVQAMMDKYQSLTYTIEKAKQEAQKAIDSLSVIDD 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           + +K++L+ +    ++R
Sbjct: 305 NPYKEALISLAKISVER 321


>gi|332526525|ref|ZP_08402637.1| dimethylallyltransferase [Rubrivivax benzoatilyticus JA2]
 gi|332110793|gb|EGJ10970.1| dimethylallyltransferase [Rubrivivax benzoatilyticus JA2]
          Length = 313

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 130/311 (41%), Positives = 195/311 (62%), Gaps = 5/311 (1%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M +V+ ++  R+ S V +I  +  Y+I +GGKR+RP L L  +  L +RG     LA  +
Sbjct: 5   MRQVDAVLRARLSSKVALIDQIASYIISAGGKRMRPRLLLLFSEALGFRGPERYELAAVV 64

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E IHT+TLLHDDVVD+S+LRRG+  A  ++GN  +VLVGDFL S++F M++  KS   LE
Sbjct: 65  ELIHTSTLLHDDVVDESSLRRGRATANSMFGNAAAVLVGDFLYSRSFQMMVSVKSMRVLE 124

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            L+     +AEGE+ QL    + D+  ++YL VI+ KTA LF A+  + +++AG    V 
Sbjct: 125 VLAEATNVIAEGEVLQLMNMHDADLAVDEYLRVIRFKTAKLFEASARLGAVLAGASAEVE 184

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +A   YG +LG AFQLVDD+LDY G  +E+GKN+G+D R GKPTLP+++A +RGT  E+ 
Sbjct: 185 EACADYGRSLGTAFQLVDDLLDYEGNASELGKNVGDDLREGKPTLPLLIAMERGTAEERE 244

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G++  E L++   I+R   AL  T   A +    A+ +L  LP S  +++L+
Sbjct: 245 LIRHAIEHGEL--ERLQQIIDIVRRTGALEATREAAQAQADIARATLELLPVSKAREALL 302

Query: 312 EVVDFCLQRLN 322
           E   FC + ++
Sbjct: 303 E---FCFRAVH 310


>gi|238750110|ref|ZP_04611613.1| Octaprenyl-diphosphate synthase [Yersinia rohdei ATCC 43380]
 gi|238711654|gb|EEQ03869.1| Octaprenyl-diphosphate synthase [Yersinia rohdei ATCC 43380]
          Length = 323

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/316 (41%), Positives = 194/316 (61%), Gaps = 1/316 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G+ H+
Sbjct: 8   ELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAILVARALNYQGNKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + ++++A 
Sbjct: 128 SLRVLTLMSDATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLAN 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A + G
Sbjct: 188 ASEEQEVALQNYGRYLGTAFQLIDDLLDYSSDGVTLGKNTGDDLNEGKPTLPLLHAMRNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I  G      L+     M++ ++L  T  RA +   KA  SL+ LP+S+
Sbjct: 248 TPEQAAMIRQAIEQGN-GRHLLEPVLFAMQQCKSLDYTRQRAEAEADKAIASLQILPESN 306

Query: 306 WKKSLMEVVDFCLQRL 321
           ++++L  +    +QR+
Sbjct: 307 YRQALEGLAHIAVQRV 322


>gi|325577651|ref|ZP_08147926.1| octaprenyl-diphosphate synthase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160396|gb|EGC72522.1| octaprenyl-diphosphate synthase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 331

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  ++ LT  DM+KVN  IL +I SDV M+  +  Y++  GGKR+RP++ +  A  L Y 
Sbjct: 11  MHAIQALTDADMQKVNQAILAQINSDVPMVNQLGFYIVQGGGKRIRPLIAVLAARALGYE 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D     A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 71  SDKVATCATFVEFIHTASLLHDDVVDESDMRRGRATANSAFGNAASVLVGDFIYTRAFQL 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           V + +S + L  ++     LAEGE++QL    + D TEE Y+ VI SKTA LF  A +  
Sbjct: 131 VAQLQSLDILRIMADATNVLAEGEVQQLMNVNDPDTTEESYMRVIYSKTARLFEVAAQSV 190

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG + S+  A + YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ 
Sbjct: 191 AIVAGAEKSIETAFQEYGRYLGTAFQLVDDVLDYSANAAALGKNVGDDLAEGKPTLPLLH 250

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G  ++    +  I  G    + + +   IM E+++L     RA    QKA D+++ 
Sbjct: 251 AMRHGNPQQAALIREAIEQGG-KRDAIDEVLAIMAEHKSLDYAMDRAKQEAQKAIDAIQI 309

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 310 LPESEYKQALISLAYLSVSR 329


>gi|170725365|ref|YP_001759391.1| polyprenyl synthetase [Shewanella woodyi ATCC 51908]
 gi|169810712|gb|ACA85296.1| Polyprenyl synthetase [Shewanella woodyi ATCC 51908]
          Length = 323

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  +  L   DM+ VN LI K++ SDV +I  +  Y+I  GGKR+RP+L++  A  ++Y 
Sbjct: 3   LNAIRQLADNDMQNVNKLIYKQLESDVALINQLGFYIINGGGKRMRPLLSILAARAVDYN 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+ H+ LA  IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 63  GEAHLKLAAIIEFIHTASLLHDDVVDESMLRRGRETANALFGNSASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E  S E LE L+     LAEGE+ QL    + + TEE Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELGSMEVLEVLADATNVLAEGEVLQLMNCNDPNTTEESYMRVIYCKTAKLFEAATRLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A     ++ AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I 
Sbjct: 183 GVLADSPKEIQVALADYGKYLGTAFQLTDDLLDYTADTEELGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G++ E+   ++ I  G    +++      +    AL  T  RA    +KA  +L  
Sbjct: 243 AIAHGSETEQTLIRTAIEKGD-GTDSIDPILAALDNCGALEYTYKRAQEEAEKAIGALSI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 302 LPESDYKQALISLAKIAVAR 321


>gi|156973119|ref|YP_001444026.1| octaprenyl-diphosphate synthase [Vibrio harveyi ATCC BAA-1116]
 gi|156524713|gb|ABU69799.1| hypothetical protein VIBHAR_00798 [Vibrio harveyi ATCC BAA-1116]
          Length = 323

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 195/319 (61%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF +A ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFESATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++     +V  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPENVEVALQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +  T       +  I      ++ L+    +M+E  +L  T  +A     KA   L  L
Sbjct: 244 MRNTTPENTAMIREAIEKAN-GMDRLEDILAVMQEAGSLEYTTQKALEEADKAIAELSVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 303 PESDYKQALVTLAHMAVKR 321


>gi|238787578|ref|ZP_04631376.1| Octaprenyl-diphosphate synthase [Yersinia frederiksenii ATCC 33641]
 gi|238724365|gb|EEQ16007.1| Octaprenyl-diphosphate synthase [Yersinia frederiksenii ATCC 33641]
          Length = 323

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 190/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G+ H+
Sbjct: 8   ELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALNYQGNKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  ++     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + ++++A 
Sbjct: 128 SLRVLTLMAAATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLAD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ASEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I  G      L+   + M++  +L  T  RA     KA  SL+ LPDS 
Sbjct: 248 TPEQTAMIRQAIEQGN-GRHLLEPVLLAMQQCGSLDYTRQRAEEEADKAIASLQILPDSD 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L  +    +QR
Sbjct: 307 YRQALEGLAHIAVQR 321


>gi|28897101|ref|NP_796706.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28805310|dbj|BAC58590.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 333

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 14  KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYQG 73

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
             H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 74  TGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 133

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF +A ++ +
Sbjct: 134 TELGSMKILQLMSNAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFESATQIGA 193

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 194 ILNDAPEHVELALQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 253

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +  T       +  I      +E L +   +M+E  +L  T  +A     KA   L  L
Sbjct: 254 MRNTTPENALMIREAIEKAN-GMERLDEILAVMKEAGSLEYTTQKALEEADKAIAELEVL 312

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 313 PESEYKEALITLAHVAVKR 331


>gi|322831197|ref|YP_004211224.1| Polyprenyl synthetase [Rahnella sp. Y9602]
 gi|321166398|gb|ADW72097.1| Polyprenyl synthetase [Rahnella sp. Y9602]
          Length = 323

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 190/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DLT  DM  VN  IL+++ S+V +I  +  Y+I  GGKR+RPM+ +  A  L Y+GD H+
Sbjct: 8   DLTQDDMAAVNASILEQLNSEVSLINQLGYYIISGGGKRIRPMIAVLAAKALSYQGDKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+ + +
Sbjct: 68  KVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTDLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  ++     +AEGE++QL    + D+TE  Y+ VI SKTA LF AA + S+++AG
Sbjct: 128 SLPVLALMAKAVNVIAEGEVQQLINCNDPDITEASYMQVIYSKTARLFEAASQASAMLAG 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
             N    AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A Q G
Sbjct: 188 GNNEQITALQDYGRYLGTAFQLIDDLLDYDADGETLGKNTGDDLDEGKPTLPLLHAMQHG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
              +    +  I +G      L+     M +  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 DAEQSAMIRKAIEEGN-GRHLLEPVLAAMHQWGSLAYTRQRAEEEADKAIQALQVLPESE 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    ++R
Sbjct: 307 YRSALEGLAHMSVKR 321


>gi|260878015|ref|ZP_05890370.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus AN-5034]
 gi|260896382|ref|ZP_05904878.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus Peru-466]
 gi|308085175|gb|EFO34870.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus Peru-466]
 gi|308090006|gb|EFO39701.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus AN-5034]
 gi|328471899|gb|EGF42776.1| octaprenyl-diphosphate synthase [Vibrio parahaemolyticus 10329]
          Length = 323

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
             H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  TGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF +A ++ +
Sbjct: 124 TELGSMKILQLMSNAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFESATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPEHVELALQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +  T       +  I      +E L +   +M+E  +L  T  +A     KA   L  L
Sbjct: 244 MRNTTPENALMIREAIEKAN-GMERLDEILAVMKEAGSLEYTTQKALEEADKAIAELEVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 303 PESEYKEALITLAHVAVKR 321


>gi|26987423|ref|NP_742848.1| polyprenyl synthetase [Pseudomonas putida KT2440]
 gi|24982082|gb|AAN66312.1|AE016259_10 octylprenyl diphosphate synthase [Pseudomonas putida KT2440]
          Length = 322

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 196/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +A   +  
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTTEEVYMEVIRGKTAMLFEASTHSAAALAQATDEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTLPLIYTMREGTAEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  + + E+ AL  T   A  Y ++A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLEQIRVAVEESGALKYTAELARDYVKRAIACLEVLPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|313497049|gb|ADR58415.1| IspB [Pseudomonas putida BIRD-1]
          Length = 322

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 196/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +A   +  
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTTEEVYMEVIRGKTAMLFEASTHSAAALAQATDEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTLPLIYTMREGTTEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  + + E+ AL  T   A  Y ++A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLEQIRVAVEESGALKYTAELARDYVKRAIACLEVLPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|328676037|gb|AEB28712.1| Octaprenyl-diphosphate synthase / Dimethylallyltransferase /
           Geranyltranstransferase (farnesyldiphosphate synthase) /
           Geranylgeranyl pyrophosphate synthetase [Francisella cf.
           novicida 3523]
          Length = 325

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 202/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIIDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EEDY+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEDYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIAGVQNS---VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+  + S    +  +++YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQSYAKYQDNIRNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I       ++++   K  I +G+ +++ +    I M +N   VD  Y+ A  Y   AK 
Sbjct: 244 TIYTLANVNQQQQQILKKAIENGEYAIDEI----IAMVKNSGAVDYSYKIACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  ++R N
Sbjct: 300 QIDFLPDSEYKQAMILLCDLAVKRKN 325


>gi|259907026|ref|YP_002647382.1| Octaprenyl diphosphate synthase [Erwinia pyrifoliae Ep1/96]
 gi|224962648|emb|CAX54103.1| Octaprenyl diphosphate synthase [Erwinia pyrifoliae Ep1/96]
 gi|283476821|emb|CAY72659.1| octaprenyl diphosphate synthase [Erwinia pyrifoliae DSM 12163]
          Length = 324

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 193/321 (60%), Gaps = 2/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLT-LATALMLEY 59
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+  LA   + +Y
Sbjct: 3   LEQINELTAQDMADVNATILDQLNSDVSLINQLGYYIINGGGKRIRPMIAVLAARAINDY 62

Query: 60  RGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC 119
            G  H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF 
Sbjct: 63  AGKQHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQ 122

Query: 120 MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           M+    S + L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + 
Sbjct: 123 MMTSLGSLKVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQS 182

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
           S+++AG   +  QAL+ YG  +G AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++
Sbjct: 183 SAILAGASEAEEQALQDYGRYIGTAFQLIDDLLDYSADGETLGKNVGDDLSEGKPTLPLL 242

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
            A + GT  + +  +S I +G      L+     M +  +L  T   A     KA  +L 
Sbjct: 243 HAMRNGTPEQASMIRSAIEEGN-GRHLLESVLETMNQCGSLGWTRNAAEKEADKAIAALE 301

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            LP S W+ +L  +    +QR
Sbjct: 302 VLPKSPWRTALEALAHMSVQR 322


>gi|297580574|ref|ZP_06942500.1| octaprenyl-diphosphate synthase [Vibrio cholerae RC385]
 gi|297534990|gb|EFH73825.1| octaprenyl-diphosphate synthase [Vibrio cholerae RC385]
          Length = 348

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 29  KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 88

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 89  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 148

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 149 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 208

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 209 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 268

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 269 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKALHEADKAIAELAAL 327

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 328 PESEYKQALITLAHMAVNR 346


>gi|148545964|ref|YP_001266066.1| polyprenyl synthetase [Pseudomonas putida F1]
 gi|148510022|gb|ABQ76882.1| Polyprenyl synthetase [Pseudomonas putida F1]
          Length = 322

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 196/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +A   +  
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTTEEVYMEVIRGKTAMLFEASTHSAAALAQATDEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTLPLIYTMREGTAEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  + + E+ AL  T   A  Y ++A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLEQIRVAVEESGALHYTAELARDYVKRAIACLEVLPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|229525127|ref|ZP_04414532.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae bv. albensis VL426]
 gi|229338708|gb|EEO03725.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae bv. albensis VL426]
 gi|327483290|gb|AEA77697.1| Octaprenyl-diphosphate synthase [Vibrio cholerae LMA3894-4]
          Length = 323

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 244 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKALHEADKAIAELAVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 303 PESEYKQALITLAHMAVNR 321


>gi|167031734|ref|YP_001666965.1| polyprenyl synthetase [Pseudomonas putida GB-1]
 gi|166858222|gb|ABY96629.1| Polyprenyl synthetase [Pseudomonas putida GB-1]
          Length = 322

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 196/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +A   +  
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTTEEVYMEVIRGKTAMLFEASTHSAAALAEATDEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTLPLIYTMREGTAEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  + + E+ AL  T   A  Y ++A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLEQIRVAVEESGALKYTAELARDYVKRAIACLEVLPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|127511802|ref|YP_001092999.1| trans-hexaprenyltranstransferase [Shewanella loihica PV-4]
 gi|126637097|gb|ABO22740.1| Trans-hexaprenyltranstransferase [Shewanella loihica PV-4]
          Length = 323

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 191/310 (61%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ LI K++ SDV +I  +  Y+I  GGKR+RP+L++  A  + Y G+ H+ LA  
Sbjct: 13  DMKAVDQLIYKQLESDVALINQLGFYIINGGGKRMRPLLSILAARAIAYEGEAHLKLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E KS E L
Sbjct: 73  VEFIHTASLLHDDVVDESMLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELKSMEVL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E L+     LAEGE+ QL    + D +EE Y+ VI  KTA LF AA  ++ ++A     V
Sbjct: 133 EVLADATNVLAEGEVLQLMNCNDPDTSEESYMRVIYCKTAKLFEAATRLAGVLAESSIEV 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           + AL  YG  LG AFQL DD+LDY  +   +GKNIG+D   GKPTLP+I A   G + E+
Sbjct: 193 QTALADYGKYLGTAFQLTDDLLDYTADTEALGKNIGDDLAEGKPTLPLIYAIANGNELER 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    E++      +++  AL  TE RA    +KA  +L  +PDS +K++L
Sbjct: 253 QLIRDAIEKGD-GTEHIDTILNALKQCGALDYTEKRAREEAEKAIRALDLIPDSDYKQAL 311

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 312 ISLARIAVAR 321


>gi|229507073|ref|ZP_04396579.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae BX 330286]
 gi|229508772|ref|ZP_04398264.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae B33]
 gi|229519759|ref|ZP_04409202.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae RC9]
 gi|229519996|ref|ZP_04409425.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae TM 11079-80]
 gi|229530278|ref|ZP_04419666.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae 12129(1)]
 gi|229606271|ref|YP_002876919.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae MJ-1236]
 gi|255743817|ref|ZP_05417774.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholera CIRS 101]
 gi|262167602|ref|ZP_06035306.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae RC27]
 gi|229332051|gb|EEN97539.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae 12129(1)]
 gi|229342945|gb|EEO07934.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae TM 11079-80]
 gi|229344448|gb|EEO09423.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae RC9]
 gi|229354175|gb|EEO19106.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae B33]
 gi|229355818|gb|EEO20738.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae BX 330286]
 gi|229368926|gb|ACQ59349.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae MJ-1236]
 gi|255738566|gb|EET93954.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholera CIRS 101]
 gi|262023938|gb|EEY42635.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae RC27]
          Length = 323

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 244 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKALHEADKAIAELAIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 303 PESEYKQALITLAHMAVNR 321


>gi|262275074|ref|ZP_06052885.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Grimontia
           hollisae CIP 101886]
 gi|262221637|gb|EEY72951.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Grimontia
           hollisae CIP 101886]
          Length = 323

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 193/317 (60%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ LT  DM KV+  IL ++ SDV +I  +  Y++  GGKRLRPML + +   L Y+G+ 
Sbjct: 6   IQALTADDMAKVDQKILAQLNSDVALINQLGFYIVSGGGKRLRPMLAVLSGRALGYQGEG 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+  A  IEFIHTATLLHDDVVD+S LRRGK  A  ++GN  SVLVGD++ +++F M+ E
Sbjct: 66  HITAAAFIEFIHTATLLHDDVVDESDLRRGKATANAMFGNAASVLVGDYIYTRSFQMMTE 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S   L+ +S     +AEGE+ QL    + + TEE Y+ VI SKTA LF AA ++ +++
Sbjct: 126 LRSLRILDLMSKATNVIAEGEVLQLMNCNDPNTTEESYMQVIYSKTARLFEAATQIGAIL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A     +  A++ YG  LG AFQL+DDV+DY  + +EMGKN G+D   GKPTLP++ A  
Sbjct: 186 ADASEEIETAMQDYGRYLGTAFQLIDDVMDYTSQGDEMGKNTGDDLAEGKPTLPLLHAMA 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            GT  +    +  I  G   ++ L +    M    +L  T  RA     KA ++L  +P+
Sbjct: 246 NGTPEQAAMIREAIEQGN-GLDKLAQILACMEACGSLEYTRQRAEDEADKAINALAPIPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L  +    ++R
Sbjct: 305 SEYKEALKALAHIAVRR 321


>gi|167856324|ref|ZP_02479054.1| octaprenyl-diphosphate synthase [Haemophilus parasuis 29755]
 gi|167852554|gb|EDS23838.1| octaprenyl-diphosphate synthase [Haemophilus parasuis 29755]
          Length = 327

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 195/314 (62%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM+ V+  IL ++ SDV +I  +  Y+I  GGKR+RP++ +  A  + Y+G  H+ 
Sbjct: 13  LVKADMQAVDQAILAQLNSDVVLINQLGHYIISGGGKRIRPLIAVLAANTVGYKGQEHIT 72

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
            A  +EFIHTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF M+   +S
Sbjct: 73  CAAFVEFIHTATLLHDDVVDESDMRRGRETANARFGNAASVLVGDFIYTRAFQMMASLRS 132

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ +S     +AEGE++QL    + + TE +Y+ VI SKTA LF AA + S++++G 
Sbjct: 133 LDVLQVMSDATNVIAEGEVQQLMNVNDPETTEANYMQVIYSKTARLFEAASQCSAIVSGA 192

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A++ YG  LG AFQLVDD+LDY     ++GKNIG+D   GKPTLP++ A + G 
Sbjct: 193 DQATVIAMRDYGRYLGTAFQLVDDILDYSANAEQLGKNIGDDLAEGKPTLPLLHAMRSGN 252

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           +++    +  I  G    E L +   IM E+++L  T  RA    QKA D++  LP+S +
Sbjct: 253 RQQAALIREAIEQGG-KREALDEILAIMAEHKSLDYTMERAKQEAQKAVDAIAILPESEY 311

Query: 307 KKSLMEVVDFCLQR 320
           K++L+ +    + R
Sbjct: 312 KQALISLAYLSVDR 325


>gi|329297304|ref|ZP_08254640.1| polyprenyl synthetase [Plautia stali symbiont]
          Length = 323

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 191/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGK +RPM+ + +A  L Y+
Sbjct: 3   LEQINELTAQDMAAVNQTILDQLNSDVSLINQLGYYIISGGGKHIRPMIAVLSARALNYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GSLHVTNAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S + L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSMGSLKILALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAASQAS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +  +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAEATPAQEKALQDYGRYLGTAFQLIDDLLDYSADGETLGKNTGDDLSEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT  +    +  I +G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 243 AMHNGTPEQAQMIRKAIEEGN-GRHLLEPVLAAMQQTGSLEWTRKRAEEEADKAIAALQA 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ W+ +L  +    +QR
Sbjct: 302 LPETPWRSALEALAHMSVQR 321


>gi|254225991|ref|ZP_04919591.1| octaprenyl-diphosphate synthase [Vibrio cholerae V51]
 gi|254291338|ref|ZP_04962132.1| octaprenyl-diphosphate synthase [Vibrio cholerae AM-19226]
 gi|125621447|gb|EAZ49781.1| octaprenyl-diphosphate synthase [Vibrio cholerae V51]
 gi|150422794|gb|EDN14747.1| octaprenyl-diphosphate synthase [Vibrio cholerae AM-19226]
          Length = 348

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 29  KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 88

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 89  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 148

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 149 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 208

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 209 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 268

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 269 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKALHEADKAIAELAVL 327

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 328 PESEYKQALITLAHMAVNR 346


>gi|17547542|ref|NP_520944.1| octaprenyl-diphosphate synthase [Ralstonia solanacearum GMI1000]
 gi|17429846|emb|CAD16530.1| probable octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthase) protein [Ralstonia solanacearum GMI1000]
          Length = 322

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 194/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L YRG +H  LA 
Sbjct: 12  EDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANALGYRGQHHYELAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 72  VVEFIHTATLLHDDVVDESELRRGRQTANAVFGNAASVLVGDFLYSRAFQMMVQADSMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 132 MQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 192 TEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLREGKPTLPLIYLLSHGTETQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A +++  LP S ++++
Sbjct: 252 RALARQAIEQG--GTEHFDAIFAAIQASGALEYTRKAAEHEASAAAEAIIALPPSQFRQT 309

Query: 310 LMEVVDFCLQR 320
           L+E+  F LQR
Sbjct: 310 LIELCAFSLQR 320


>gi|229512636|ref|ZP_04402105.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae TMA 21]
 gi|229350313|gb|EEO15264.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           cholerae TMA 21]
          Length = 323

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 244 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKAQYEADKAIAELAVL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 303 PESEYKQALITLAHMAVNR 321


>gi|15640461|ref|NP_230088.1| octaprenyl-diphosphate synthase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121590773|ref|ZP_01678102.1| octaprenyl-diphosphate synthase [Vibrio cholerae 2740-80]
 gi|121727265|ref|ZP_01680424.1| octaprenyl-diphosphate synthase [Vibrio cholerae V52]
 gi|147674613|ref|YP_001218702.1| octaprenyl-diphosphate synthase [Vibrio cholerae O395]
 gi|153819559|ref|ZP_01972226.1| octaprenyl-diphosphate synthase [Vibrio cholerae NCTC 8457]
 gi|153822596|ref|ZP_01975263.1| octaprenyl-diphosphate synthase [Vibrio cholerae B33]
 gi|153830825|ref|ZP_01983492.1| octaprenyl-diphosphate synthase [Vibrio cholerae 623-39]
 gi|227080645|ref|YP_002809196.1| octaprenyl-diphosphate synthase [Vibrio cholerae M66-2]
 gi|254850665|ref|ZP_05240015.1| octaprenyl-diphosphate synthase [Vibrio cholerae MO10]
 gi|298501034|ref|ZP_07010835.1| octaprenyl-diphosphate synthase [Vibrio cholerae MAK 757]
 gi|9654858|gb|AAF93607.1| octaprenyl-diphosphate synthase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121547375|gb|EAX57489.1| octaprenyl-diphosphate synthase [Vibrio cholerae 2740-80]
 gi|121630384|gb|EAX62779.1| octaprenyl-diphosphate synthase [Vibrio cholerae V52]
 gi|126509895|gb|EAZ72489.1| octaprenyl-diphosphate synthase [Vibrio cholerae NCTC 8457]
 gi|126519900|gb|EAZ77123.1| octaprenyl-diphosphate synthase [Vibrio cholerae B33]
 gi|146316496|gb|ABQ21035.1| octaprenyl-diphosphate synthase [Vibrio cholerae O395]
 gi|148873684|gb|EDL71819.1| octaprenyl-diphosphate synthase [Vibrio cholerae 623-39]
 gi|227008533|gb|ACP04745.1| octaprenyl-diphosphate synthase [Vibrio cholerae M66-2]
 gi|227012288|gb|ACP08498.1| octaprenyl-diphosphate synthase [Vibrio cholerae O395]
 gi|254846370|gb|EET24784.1| octaprenyl-diphosphate synthase [Vibrio cholerae MO10]
 gi|297540282|gb|EFH76342.1| octaprenyl-diphosphate synthase [Vibrio cholerae MAK 757]
          Length = 348

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 29  KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 88

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 89  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 148

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 149 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 208

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 209 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 268

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 269 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKALHEADKAIAELAIL 327

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 328 PESEYKQALITLAHMAVNR 346


>gi|262164113|ref|ZP_06031852.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           mimicus VM223]
 gi|262027641|gb|EEY46307.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           mimicus VM223]
          Length = 323

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 189/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            NH   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  SNHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 244 MQHGNPEQVLMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKAQHEADKAIAELAIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 303 PESEYKQALITLAHMAVNR 321


>gi|82702937|ref|YP_412503.1| farnesyltranstransferase [Nitrosospira multiformis ATCC 25196]
 gi|82411002|gb|ABB75111.1| Farnesyltranstransferase [Nitrosospira multiformis ATCC 25196]
          Length = 322

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 194/320 (60%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  L   DM +V+ +I +++ S+V +I  V +Y+I SGGKRLRP L + +A    Y 
Sbjct: 3   IERIRSLIAPDMGRVDTVIREKLHSEVVLIRQVSEYIINSGGKRLRPALVILSAGAFGYT 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H  LA  +EFIHTATLLHDDVVD S LRR K  A  ++GN  SVLVGDFL S+AF M
Sbjct: 63  GQYHYNLAAIVEFIHTATLLHDDVVDASELRRSKATANALFGNAASVLVGDFLYSRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  +   +  L+    T+AEGE+ QL   ++ DV EE+YL VI+ KTA LF AA  + 
Sbjct: 123 MVEVDNMRVMRVLADATNTIAEGEVLQLLNVRDPDVDEENYLRVIRYKTAKLFEAATRLG 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++     +  +A+  YGM+LG AFQL DD+LDY G+  E GKN+G+D   GKPTLP+I 
Sbjct: 183 AILGNASPAEEEAMAVYGMHLGTAFQLTDDMLDYSGDYQETGKNLGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G+  +    +S I  G       +    ++++  AL     RA +  + A + +  
Sbjct: 243 AMKTGSGAQAQIIRSAIERGGEG--GFQPVLEVIQQTGALDYARQRAQAESETASNMISS 300

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPDS +K+ L+++  F + R
Sbjct: 301 LPDSDYKQCLLDLSTFAVAR 320


>gi|310766238|gb|ADP11188.1| Octaprenyl diphosphate synthase [Erwinia sp. Ejp617]
          Length = 324

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 193/321 (60%), Gaps = 2/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLT-LATALMLEY 59
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+  LA   + +Y
Sbjct: 3   LEQINELTAQDMADVNATILDQLNSDVSLINQLGYYIINGGGKRIRPMIAVLAARAINDY 62

Query: 60  RGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC 119
            G  H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF 
Sbjct: 63  AGKQHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQ 122

Query: 120 MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           M+    S + L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + 
Sbjct: 123 MMTSLGSLKVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQS 182

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
           S+++AG   +  QAL+ YG  +G AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++
Sbjct: 183 SAILAGASEAEEQALQDYGRYIGTAFQLIDDLLDYSADGETLGKNVGDDLSEGKPTLPLL 242

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
            A + GT  + +  +S I +G      L+     M +  +L  T   A     KA  +L 
Sbjct: 243 HAMRNGTPEQASMIRSAIEEGN-GRHLLESVLETMNQCGSLEWTRNAAEKEADKAIAALG 301

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            LP S W+ +L  +    +QR
Sbjct: 302 VLPKSPWRTALEALAHMSVQR 322


>gi|153802102|ref|ZP_01956688.1| octaprenyl-diphosphate synthase [Vibrio cholerae MZO-3]
 gi|124122346|gb|EAY41089.1| octaprenyl-diphosphate synthase [Vibrio cholerae MZO-3]
          Length = 348

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 29  KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 88

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 89  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 148

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 149 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 208

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A
Sbjct: 209 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYA 268

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 269 MQHGNPEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKAQYEADKAIAELAVL 327

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 328 PESEYKQALITLAHMAVNR 346


>gi|300702983|ref|YP_003744585.1| octaprenyl diphosphate synthase [Ralstonia solanacearum CFBP2957]
 gi|299070646|emb|CBJ41941.1| octaprenyl diphosphate synthase [Ralstonia solanacearum CFBP2957]
          Length = 322

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 196/311 (63%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L YRG++H  LA 
Sbjct: 12  EDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANALGYRGNHHHELAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 72  VVEFIHTATLLHDDVVDESELRRGRQTANAVFGNAASVLVGDFLYSRAFQMMVQADSMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 132 MQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I    +GT+ +
Sbjct: 192 TEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLREGKPTLPLIHLLSQGTEEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A +++  LP S ++++
Sbjct: 252 RALARQAIEQG--GTEHFDAIFSAIQTSGALEYTRKAAEREASAAAEAIIALPPSQFRQT 309

Query: 310 LMEVVDFCLQR 320
           L+E+  F LQR
Sbjct: 310 LIELCAFSLQR 320


>gi|308051079|ref|YP_003914645.1| trans-hexaprenyltranstransferase [Ferrimonas balearica DSM 9799]
 gi|307633269|gb|ADN77571.1| Trans-hexaprenyltranstransferase [Ferrimonas balearica DSM 9799]
          Length = 322

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 195/322 (60%), Gaps = 2/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  + DL   DM+ VN +I  ++ SDV +I  +  Y+I  GGKR+RP+L +  A  ++Y+
Sbjct: 3   LNAIRDLADHDMKMVNQMIYDQLHSDVVLINQLSFYIINGGGKRMRPLLAVLAARAVDYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+HV LA  IEFIHTATLLHDDVVD+S +RRG+  A  ++GNQ SVLVGDFL +++F M
Sbjct: 63  GDDHVKLAAIIEFIHTATLLHDDVVDESTMRRGRETANALFGNQASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E K    LE L+     LAEGE+ QL    + + TEE Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELKRPRVLEDLADATNVLAEGEVLQLMNCNDPNTTEESYMQVIYCKTARLFEAATHLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IA     V  AL  YG  LG AFQLVDDVLDY  +  E+GKN+G+D   GKPTLP+I 
Sbjct: 183 AVIADQPTEVCDALSDYGRYLGTAFQLVDDVLDYTADAEELGKNLGDDLAEGKPTLPLIH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A     + +    +S I +G    + + +    + +  +L  T  RA     KA  +L  
Sbjct: 243 AIAHAPEAQSQQIRSAIENG--GCDEVDEVVATLNQVGSLEYTMQRAVEEADKAIAALDV 300

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP++ ++++L  +    ++R N
Sbjct: 301 LPETPFREALASLARIAVERRN 322


>gi|269960912|ref|ZP_06175282.1| octaprenyl-diphosphate synthase [Vibrio harveyi 1DA3]
 gi|269834352|gb|EEZ88441.1| octaprenyl-diphosphate synthase [Vibrio harveyi 1DA3]
          Length = 323

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/319 (40%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  NGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TEE Y+ VI SKTA LF +A ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSKTARLFESATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A ++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPEEVEVAFQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +  T       +  I      ++ L+    +M+E  +L  T  +A     KA   L  L
Sbjct: 244 MRNTTPENAQMIREAIEKAN-GMDRLEDILAVMQEAGSLEYTTQKAMDEADKAIAELAIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 303 PESDYKQALITLAHMAVKR 321


>gi|261345175|ref|ZP_05972819.1| octaprenyl-diphosphate synthase [Providencia rustigianii DSM 4541]
 gi|282566867|gb|EFB72402.1| octaprenyl-diphosphate synthase [Providencia rustigianii DSM 4541]
          Length = 323

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/315 (42%), Positives = 190/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN +IL ++ SDV +I  +  Y+I  GGKR+RPM+ +     L Y G  H 
Sbjct: 8   ELTNEDMSAVNKVILSQLNSDVALINQLGYYIISGGGKRIRPMIAILAGRSLGYSGHKHT 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A  V+GN  SVLVGDF+ +++F M+ +  
Sbjct: 68  QVAALIEFIHTATLLHDDVVDESDMRRGKQTANAVFGNAASVLVGDFIYTRSFQMMTDLD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ +S     +AEGE+ QL    + ++TEE+Y+ VI SKTA LF AA   S+++A 
Sbjct: 128 SMRVLKLMSEATNVIAEGEVLQLMNCNDPNITEENYMQVIYSKTARLFEAASHASAILAN 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +  +AL+ YG  +G AFQLVDD+LDY  +  ++GKN G+D   GKPTLP++ A   G
Sbjct: 188 ATPAQEKALQDYGRYIGTAFQLVDDLLDYDADNTQLGKNTGDDLDEGKPTLPLLHAMNHG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
            + E    +  I  G      L      M+   +L  T  RA    QKA D+L  L DS+
Sbjct: 248 NEEESALIRQAIEQGN-GRHLLDTVLATMKRCGSLDYTYQRAQEEAQKAIDALDILEDSA 306

Query: 306 WKKSLMEVVDFCLQR 320
           +K++L+ +    +QR
Sbjct: 307 YKQALIGLAHIAIQR 321


>gi|109900040|ref|YP_663295.1| trans-hexaprenyltranstransferase [Pseudoalteromonas atlantica T6c]
 gi|109702321|gb|ABG42241.1| Trans-hexaprenyltranstransferase [Pseudoalteromonas atlantica T6c]
          Length = 323

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 194/315 (61%), Gaps = 1/315 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN LI K++ SDV +I  +  Y++ SGGKRLRP+LT+  A  L  + + H  
Sbjct: 9   LAEPDMLAVNQLIQKQVNSDVSLINQLGFYIVNSGGKRLRPLLTVLAARALNIQTEQHHT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IEFIHTATLLHDDVVD+S +RRG+  A  V+GNQ SVLVGDFL +++F M++   S
Sbjct: 69  LAAIIEFIHTATLLHDDVVDESTMRRGRETANEVFGNQASVLVGDFLYTRSFQMMVTLDS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              ++ LS     +AEGE+ QL    + D TEE Y+ VI SKTA LF AA  ++ ++   
Sbjct: 129 MRVMQILSDATNVIAEGEVLQLMNCNDPDTTEESYMEVIYSKTARLFEAATLLAGVLTKQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             ++  A++ YG  LG AFQLVDD++DY  +  EMGKN+G+D   GKPTLP++ A   G 
Sbjct: 189 SEAIENAMQDYGKYLGTAFQLVDDIMDYASDSEEMGKNMGDDLAEGKPTLPLLYAMWHGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
           +++    +  I  G   ++NL      M +  AL  T+ +A    Q+A D+L  + +S +
Sbjct: 249 EQQTAIIREAIETGN-GMDNLTPILETMEQTGALTYTKQQALKASQQAIDALSPIEESVY 307

Query: 307 KKSLMEVVDFCLQRL 321
           K++L+ +    ++R+
Sbjct: 308 KEALIGLAHISVERV 322


>gi|152980282|ref|YP_001354685.1| octaprenyl-diphosphate synthase [Janthinobacterium sp. Marseille]
 gi|151280359|gb|ABR88769.1| octaprenyl-diphosphate synthase [Janthinobacterium sp. Marseille]
          Length = 334

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/310 (41%), Positives = 196/310 (63%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+  V+ +I +++ S+V ++  +  Y+I +GGKR+RP+L L  A    YRG +H  LA  
Sbjct: 25  DLNAVDTVIRQKLHSEVALVNQIADYIISAGGKRIRPVLVLLMANAYGYRGTDHHQLAAV 84

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S+LRRG+  A  ++GN  SVLVGDFL S+AF M++       +
Sbjct: 85  VEFIHTATLLHDDVVDESSLRRGRKTANALFGNAASVLVGDFLYSRAFQMMVSVGDIRIM 144

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+     +AEGE+ QL    + DV+EE Y  VI+SKTA LF AA ++ +LIAG  +  
Sbjct: 145 QILADATNVIAEGEVLQLLNMHDPDVSEERYTQVIRSKTAKLFEAAAQLGTLIAGASDDE 204

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG +LG AFQL+DDVLDY G+ +++GKN+G+D R GK TLP+I   + GT  ++
Sbjct: 205 IEAAAEYGRSLGTAFQLIDDVLDYSGQADDIGKNVGDDLREGKATLPLIYLMEHGTPEQR 264

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +S I +G    ++       +  + AL  T+ +A     +A  S+  LPD+++K +L
Sbjct: 265 ELVRSCIENG--DEQHFDAVLQAVTTSGALDYTKRKAEEASARATASIAGLPDNAFKDAL 322

Query: 311 MEVVDFCLQR 320
           +++  F + R
Sbjct: 323 LKLSAFAVNR 332


>gi|258627044|ref|ZP_05721842.1| octaprenyl-diphosphate synthase [Vibrio mimicus VM603]
 gi|258580718|gb|EEW05669.1| octaprenyl-diphosphate synthase [Vibrio mimicus VM603]
          Length = 348

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 188/319 (58%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y G
Sbjct: 29  KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYHG 88

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 89  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 148

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 149 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 208

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 209 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLYA 268

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 269 MQHGNAEQAAMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKAQHEADKAIAELAIL 327

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 328 PESEYKQALITLAHMAVNR 346


>gi|207721484|ref|YP_002251924.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate synthase)
           protein [Ralstonia solanacearum MolK2]
 gi|206586644|emb|CAQ17230.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate synthase)
           protein [Ralstonia solanacearum MolK2]
          Length = 352

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 195/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L YRG++H  LA 
Sbjct: 42  EDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANALGYRGNHHYELAA 101

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 102 VVEFIHTATLLHDDVVDESELRRGRQTANAVFGNAASVLVGDFLYSRAFQMMVQADSMRV 161

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 162 MQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 221

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 222 TEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLREGKPTLPLIHLLSHGTEEQ 281

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A +++  LP S ++++
Sbjct: 282 RALARQAIEQG--GTEHFDAIFDAIQASGALEYTRKAAEREASAAAEAIIALPPSQFRQT 339

Query: 310 LMEVVDFCLQR 320
           L+E+  F LQR
Sbjct: 340 LIELCAFSLQR 350


>gi|212709993|ref|ZP_03318121.1| hypothetical protein PROVALCAL_01044 [Providencia alcalifaciens DSM
           30120]
 gi|212687402|gb|EEB46930.1| hypothetical protein PROVALCAL_01044 [Providencia alcalifaciens DSM
           30120]
          Length = 323

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 134/315 (42%), Positives = 188/315 (59%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN  IL ++ SDV +I  +  Y++  GGKR+RPM+ +     L Y    H+
Sbjct: 8   ELTAEDMSAVNEAILSQLNSDVALINQLGYYIVSGGGKRIRPMIAILAGRSLGYSEHKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A  V+GN  SVLVGDF+ +++F M+ +  
Sbjct: 68  QVAALIEFIHTATLLHDDVVDESDMRRGKQTANAVFGNAASVLVGDFIYTRSFQMMTDLD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA   S+++A 
Sbjct: 128 SMRVLKLMSEATNVIAEGEVLQLMNCNDPDITEESYMQVIYSKTARLFEAASHASAILAN 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                 +AL+ YG  +G AFQLVDD+LDY  +  ++GKN G+D   GKPTLP++ A Q G
Sbjct: 188 ATPEQEKALQDYGRYIGTAFQLVDDLLDYDADNTQLGKNTGDDLDEGKPTLPLLHAMQHG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
            + E    +  I  G      L+     M+   +L  T  RA    QKA D+L  L DS 
Sbjct: 248 NEEESALIRQAIEQGN-GRHLLETVLSTMKRCGSLEYTYQRAQEEAQKAIDALNALEDSV 306

Query: 306 WKKSLMEVVDFCLQR 320
           +K++L+ +    +QR
Sbjct: 307 YKEALIGLAHVAIQR 321


>gi|299065629|emb|CBJ36801.1| octaprenyl diphosphate synthase [Ralstonia solanacearum CMR15]
          Length = 322

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 193/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L YRG +H  LA 
Sbjct: 12  EDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANALGYRGQHHYELAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL S+AF M+++  S   
Sbjct: 72  VVEFIHTATLLHDDVVDESELRRGRQTANAAFGNAASVLVGDFLYSRAFQMMVQADSMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 132 MQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 192 TEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLREGKPTLPLIYLLSHGTETQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A +++  LP S ++++
Sbjct: 252 RALARQAIEQG--GTEHFDAIFAAIQASGALEYTRKAAEREASAAAEAIIALPPSQFRQT 309

Query: 310 LMEVVDFCLQR 320
           L+E+  F LQR
Sbjct: 310 LIELCAFSLQR 320


>gi|288941872|ref|YP_003444112.1| trans-hexaprenyltranstransferase [Allochromatium vinosum DSM 180]
 gi|288897244|gb|ADC63080.1| Trans-hexaprenyltranstransferase [Allochromatium vinosum DSM 180]
          Length = 322

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 190/312 (60%), Gaps = 4/312 (1%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D + V+ LIL+R+ SDV +I  +  Y++ SGGKRLRP+  L  A    Y G+ H+ LA 
Sbjct: 12  EDTKAVDALILRRLQSDVVLINQIGHYIVNSGGKRLRPLSVLLAARACGYTGERHIDLAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHT+TLLHDDVVD S LRR +  A +VWGN  SVLVGDFL S++F M+++  +   
Sbjct: 72  IVEFIHTSTLLHDDVVDGSELRRNRETANVVWGNDASVLVGDFLYSRSFEMMVDVGNMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +E L+     +AEGE+ QL   ++ D  E  Y+ VI  KTA LF A   + ++IA     
Sbjct: 132 MEVLAHATNRIAEGEVLQLLNERDPDTDEARYMEVISRKTATLFEAGTRLGAVIAESPPE 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           + +A++ YG+ LGIAFQLVDD LDY  +  E+GKN+G+D   GKPTLP+I A Q GT  +
Sbjct: 192 IEEAIREYGLRLGIAFQLVDDALDYSVDNAELGKNVGDDLDEGKPTLPIIRAMQVGTPEQ 251

Query: 250 KNFWKSTI-NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           +   +  I + G+  +E++  A   +    A+  T   A SY  +AK +L  LP S    
Sbjct: 252 RALLRDAIEHGGRDRIESVTAA---IASTDAIDYTTQLAQSYAAQAKKALERLPASPAND 308

Query: 309 SLMEVVDFCLQR 320
           +L  + DF + R
Sbjct: 309 ALALLADFAVAR 320


>gi|317401225|gb|EFV81869.1| octaprenyl-diphosphate synthase [Achromobacter xylosoxidans C54]
          Length = 321

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 191/312 (61%), Gaps = 3/312 (0%)

Query: 9   LKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           + DM+ V+ +I +R+ SDV +I  +  Y+I +GGKR+RP + L  A  L Y+G +H LLA
Sbjct: 11  VDDMKAVDAVIRERLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYQGTHHQLLA 70

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S  
Sbjct: 71  AVVEFIHTATLLHDDVVDESDLRRGRETANAVFGNAASVLVGDYLYSRSFEMMVEADSMR 130

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            +  LS     +AEGE+ QL    + DV++E YL V++ KTA LF AA +V +++AG   
Sbjct: 131 IMSILSEATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKLFEAAAQVGAVLAGATP 190

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
               A  +YG ++G AFQLVDDVLDY G+   +GKN+G+D R GKPTLP+I   + GT +
Sbjct: 191 EQEAAAAAYGRHVGTAFQLVDDVLDYSGDAAALGKNVGDDLREGKPTLPLIRVMEVGTPQ 250

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           ++   +  I  G      +  A   ++   AL      A +   +A+++L   P S +  
Sbjct: 251 QQQLIRDAIKTGDADFAAVAAA---IQATDALEHARQAAVAEADRAREALSAYPVSPFLN 307

Query: 309 SLMEVVDFCLQR 320
           SL+E   F + R
Sbjct: 308 SLLEFCAFAVNR 319


>gi|238783532|ref|ZP_04627554.1| Octaprenyl-diphosphate synthase [Yersinia bercovieri ATCC 43970]
 gi|238715587|gb|EEQ07577.1| Octaprenyl-diphosphate synthase [Yersinia bercovieri ATCC 43970]
          Length = 323

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 191/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   ELTAPDMAAVNTTILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALHYQGSKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + ++++A 
Sbjct: 128 SLRVLTLMSEATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLAD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A + G
Sbjct: 188 ASEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMRNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  ++   +  I  G      L+   + M++  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 TPEQETMIRQAIEQGS-GRHLLEPVLVAMQQCGSLDYTRQRAEEEADKAIAALQILPESE 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    +QR
Sbjct: 307 YRLALEGLAHIAVQR 321


>gi|332678210|gb|AEE87339.1| Octaprenyl-diphosphate synthase / Dimethylallyltransferase /
           Geranyltranstransferase (farnesyldiphosphate synthase) /
           Geranylgeranyl pyrophosphate synthetase [Francisella cf.
           novicida Fx1]
          Length = 325

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 202/330 (61%), Gaps = 16/330 (4%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYS 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLI-------AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGK 233
            +I       A  Q+++R    +YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK
Sbjct: 184 GVISLDKQNYANYQDNIR----NYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGK 239

Query: 234 PTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQ 292
            TLP I A    T++++   K  I  G+ +++ +    I M ++   VD  Y+ A  Y  
Sbjct: 240 MTLPTIYALANVTEQQQQILKKAIEKGEYTIDEI----IAMVKDSGAVDYSYKVACQYAD 295

Query: 293 KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
            AK  +  LPDS +K++++ + D  + R N
Sbjct: 296 LAKQQIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|70732635|ref|YP_262398.1| octylprenyl diphosphate synthase [Pseudomonas fluorescens Pf-5]
 gi|68346934|gb|AAY94540.1| octylprenyl diphosphate synthase [Pseudomonas fluorescens Pf-5]
          Length = 322

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 190/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDGIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANAMWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG     
Sbjct: 133 RILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALAGATEEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 AEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+     +  + +L  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKGGI--EDLESIRAAVEASGSLDYTAQLARDYVARAITCLEALPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|262172465|ref|ZP_06040143.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           mimicus MB-451]
 gi|261893541|gb|EEY39527.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           mimicus MB-451]
          Length = 323

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 189/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 244 MQHGNPEQALMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKAQHEADKAIAELDIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 303 PESEYKQALITLAHMAVNR 321


>gi|262403940|ref|ZP_06080497.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio sp.
           RC586]
 gi|262349902|gb|EEY99038.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio sp.
           RC586]
          Length = 323

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSLKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++    + V  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 ILCDASSEVELAMQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLYA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 244 MQHGNPEQALMIREAIEKAN-GMSRLNEILAAMEQTGSLRYTIEKAQHEADKAIAELDIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 303 PESEYKQALITLAHMAVNR 321


>gi|91794278|ref|YP_563929.1| trans-hexaprenyltranstransferase [Shewanella denitrificans OS217]
 gi|91716280|gb|ABE56206.1| Trans-hexaprenyltranstransferase [Shewanella denitrificans OS217]
          Length = 323

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 199/324 (61%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  + +L   DM+ V+ LI +++ SDV +I  +  Y+I SGGKRLRP+LT+     + Y 
Sbjct: 3   LNAIRELAETDMKAVDQLIYQQLESDVALINQLAFYIIKSGGKRLRPLLTVLACRAMGYE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ LA  +EFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 63  GDKHLKLAAIVEFIHTASLLHDDVVDESLLRRGRETANALFGNSASVLVGDFLYTRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E  S   L+ L+     LAEGE+ QL    + + TE +Y+ VI  KTA LF AA  ++
Sbjct: 123 MTELDSLHVLKVLANTTNVLAEGEVLQLMNCNDPNTTEANYMRVIYCKTAKLFEAATLLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++AG   + + AL  YG  LG AFQL DD+LDY    +E+GKNIG+D   GKPTLP+I 
Sbjct: 183 GVLAGASVAEQIALGEYGKFLGTAFQLTDDLLDYTASSDELGKNIGDDLAEGKPTLPLIF 242

Query: 241 AFQRGTKREKNFWKSTI--NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
           A + G+   K   K  I   DG  +++ + KA   + ++ AL  T+ +A    +KA  +L
Sbjct: 243 AMEHGSAHAKALIKQAIEQGDGTQAIDEIVKA---LHDSGALEYTKNKAIEEAEKAIAAL 299

Query: 299 RCLPDSSWKKSLMEVVDFCLQRLN 322
            C+ DS  K +L+ + +  + R N
Sbjct: 300 SCVKDSRHKDALISLANIAVNRSN 323


>gi|90411954|ref|ZP_01219962.1| putative octaprenyl-diphosphate synthase [Photobacterium profundum
           3TCK]
 gi|90327212|gb|EAS43584.1| putative octaprenyl-diphosphate synthase [Photobacterium profundum
           3TCK]
          Length = 323

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 194/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM +V+  I  ++ SDV +I  +  Y++  GGKRLRPML +  A  L Y+G
Sbjct: 4   KAIQALTANDMAEVDAKIQAQLNSDVALINQLGFYIVSGGGKRLRPMLVVLAARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           D H+  A  +EFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+
Sbjct: 64  DKHITAAAFVEFIHTATLLHDDVVDESDMRRGKETANAAFGNAASVLVGDYIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
              +S + L+ +S     +AEGE+ QL    + + TE++Y+ VI SKTA LF AA ++S+
Sbjct: 124 TSLRSLKILDVMSEATNVIAEGEVLQLMNCNDPNTTEDNYMQVIYSKTARLFEAATQISA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           +I      V  AL+ YG  LG AFQL+DDVLDY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 IITESSTEVEVALQDYGRYLGTAFQLIDDVLDYVADGKEMGKNVGDDLSEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G + +    +  I      ++ L      MRE  +L  T+ RA     KA  +L  +
Sbjct: 244 MHNGNEAQSAMIREAIEKSN-GMDKLNDILAAMREAGSLEYTQQRAEEEADKAIAALAPI 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            +S +K++L+++    ++R
Sbjct: 303 AESDYKEALIQLAHLAVKR 321


>gi|260773626|ref|ZP_05882542.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           metschnikovii CIP 69.14]
 gi|260612765|gb|EEX37968.1| octaprenyl-diphosphate
           synthase/dimethylallyltransferase/geranyltranstransferas
           e/geranylgeranyl pyrophosphate synthetase [Vibrio
           metschnikovii CIP 69.14]
          Length = 323

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/319 (40%), Positives = 193/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KV+  IL ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y+G
Sbjct: 4   KAIQALTADDMAKVDKTILAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSAKALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           + H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  EGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANATFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE+ QL    + + TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TELGSMKILKLMSHSVNIIAEGEVLQLMNCNDPETTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V +A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 MLCDASPEVERAMQNYGKYLGTAFQLIDDVMDYTADGKEMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            +     +    +  I      +E L      M++  +L  T  +A     KA   L  L
Sbjct: 244 MRNSQGEQSAMIREAIEKAN-GMEKLTAILATMQQAGSLEYTTAKAQQEADKAIAELAIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    ++R
Sbjct: 303 PESDYKQALIALAHMAVKR 321


>gi|300718598|ref|YP_003743401.1| Octaprenyl diphosphate synthase [Erwinia billingiae Eb661]
 gi|299064434|emb|CAX61554.1| Octaprenyl diphosphate synthase [Erwinia billingiae Eb661]
          Length = 323

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 190/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ S+V +I  +  Y+I  GGKR+RPM+ +  A  + Y 
Sbjct: 3   LEQINELTAQDMADVNATILEQLNSEVSLINQLGYYIISGGGKRIRPMIAVLAARAVNYT 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GKQHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLGSLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A       +AL+ YG  +G AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++ 
Sbjct: 183 AILAEAVPEQEKALQDYGRFIGTAFQLIDDLLDYSADGKTLGKNVGDDLSEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    +  I  G      L+     MR+  +L  T   A     KA  +L+ 
Sbjct: 243 AMRNGTPEQSQMIREAIEKGN-GRHLLEPVLETMRQCGSLEWTRQAAEHEADKAISALKA 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S W+ +L  +    +QR
Sbjct: 302 LPESPWRSALEALAHMSVQR 321


>gi|254483435|ref|ZP_05096664.1| polyprenyl synthetase superfamily protein [marine gamma
           proteobacterium HTCC2148]
 gi|214036309|gb|EEB76987.1| polyprenyl synthetase superfamily protein [marine gamma
           proteobacterium HTCC2148]
          Length = 320

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 197/320 (61%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+ +      + E+VN LI+ ++ SDV+M+ ++  Y++ +GGKRLRP+L L TA      
Sbjct: 1   MQDIRSAVAAEFEQVNHLIIDQLHSDVDMVENIGHYIVDAGGKRLRPLLVLLTAAAFGRC 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G + +  A  IEFIHTATLLHDDVVD S+LRRG+  A   +GN  SVLVGDFL ++AF +
Sbjct: 61  GPDQIKFAAVIEFIHTATLLHDDVVDISSLRRGRPTANAEFGNAPSVLVGDFLYTRAFQL 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++    + L  ++    T+AEGE+ QL  + N D TE+ YL VI  KTA+LF+A    +
Sbjct: 121 MVQLGDMDILTHMANTTNTIAEGEVLQLVRAGNADTTEQQYLDVITRKTAILFAAGCYGA 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           + +   ++SV Q + S+G+NLGIAFQ++DD+LDY G+   MGKN+G+D   GKPTLP+I 
Sbjct: 181 ATLCHQESSVCQGMHSFGLNLGIAFQMIDDILDYEGDPAAMGKNVGDDLTEGKPTLPLIY 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
             + GTK E+   +  I +   + E++++    ++   AL  ++ +A  Y   A   L  
Sbjct: 241 TLEHGTKEEQALVRRAITEK--TAEDIEQVLAAVQRCGALNYSKQQARKYHNLALAELAA 298

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPDS  + SL  V    + R
Sbjct: 299 LPDSPARASLQAVTALSINR 318


>gi|3410887|dbj|BAA32241.1| decaprenyl diphosphate synthase [Gluconobacter oxydans]
          Length = 315

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 197/313 (62%), Gaps = 4/313 (1%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG----DNHVLL 67
           M   N  I+ R+ S V +IP +  +L+ +GGKRLRP+LTLA+A +  Y+       HV L
Sbjct: 1   MLACNRAIIARMESPVPLIPQLGAHLVAAGGKRLRPLLTLASARLCGYQPGPDHQRHVGL 60

Query: 68  ACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ 127
           A  +EFIHTATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL +++F ++    S 
Sbjct: 61  AACVEFIHTATLLHDDVVDESTLRRGLASANAVFGNKASVLVGDFLFARSFQLMTADGSL 120

Query: 128 EALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQ 187
           + +  LS  + T+AEGE+ Q+ +  +L    E YL VI  KTA LF+AA  V +++A   
Sbjct: 121 KVMAILSDASATIAEGEVLQMVVQNDLTTPVERYLEVIHGKTAALFAAACRVGAVVAERP 180

Query: 188 NSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTK 247
            +  +AL+ +G NLG+AFQLVDD LDY  +   +GK +G+D R GK TLPV+ A++ G+ 
Sbjct: 181 EAEEEALERFGTNLGMAFQLVDDALDYAADQQVLGKTVGDDMREGKITLPVLAAYEAGSP 240

Query: 248 REKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWK 307
            ++ FW+  I +G+ + ++L  A  ++ +  A+  T  RA  Y   A ++L   PDS  +
Sbjct: 241 EDRIFWERVIGEGEQTEDDLPHALNLIAKTGAINTTIARAQVYADAAVEALSIFPDSELR 300

Query: 308 KSLMEVVDFCLQR 320
           + L+E V F + R
Sbjct: 301 RLLIETVQFTVNR 313


>gi|219871055|ref|YP_002475430.1| octaprenyl-diphosphate synthase [Haemophilus parasuis SH0165]
 gi|219691259|gb|ACL32482.1| octaprenyl-diphosphate synthase [Haemophilus parasuis SH0165]
          Length = 327

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 193/314 (61%), Gaps = 1/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM+ V+  IL ++ SDV +I  +  Y+I  GGKR+RP++ +  A  + Y+G  H+ 
Sbjct: 13  LVKADMQAVDQAILAQLNSDVVLINQLGHYIISGGGKRIRPLIAVLAANTVGYKGQEHIT 72

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
            A  +EFIHTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF M+    S
Sbjct: 73  CAAFVEFIHTATLLHDDVVDESDMRRGRETANARFGNAASVLVGDFIYTRAFQMMASLCS 132

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
            + L+ +S     +AEGE++QL    N + TE +Y+ VI SKTA LF AA + S++++G 
Sbjct: 133 LDVLQVMSDATNVIAEGEVQQLMNVNNPETTEANYMQVIYSKTARLFEAASQCSAIVSGA 192

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A++ YG  LG AFQLVDD+LDY     ++GKNIG+D   GKPTLP++ A + G 
Sbjct: 193 DQATVIAMRDYGRYLGTAFQLVDDILDYSANAEQLGKNIGDDLAEGKPTLPLLHAMRSGN 252

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
            ++    +  I  G    E L +   IM E+++L  T  RA    QKA D++  LP+S +
Sbjct: 253 LQQAALIREAIEQGG-KREALDEILAIMAEHKSLDYTMERAKQEAQKAVDAIAILPESEY 311

Query: 307 KKSLMEVVDFCLQR 320
           K++L+ +    + R
Sbjct: 312 KQALISLAYLSVDR 325


>gi|254374334|ref|ZP_04989816.1| hypothetical protein FTDG_00500 [Francisella novicida GA99-3548]
 gi|151572054|gb|EDN37708.1| hypothetical protein FTDG_00500 [Francisella novicida GA99-3548]
          Length = 325

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 201/330 (60%), Gaps = 16/330 (4%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYS 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLI-------AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGK 233
            +I       A  Q+++R    +YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK
Sbjct: 184 GVISLDKQNYANYQDNIR----NYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGK 239

Query: 234 PTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQ 292
            TLP I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y  
Sbjct: 240 MTLPTIYALANVTEQQQQILKKAIEKGEYRIDQI----IAMVKDSGAVDYSYKVACQYAD 295

Query: 293 KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
            AK  +  LPDS +K++++ + D  + R N
Sbjct: 296 LAKQQIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|258623396|ref|ZP_05718400.1| octaprenyl-diphosphate synthase [Vibrio mimicus VM573]
 gi|258584362|gb|EEW09107.1| octaprenyl-diphosphate synthase [Vibrio mimicus VM573]
          Length = 348

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 188/319 (58%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM KVN  I  ++ SDV +I  +  Y+I  GGKRLRP+L + +A  L Y G
Sbjct: 29  KAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYHG 88

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H   A  IEFIHTATLLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 89  SHHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMM 148

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
            E  S + L+ +S     +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +
Sbjct: 149 TELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGA 208

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      V  A+++YG  LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 209 ILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLYA 268

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            Q G   +    +  I      +  L +    M +  +L  T  +A     KA   L  L
Sbjct: 269 MQHGNPEQALMIREAIEKAN-GMSRLNEILAAMEQTGSLQYTIEKAQHEADKAIAELDIL 327

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L+ +    + R
Sbjct: 328 PESEYKQALITLAHMAVNR 346


>gi|261493062|ref|ZP_05989602.1| octaprenyl-diphosphate synthase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496350|ref|ZP_05992745.1| octaprenyl-diphosphate synthase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307994|gb|EEY09302.1| octaprenyl-diphosphate synthase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311282|gb|EEY12445.1| octaprenyl-diphosphate synthase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 335

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 199/324 (61%), Gaps = 5/324 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L  +DM+ VN  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YR
Sbjct: 11  LEQIQALANEDMQAVNAEILAQLNSEVLLINQLGHYIIAGGGKRIRPLIAVLAARALGYR 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H+  A  IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M
Sbjct: 71  GKKHITAAAFIEFVHTATLLHDDVVDESDMRRGRPTANAHFGNAASVLVGDFIYTRSFQM 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S   L+ +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  
Sbjct: 131 MTDLDSLRVLKVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCV 190

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A     +  ALK+YG  LG AFQL+DD+LDY  +   +GKN+G+DF  GKPTLP++ 
Sbjct: 191 AIVADASEEIETALKNYGCYLGTAFQLIDDILDYSAQSESLGKNVGDDFVEGKPTLPLLH 250

Query: 241 AFQRGTKREKN----FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           A     K  K       ++ I +G   +E + +   IM+E+++L     +A    QKA D
Sbjct: 251 AMHAADKAGKTTQAELIRNAIENGG-ELEQIPQVLAIMQEHQSLDYAMQKAREEAQKAVD 309

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           SL  LP+S +K++L+ +    + R
Sbjct: 310 SLGVLPESEYKQALVSLAYLSVDR 333


>gi|118497514|ref|YP_898564.1| octaprenyl diphosphate synthase [Francisella tularensis subsp.
           novicida U112]
 gi|195536208|ref|ZP_03079215.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           novicida FTE]
 gi|118423420|gb|ABK89810.1| octaprenyl diphosphate synthase [Francisella novicida U112]
 gi|194372685|gb|EDX27396.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           novicida FTE]
          Length = 325

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 201/330 (60%), Gaps = 16/330 (4%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLI-------AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGK 233
            +I       A  Q+++R    +YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK
Sbjct: 184 GVISLDKQNYANYQDNIR----NYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGK 239

Query: 234 PTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQ 292
            TLP I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y  
Sbjct: 240 MTLPTIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYAD 295

Query: 293 KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
            AK  +  LPDS +K++++ + D  + R N
Sbjct: 296 LAKQQIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|302877611|ref|YP_003846175.1| Polyprenyl synthetase [Gallionella capsiferriformans ES-2]
 gi|302580400|gb|ADL54411.1| Polyprenyl synthetase [Gallionella capsiferriformans ES-2]
          Length = 320

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 191/320 (59%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+    L   DM  V+ +I  ++ S+V ++  V +Y++ SGGKRLRP L + +A    Y 
Sbjct: 1   MENFNQLLAADMASVDQVIRNKLHSEVVLVNQVAEYIVNSGGKRLRPALVVLSAHAFNYT 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H  LA  +EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL S+AF M
Sbjct: 61  GEHHHELAAVVEFIHTATLLHDDVVDESGLRRGRETANALFGNAASVLVGDFLYSRAFQM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S   ++ L+     +AEGE+ QL    + DV  E+Y+ VI  KTA LF AA+ + 
Sbjct: 121 MVEVGSMRVMQTLADATNVIAEGEVLQLLNCNDADVDAENYMRVIHYKTAKLFEAAMRLG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A   +    A  +YGM+LG AFQL+DDVLDY  +    GK++G+D   GKPTLP+I 
Sbjct: 181 AILAKTSSEDEAAAATYGMHLGTAFQLIDDVLDYSADEAATGKHLGDDLAEGKPTLPLIY 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q GT ++    +S I +G +          I+ +  AL  T  +A    + A  +++ 
Sbjct: 241 AMQHGTAQQAAVVRSAIEEGDVG--KFADVLKIIHDTGALDFTRLQAMREVELACAAIKG 298

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S +K  LME+  F   R
Sbjct: 299 LPASKYKTCLMELAHFAATR 318


>gi|156502468|ref|YP_001428533.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|290953802|ref|ZP_06558423.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312813|ref|ZP_06803545.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|156253071|gb|ABU61577.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 325

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 201/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALVKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVILFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIA-GVQNSVRQA--LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            LI+   Q+  +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GLISIDKQDYTKYQGRIKNYGVYLGNAFQITDDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 244 TIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  + R N
Sbjct: 300 QIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|171059952|ref|YP_001792301.1| polyprenyl synthetase [Leptothrix cholodnii SP-6]
 gi|170777397|gb|ACB35536.1| Polyprenyl synthetase [Leptothrix cholodnii SP-6]
          Length = 313

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 188/301 (62%), Gaps = 2/301 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           +M +V+ +I +R+ S+V +I  +  Y++ +GGKR+RP+L L  A  L++ G     +A  
Sbjct: 4   EMAQVDAVIHRRLASEVALINQISHYIVSAGGKRIRPLLVLLFARALDFDGPERFEMAAT 63

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL S+AF M++       L
Sbjct: 64  VEFIHTATLLHDDVVDESDLRRGRKTANAIFGNAASVLVGDFLYSRAFQMMVSVNRLRVL 123

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+     +AEGE+ QL    + D++ E YL VI+ KTA LF A+    +++AGV   +
Sbjct: 124 DVLADATNVIAEGEVLQLLNMHDPDISIEAYLRVIRYKTAKLFEASARTGAVLAGVSAPL 183

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             +  SYG  LG AFQL+DD+LDY G   ++GKN+G+D R GKPT+P++LA Q G+  ++
Sbjct: 184 EDSCASYGRCLGTAFQLIDDLLDYEGATAQLGKNVGDDLREGKPTMPLLLAMQHGSSTQR 243

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
           +  +  I  G+  VE L +   I+R   AL  T   A     KA+  L  LP S +K++L
Sbjct: 244 DLIRHAIEHGE--VERLPEIIEIVRSTGALEATRQAARDEANKARAHLSSLPSSQFKEAL 301

Query: 311 M 311
           +
Sbjct: 302 L 302


>gi|89256379|ref|YP_513741.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314825|ref|YP_763548.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|254367716|ref|ZP_04983737.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           holarctica 257]
 gi|89144210|emb|CAJ79480.1| Octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129724|gb|ABI82911.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253527|gb|EBA52621.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           holarctica 257]
          Length = 325

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 201/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALVKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVILFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIA-GVQNSVRQA--LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            LI+   Q+  +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GLISIDKQDYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 244 TIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  + R N
Sbjct: 300 QIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|157368719|ref|YP_001476708.1| octaprenyl diphosphate synthase [Serratia proteamaculans 568]
 gi|157320483|gb|ABV39580.1| Polyprenyl synthetase [Serratia proteamaculans 568]
          Length = 323

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 192/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEQITELTAQDMAAVNATILEQLNSDVTLINQLGYYIISGGGKRIRPMIAVLAARALHYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRVLALMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++++    +  +AL+ YG  LG AFQL+DD+LDY  + + +GKN G+D   GKPTLP++ 
Sbjct: 183 AILSDASVAEEKALQDYGRYLGTAFQLIDDLLDYSADGSTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A       +K   +  I  G      L+     M++  +L  T  RA     KA  +L+ 
Sbjct: 243 AMHNSEGEQKAMIRGAIEQGN-GRHLLEPVLQAMQQCGSLEYTRQRAEEEADKAIAALQV 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S  + +L  +    +QR
Sbjct: 302 LPESPHRSALEGLAHLAVQR 321


>gi|94501366|ref|ZP_01307886.1| Trans-hexaprenyltranstransferase [Oceanobacter sp. RED65]
 gi|94426479|gb|EAT11467.1| Trans-hexaprenyltranstransferase [Oceanobacter sp. RED65]
          Length = 322

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 193/307 (62%), Gaps = 2/307 (0%)

Query: 14  KVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEF 73
           + N +IL+++ S+V M+  +  ++I SGGKR+RP+L L  A  LE    NH LLA  IEF
Sbjct: 16  RTNEIILEQLSSNVPMVEKIGHHIIESGGKRMRPLLVLLAAKALESNEQNHPLLASIIEF 75

Query: 74  IHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEAL 133
           +HTATLLHDDVVD S +RRGK  A   +GN  SVLVGDFL S+AF M+++  S E +  L
Sbjct: 76  LHTATLLHDDVVDTSDMRRGKATANAAFGNAPSVLVGDFLYSRAFEMMVQLGSMEVMAIL 135

Query: 134 SLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQA 193
           S   C +AEGE+ QL   KN +V E+ Y+ VI+ KTA+LF A+    + +A       +A
Sbjct: 136 SNATCVIAEGEVMQLMNVKNPNVGEDKYMDVIQGKTAMLFEASSHSGAKLANASPEQAEA 195

Query: 194 LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFW 253
           L+ +G +LG+AFQLVDDVLDY G  +E+GKN+G+D   GKPTLP+I A Q  ++ + +  
Sbjct: 196 LRLFGHHLGMAFQLVDDVLDYIGNADELGKNVGDDLAEGKPTLPLIFAMQNASQEQADVI 255

Query: 254 KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEV 313
           +  I  G    E+L K   I++   A+  T+ +A  +  +A +++  L D+  K++L  +
Sbjct: 256 RQAIRKG--GTEDLPKIIEIVQSCGAIDYTQQKAQEHVNQACEAIAILADTPAKQALQTL 313

Query: 314 VDFCLQR 320
            D  + R
Sbjct: 314 ADMAINR 320


>gi|71278535|ref|YP_271161.1| octaprenyl-diphosphate synthase [Colwellia psychrerythraea 34H]
 gi|71144275|gb|AAZ24748.1| octaprenyl-diphosphate synthase [Colwellia psychrerythraea 34H]
          Length = 327

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 191/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM  VN LI  ++ SDV +I  +  Y++  GGKR+RPMLT+  A    Y+
Sbjct: 7   IKAIQALAQSDMAAVNDLIYDQLQSDVALINQLGIYIVNGGGKRMRPMLTVLAARAFAYQ 66

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRG+  A  ++GN  SVLVGDFL +++F M
Sbjct: 67  GDKHLEIAAIIEFIHTATLLHDDVVDESNMRRGRETANALFGNSASVLVGDFLYTRSFQM 126

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +      ++ LS     +AEGE+ QL    +   TEE Y+ VI  KTA LF AA  ++
Sbjct: 127 MTKLGDMRIMDILSEATNIVAEGEVLQLMNCNDASTTEESYMQVIYCKTAKLFEAATRLA 186

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IA     + QA+  YG  LG AFQLVDD++DY  +  EMGKN+G+D   GKPTLP++ 
Sbjct: 187 AVIAKQDAKIEQAMADYGKYLGTAFQLVDDIMDYTADAKEMGKNVGDDLAEGKPTLPLLY 246

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G + ++   K  I  G   ++NL+     M E  +L  T+ +A     KA  +L  
Sbjct: 247 AMKHGNEAQQKLIKEAIELGN-GMDNLELILQAMEETGSLRYTQKQAEIEADKAIKALNV 305

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           + DS  K++L+ +      R
Sbjct: 306 IADSEHKQALISLAHIAANR 325


>gi|22124585|ref|NP_668008.1| octaprenyl diphosphate synthase [Yersinia pestis KIM 10]
 gi|45440424|ref|NP_991963.1| octaprenyl diphosphate synthase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108806061|ref|YP_649977.1| octaprenyl diphosphate synthase [Yersinia pestis Antiqua]
 gi|108813417|ref|YP_649184.1| octaprenyl diphosphate synthase [Yersinia pestis Nepal516]
 gi|145600809|ref|YP_001164885.1| octaprenyl diphosphate synthase [Yersinia pestis Pestoides F]
 gi|153997290|ref|ZP_02022390.1| octaprenyl-diphosphate synthase [Yersinia pestis CA88-4125]
 gi|162421069|ref|YP_001608269.1| octaprenyl diphosphate synthase [Yersinia pestis Angola]
 gi|165928166|ref|ZP_02223998.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937469|ref|ZP_02226032.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166011293|ref|ZP_02232191.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166214028|ref|ZP_02240063.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401227|ref|ZP_02306727.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167420704|ref|ZP_02312457.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423704|ref|ZP_02315457.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167470490|ref|ZP_02335194.1| octaprenyl-diphosphate synthase [Yersinia pestis FV-1]
 gi|218930527|ref|YP_002348402.1| octaprenyl diphosphate synthase [Yersinia pestis CO92]
 gi|229839166|ref|ZP_04459325.1| octaprenyl diphosphate synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229896655|ref|ZP_04511822.1| octaprenyl diphosphate synthase [Yersinia pestis Pestoides A]
 gi|229899730|ref|ZP_04514871.1| octaprenyl diphosphate synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229903892|ref|ZP_04519005.1| octaprenyl diphosphate synthase [Yersinia pestis Nepal516]
 gi|270489119|ref|ZP_06206193.1| polyprenyl synthetase [Yersinia pestis KIM D27]
 gi|294505357|ref|YP_003569419.1| octaprenyl-diphosphate synthase [Yersinia pestis Z176003]
 gi|21957387|gb|AAM84259.1|AE013669_9 octaprenyl diphosphate synthase [Yersinia pestis KIM 10]
 gi|45435281|gb|AAS60840.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108777065|gb|ABG19584.1| octaprenyl-diphosphate synthase [Yersinia pestis Nepal516]
 gi|108777974|gb|ABG12032.1| octaprenyl-diphosphate synthase [Yersinia pestis Antiqua]
 gi|115349138|emb|CAL22101.1| octaprenyl-diphosphate synthase [Yersinia pestis CO92]
 gi|145212505|gb|ABP41912.1| octaprenyl-diphosphate synthase [Yersinia pestis Pestoides F]
 gi|149288927|gb|EDM39007.1| octaprenyl-diphosphate synthase [Yersinia pestis CA88-4125]
 gi|162353884|gb|ABX87832.1| octaprenyl-diphosphate synthase [Yersinia pestis Angola]
 gi|165914574|gb|EDR33188.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165919853|gb|EDR37154.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165989677|gb|EDR41978.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166204823|gb|EDR49303.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166961510|gb|EDR57531.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049252|gb|EDR60660.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167057874|gb|EDR67620.1| octaprenyl-diphosphate synthase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229679662|gb|EEO75765.1| octaprenyl diphosphate synthase [Yersinia pestis Nepal516]
 gi|229687222|gb|EEO79297.1| octaprenyl diphosphate synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695532|gb|EEO85579.1| octaprenyl diphosphate synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700433|gb|EEO88465.1| octaprenyl diphosphate synthase [Yersinia pestis Pestoides A]
 gi|262363422|gb|ACY60143.1| octaprenyl-diphosphate synthase [Yersinia pestis D106004]
 gi|262367203|gb|ACY63760.1| octaprenyl-diphosphate synthase [Yersinia pestis D182038]
 gi|270337623|gb|EFA48400.1| polyprenyl synthetase [Yersinia pestis KIM D27]
 gi|294355816|gb|ADE66157.1| octaprenyl-diphosphate synthase [Yersinia pestis Z176003]
 gi|320013717|gb|ADV97288.1| octaprenyl diphosphate synthase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 323

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 185/315 (58%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+++  A  L Y+G  H+
Sbjct: 8   ELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMISVLVARALNYQGSKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTGLQ 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE Y+ VI SKTA LF AA + +++++ 
Sbjct: 128 SMRVLTLMSEATNVIAEGEVLQLMNCNNPDITEESYMQVIYSKTARLFEAAAQSAAILSD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  E + +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ASEEQELALQNYGRYLGTAFQLIDDLLDYSAEGSTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I  G      L+     M    +LV T  RA     KA  +L  LP+S 
Sbjct: 248 TPEQAAMIRQAIEQGN-GRHLLEPVLAAMEHCGSLVYTRQRAEEEADKAIAALHALPESD 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    + R
Sbjct: 307 YRLALEGLAHISVHR 321


>gi|253998223|ref|YP_003050286.1| trans-hexaprenyltranstransferase [Methylovorus sp. SIP3-4]
 gi|253984902|gb|ACT49759.1| Trans-hexaprenyltranstransferase [Methylovorus sp. SIP3-4]
          Length = 322

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 130/311 (41%), Positives = 189/311 (60%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM+ V+ +I K + SDV +I  V +Y+I  GGKRLRP L L +A         H  LA 
Sbjct: 12  QDMQAVDAVIRKSLHSDVVLINQVAEYIINGGGKRLRPALVLLSAGAFGEVNARHHELAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+SA+RRG+  A  ++GN  SVLVGDF+ S+AF M++  +S   
Sbjct: 72  VVEFIHTATLLHDDVVDESAMRRGRATANTLFGNAASVLVGDFIYSRAFQMMVGVESMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +E L+     +AEGE+ QL    + D+T+E YL VI  KTA LF AA  + ++I      
Sbjct: 132 MEVLAEATNIIAEGEVLQLLNVHDADITDEAYLKVIHYKTAKLFEAATRLGAIICAASEQ 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             QA+  YGM LG AFQL+DDVLD+ G+  E+GKN+G+D   GKPTLP+++A + GT  +
Sbjct: 192 DEQAMAEYGMRLGTAFQLIDDVLDFSGDSQEIGKNLGDDLAEGKPTLPLLIAMRLGTTAQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               +  I +G   ++ L      + E  AL      A    +   D+++ LPDS  +++
Sbjct: 252 AQTIRKAIEEG--GLDELPAVMQAVHETGALDQVRAIARQEAKAGCDAIQHLPDSPSRQA 309

Query: 310 LMEVVDFCLQR 320
           L+++ +F + R
Sbjct: 310 LLKLAEFAVDR 320


>gi|325981722|ref|YP_004294124.1| Trans-hexaprenyltranstransferase [Nitrosomonas sp. AL212]
 gi|325531241|gb|ADZ25962.1| Trans-hexaprenyltranstransferase [Nitrosomonas sp. AL212]
          Length = 322

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 193/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +++ S V +I  V +Y+I SGGKRLRP L + +A    Y G  H  LA 
Sbjct: 12  QDMSIVDNVIREKLHSHVLLIRQVSEYIINSGGKRLRPALVILSAGAFGYSGKFHYNLAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEFIHTATLLHDDVVD+S LRR +  A  ++GN  SVLVGDFL S+AF M++E  +   
Sbjct: 72  VIEFIHTATLLHDDVVDESELRRNRETANALFGNAASVLVGDFLYSRAFQMMVEVDNMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+    T+AEGE+ QL   ++  V+EE+YL VI+ KTA LF AA  + +++    + 
Sbjct: 132 MQVLADATNTIAEGEVLQLLNCRDPQVSEENYLQVIRFKTAKLFEAASRLGAILGNATSE 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A+  YGM+LG AFQLVDD+LDY G  +++GKN+G+D   GKPTLP+I A + GT+ +
Sbjct: 192 EENAMAVYGMHLGTAFQLVDDMLDYSGNNHDIGKNLGDDLTEGKPTLPLIYAMRTGTQEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
            N  +  I DG    +  +    ++R+  AL   +  A +    A  ++  LPDS  KK 
Sbjct: 252 ANIIRKAIEDG--GKDGFQPVLNVIRQTAALEYAKKCAEAEVTTAVAAIATLPDSENKKC 309

Query: 310 LMEVVDFCLQR 320
           L+++  F + R
Sbjct: 310 LLQLASFAVTR 320


>gi|118602394|ref|YP_903609.1| dimethylallyltranstransferase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567333|gb|ABL02138.1| Dimethylallyltranstransferase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 323

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 200/323 (61%), Gaps = 5/323 (1%)

Query: 1   MKMLEDLT--LK-DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALML 57
           MK L D+   LK D++K + +++ R+ S+V +I  +  Y+I +GGKRLRP+L L  A   
Sbjct: 1   MKSLSDIQSLLKLDLQKTDEILINRLSSNVALINQMGHYIIHAGGKRLRPLLLLLCARAT 60

Query: 58  EYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQA 117
           EY+G +H L+A  IE IHTATLLHDD+VD+S  RRGK     VWGN  SVLVGDFL S+A
Sbjct: 61  EYQGTHHYLMAVVIELIHTATLLHDDIVDESITRRGKDTVNEVWGNAPSVLVGDFLYSRA 120

Query: 118 FCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAAL 177
           F M+IE  S   +  LS    ++AEGE+ QL   KN ++TE +Y  VI+ KTA LF AA 
Sbjct: 121 FEMMIEPNSMYIIRILSKTTNSIAEGEVLQLLNCKNTELTETEYYAVIERKTACLFQAAT 180

Query: 178 EVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
           ++  L++GV  +   ALK YG++LG AFQ++DDVLDY   V  MGK +G+D   GK TLP
Sbjct: 181 QIGGLLSGVDKAQESALKDYGLHLGNAFQIIDDVLDYESNVKTMGKEVGDDLSEGKTTLP 240

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDS 297
           +I A    +   +   +  IN    S   + +   I++  +A   T  +A+   Q AK S
Sbjct: 241 MIYALAHTSGDNRQLLEDAINQADNS--KIVQVIKILQSIKAFDYTRNQAHKSAQLAKQS 298

Query: 298 LRCLPDSSWKKSLMEVVDFCLQR 320
           L+ +PDS +K +L+ + D  LQR
Sbjct: 299 LKLIPDSDYKDALILLCDLSLQR 321


>gi|123440796|ref|YP_001004787.1| octaprenyl diphosphate synthase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087757|emb|CAL10543.1| octaprenyl-diphosphate synthase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 323

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 189/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DLT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   DLTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALGYQGTKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + +++++ 
Sbjct: 128 SLRVLTLMSDATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLSD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ATEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I +G      L+   + M++  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 TPEQAAMIRQAIEEGN-GRHLLEPVLVAMQQCGSLDYTRQRAEEEADKAIAALQVLPESD 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    +QR
Sbjct: 307 YRLALEGLAHIAVQR 321


>gi|291615993|ref|YP_003518735.1| IspB [Pantoea ananatis LMG 20103]
 gi|291151023|gb|ADD75607.1| IspB [Pantoea ananatis LMG 20103]
 gi|327396245|dbj|BAK13667.1| octaprenyl-diphosphate synthase IspB [Pantoea ananatis AJ13355]
          Length = 323

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 189/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ + +A  + Y+
Sbjct: 3   LEQINELTAQDMAAVNQTILDQLNSDVSLINQLGYYIISGGGKRIRPMIAVLSARAMGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV  A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDLHVTNAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSMGSLRILALMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAASQAS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +  +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAEATPAQEKALQDYGRYLGTAFQLIDDLLDYSADGETLGKNTGDDLSEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G+  +    +  I  G      L      M +  +L  T  RA     KA  +L+ 
Sbjct: 243 AMNHGSPEQAKMIRDAIEQGN-GRHLLAPVLEAMNQCGSLEWTRQRAEQEADKAIAALQI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ W+ +L  +    +QR
Sbjct: 302 LPETPWRSALEALAHMSVQR 321


>gi|15602211|ref|NP_245283.1| IspB [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720590|gb|AAK02430.1| IspB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 330

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 191/317 (60%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L  +DM+K N  IL ++ SDV +I  +  Y+I SGGKR+RPM+ +  A  L + G+ 
Sbjct: 13  IQKLIHRDMQKTNETILAQLNSDVTLINQLGYYIIQSGGKRIRPMIAILAARALGFHGEQ 72

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  IEFIHTATLLHDDVVD+SALRRG   A   +GN  SVLVGDF+ ++AF ++ +
Sbjct: 73  PITCATFIEFIHTATLLHDDVVDESALRRGNPTANAEFGNAASVLVGDFIYTRAFQLMTQ 132

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S   L+ +S     +AEGE++QL    + + TEE+Y+ VI  KTA LF AA   ++++
Sbjct: 133 LDSLRILKVMSDATNVIAEGEVQQLMNVNDPNTTEENYMQVIYGKTARLFEAATHCAAIL 192

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A    +   AL+ YG  LG AFQLVDD+LDY  +   +GKNIG+D   GKPTLP++ A  
Sbjct: 193 AHATEAQENALREYGCYLGTAFQLVDDILDYSADAQALGKNIGDDLAEGKPTLPLLHAMH 252

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G   +    +  I  G    + L+    IM E+++L     RA    QKA D++  LP+
Sbjct: 253 HGNPAQAKLIREAIEQGG-KRDILEDVLTIMTEHKSLDYAMMRAKQEAQKAVDAIALLPE 311

Query: 304 SSWKKSLMEVVDFCLQR 320
           + +K++L+ +    + R
Sbjct: 312 NEYKQALISLAYLSVDR 328


>gi|170717395|ref|YP_001783470.1| polyprenyl synthetase [Haemophilus somnus 2336]
 gi|168825524|gb|ACA30895.1| Polyprenyl synthetase [Haemophilus somnus 2336]
          Length = 330

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 192/317 (60%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++ SGGKR+RPM+ L  A  L Y+GD 
Sbjct: 13  IQSLIKTDMDKVNATILAQLNSDVALINQLGYYIVQSGGKRIRPMIALLAARALNYQGDE 72

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTATLLHDDVVD+S +RRG   A   +GN  SVLVGDF+ ++AF ++ +
Sbjct: 73  PITCAAFVEFIHTATLLHDDVVDESDMRRGNPTANAEFGNAASVLVGDFIYTRAFQLMTK 132

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S   L+ +S     +AEGE++QL    + + +E++Y+ VI SKTA LF  A + +++ 
Sbjct: 133 LNSLRILQIMSDATNIIAEGEVQQLMNVNDPETSEDNYMKVIYSKTARLFEVATQCAAIT 192

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A        AL+ YG  LG AFQLVDDVLDY      +GKNIG+D   GKPTLP++ A +
Sbjct: 193 AQSNAEQEIALQHYGRYLGTAFQLVDDVLDYSANAATLGKNIGDDLAEGKPTLPLLHAMR 252

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            GT ++    +  I  G    + L     IM E ++L     +A    QKA DS+ CLP+
Sbjct: 253 NGTPQQSALIREAIEQGG-KRDFLDDVLAIMTEQKSLDYAMSKAKEEAQKAVDSISCLPE 311

Query: 304 SSWKKSLMEVVDFCLQR 320
           + +K++L+ +    ++R
Sbjct: 312 NQYKQALISLAYLSVER 328


>gi|254372879|ref|ZP_04988368.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570606|gb|EDN36260.1| octaprenyl-diphosphate synthase [Francisella novicida GA99-3549]
          Length = 325

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 200/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIAGVQNSVRQA---LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+  +    +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQGYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 244 TIYALANVTEQQQQILKKAIEKGEYRIDQI----IAMVKDSGAVDYSYKVACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  + R N
Sbjct: 300 QIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|238793005|ref|ZP_04636634.1| Octaprenyl-diphosphate synthase [Yersinia intermedia ATCC 29909]
 gi|238727605|gb|EEQ19130.1| Octaprenyl-diphosphate synthase [Yersinia intermedia ATCC 29909]
          Length = 323

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 188/315 (59%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y GD H+
Sbjct: 8   ELTAPDMANVNTTILNQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALHYEGDKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTGLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + ++++A 
Sbjct: 128 SLRVLTLMSEATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLAD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
              +   AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ATETQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I  G      L+     M++  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 TVEQAAMIRQAIEQGN-GRHLLEPVLAAMQQCGSLDYTRRRAEEEADKAIAALQILPESE 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    +QR
Sbjct: 307 YRLALEGLAHIAVQR 321


>gi|251791050|ref|YP_003005771.1| octaprenyl diphosphate synthase [Dickeya zeae Ech1591]
 gi|247539671|gb|ACT08292.1| Trans-hexaprenyltranstransferase [Dickeya zeae Ech1591]
          Length = 323

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 189/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  L+ +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEQITALSAQDMAAVNQTILDQLNSDVVLINQLGNYIIGGGGKRIRPMIAVLAARALSYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   +  +S     +AEGE+ QL    + D+TE+ Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLASLRVMSVMSDAVNVIAEGEVLQLMNCNDPDITEDSYMRVIYSKTARLFEAAAQAS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++++   +    AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILSDASSEQELALQEYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G + ++   +  I  G      L+     M+   +L  T  RA     KA  +++C
Sbjct: 243 AMHHGNEEQRIMIRQAIEQGN-GRHLLEPVLAAMQSCGSLAYTRQRAEEEADKAITAIQC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S ++ +L  +    +QR
Sbjct: 302 LPASDFRTALEGLAHLAVQR 321


>gi|149912227|ref|ZP_01900805.1| octaprenyl-diphosphate synthase [Moritella sp. PE36]
 gi|149804686|gb|EDM64738.1| octaprenyl-diphosphate synthase [Moritella sp. PE36]
          Length = 323

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/322 (40%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L+ +DM+ VN LIL R+ SDV ++  V  Y++  GGKR+RP++   +A  L Y+
Sbjct: 3   IKAIQALSKQDMDAVNELILARLQSDVALVNQVGYYIVNGGGKRIRPLIATLSARALGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHT+TLLHDDVVD+S +RRG+  A   +GN  SVLVGDFL S++F M
Sbjct: 63  GQQHVDVAAIIEFIHTSTLLHDDVVDESDMRRGRKTANAAFGNAASVLVGDFLYSRSFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  + + ++ LS     +AEGE+ QL    + D  E+ Y+ VI  KTA LF AA +++
Sbjct: 123 MAKLNNSKIIDILSDATNVIAEGEVLQLMNCNDADTDEKRYMDVIYYKTAKLFEAATQLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IA     + QA+  YG++LG AFQL+DDV+DY  +  EMGKN+G+D   GKPTLP+I 
Sbjct: 183 AVIAEQPADIEQAMIDYGVHLGAAFQLIDDVMDYTSDAQEMGKNVGDDLAEGKPTLPLIH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   GT++E    +  I      ++NL+    I+  N +L     +A    + A  ++  
Sbjct: 243 AMAHGTEQEALMVREAIEKMN-GMDNLEAILAILERNGSLNYCFDKAQQEAELAVKAIAV 301

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP+S +K++L+ +      R N
Sbjct: 302 LPESEYKQALISLAYIAANRSN 323


>gi|56708131|ref|YP_170027.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670602|ref|YP_667159.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134301942|ref|YP_001121911.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|208779313|ref|ZP_03246659.1| polyprenyl synthetase family protein [Francisella novicida FTG]
 gi|224457222|ref|ZP_03665695.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370617|ref|ZP_04986622.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874931|ref|ZP_05247641.1| polyprenyl synthetase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604623|emb|CAG45677.1| Octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320935|emb|CAL09060.1| Octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049719|gb|ABO46790.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151568860|gb|EDN34514.1| hypothetical protein FTBG_00405 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|208745113|gb|EDZ91411.1| polyprenyl synthetase family protein [Francisella novicida FTG]
 gi|254840930|gb|EET19366.1| polyprenyl synthetase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159332|gb|ADA78723.1| polyprenyl synthetase family protein [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 325

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/326 (41%), Positives = 201/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIA-GVQNSVRQA--LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+   Q+  +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQDYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 244 TIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  + R N
Sbjct: 300 QIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|271499159|ref|YP_003332184.1| Trans-hexaprenyltranstransferase [Dickeya dadantii Ech586]
 gi|270342714|gb|ACZ75479.1| Trans-hexaprenyltranstransferase [Dickeya dadantii Ech586]
          Length = 323

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 188/320 (58%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  L+ +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   LEQITALSAQDMAAVNQTILDQLNSDVVLINQLGNYIIGGGGKRIRPMIAVLAARALNYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +    S   +  +S     +AEGE+ QL    + D+TE+ Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLASLRVMSVMSDAVNVIAEGEVLQLMNCNDPDITEDSYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++++   +    AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILSDASSEQELALQEYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   ++   +  I  G      L+     M+   +L  T  RA     KA  +++C
Sbjct: 243 AMHHGNDEQRTMIRQAIEQGN-GRHLLEPVLAAMQSCGSLTYTRQRAEEEADKAITAIQC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP S ++ +L  +    +QR
Sbjct: 302 LPASDFRTALEGLAHLAVQR 321


>gi|254369351|ref|ZP_04985363.1| hypothetical protein FTAG_00322 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122301|gb|EDO66441.1| hypothetical protein FTAG_00322 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 325

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/326 (41%), Positives = 201/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVILFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIA-GVQNSVRQA--LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+   Q+  +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQDYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 244 TIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  + R N
Sbjct: 300 QIDFLPDSEYKQAMILLCDLAVNRKN 325


>gi|51594815|ref|YP_069006.1| octaprenyl diphosphate synthase [Yersinia pseudotuberculosis IP
           32953]
 gi|153949434|ref|YP_001402567.1| octaprenyl diphosphate synthase [Yersinia pseudotuberculosis IP
           31758]
 gi|170025973|ref|YP_001722478.1| octaprenyl diphosphate synthase [Yersinia pseudotuberculosis YPIII]
 gi|186893824|ref|YP_001870936.1| octaprenyl diphosphate synthase [Yersinia pseudotuberculosis PB1/+]
 gi|51588097|emb|CAH19703.1| octaprenyl-diphosphate synthase [Yersinia pseudotuberculosis IP
           32953]
 gi|152960929|gb|ABS48390.1| octaprenyl-diphosphate synthase [Yersinia pseudotuberculosis IP
           31758]
 gi|169752507|gb|ACA70025.1| Polyprenyl synthetase [Yersinia pseudotuberculosis YPIII]
 gi|186696850|gb|ACC87479.1| Polyprenyl synthetase [Yersinia pseudotuberculosis PB1/+]
          Length = 323

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 184/315 (58%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   ELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALNYQGSKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTGLQ 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE Y+ VI SKTA LF AA + +++++ 
Sbjct: 128 SMRVLTLMSEATNVIAEGEVLQLMNCNNPDITEESYMQVIYSKTARLFEAAAQSAAILSD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  E + +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ASEEQELALQNYGRYLGTAFQLIDDLLDYSAEGSTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I  G      L+     M    +LV T  RA     KA  +L  LP+S 
Sbjct: 248 TPEQAAMIRQAIEQGN-GRHLLEPVLAAMEHCGSLVYTRQRAEEEADKAIAALHALPESD 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    + R
Sbjct: 307 YRLALEGLAHISVHR 321


>gi|113460390|ref|YP_718452.1| octaprenyl-diphosphate synthase [Haemophilus somnus 129PT]
 gi|112822433|gb|ABI24522.1| octaprenyl-diphosphate synthase [Haemophilus somnus 129PT]
          Length = 326

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 192/317 (60%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++ SGGKR+RPM+ L  A  L Y+GD 
Sbjct: 9   IQSLIKTDMDKVNATILAQLNSDVALINQLGYYIVQSGGKRIRPMIALLAARALNYQGDE 68

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTATLLHDDVVD+S +RRG   A   +GN  SVLVGDF+ ++AF ++ +
Sbjct: 69  PITCAAFVEFIHTATLLHDDVVDESDMRRGNPTANAEFGNAASVLVGDFIYTRAFQLMTK 128

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S   L+ +S     +AEGE++QL    + + +E++Y+ VI SKTA LF  A + +++ 
Sbjct: 129 LNSLRILQIMSDATNIIAEGEVQQLMNVNDPETSEDNYMKVIYSKTARLFEVATQCAAIT 188

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A        AL+ YG  LG AFQLVDDVLDY      +GKNIG+D   GKPTLP++ A +
Sbjct: 189 AQSNAEQEIALQHYGRYLGTAFQLVDDVLDYSANAATLGKNIGDDLAEGKPTLPLLHAMR 248

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            GT ++    +  I  G    + L     IM E ++L     +A    QKA DS+ CLP+
Sbjct: 249 NGTPQQSALIREAIEQGG-KRDFLDDVLAIMTEQKSLDYAMSKAKEEAQKAVDSISCLPE 307

Query: 304 SSWKKSLMEVVDFCLQR 320
           + +K++L+ +    ++R
Sbjct: 308 NQYKQALISLAYLSVER 324


>gi|292486819|ref|YP_003529689.1| octaprenyl diphosphate synthase [Erwinia amylovora CFBP1430]
 gi|292900783|ref|YP_003540152.1| octaprenyl-diphosphate synthase [Erwinia amylovora ATCC 49946]
 gi|291200631|emb|CBJ47763.1| octaprenyl-diphosphate synthase [Erwinia amylovora ATCC 49946]
 gi|291552236|emb|CBA19273.1| octaprenyl diphosphate synthase [Erwinia amylovora CFBP1430]
 gi|312170887|emb|CBX79146.1| octaprenyl diphosphate synthase [Erwinia amylovora ATCC BAA-2158]
          Length = 324

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 194/321 (60%), Gaps = 2/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLT-LATALMLEY 59
           ++ + +LT +DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+  LA   + +Y
Sbjct: 3   LEQINELTAQDMADVNATILDQLNSDVSLINQLGYYIINGGGKRIRPMIAVLAARAINDY 62

Query: 60  RGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC 119
            G  H+ +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF 
Sbjct: 63  AGKQHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQ 122

Query: 120 MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           M+    S + L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + 
Sbjct: 123 MMTSLGSLKVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQS 182

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
           S+++AG   +  QAL+ YG  +G AFQL+DD+LDY  +   +GKN+G+D   GKPTLP++
Sbjct: 183 SAILAGASATEEQALQDYGRYIGTAFQLIDDLLDYSADGETLGKNVGDDLSEGKPTLPLL 242

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
            A + GT  + +  +S I +G      L+     M +  +L  T   A     KA  +L 
Sbjct: 243 HAMRNGTPEQASMIRSAIEEGN-GRHLLESVLETMNQCGSLEWTRNAAEKEADKAIAALA 301

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            LPDS W+ +L  +    +QR
Sbjct: 302 ALPDSPWRSALEALAHMSVQR 322


>gi|213971072|ref|ZP_03399192.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           T1]
 gi|301384205|ref|ZP_07232623.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060871|ref|ZP_07252412.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           K40]
 gi|302132864|ref|ZP_07258854.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924180|gb|EEB57755.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           T1]
 gi|331018359|gb|EGH98415.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 322

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 193/314 (61%), Gaps = 6/314 (1%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDIRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +     + 
Sbjct: 133 KILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCKASEAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 TEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKIS-VENLKKAFIIMRENRALVD-TEYRAYSYGQKAKDSLRCLPDSSWKK 308
              +  I  G +  +E+++ A     EN   +D T   A  Y  +A   L  LP S ++ 
Sbjct: 253 ALVRQAIQKGGLEDLESIRNAV----ENAGALDYTAQLARDYAARAIACLDALPPSEYRD 308

Query: 309 SLMEVVDFCLQRLN 322
           +L+E+ +F + R +
Sbjct: 309 ALIELSEFAVARTH 322


>gi|194290791|ref|YP_002006698.1| octaprenyl diphosphate synthase [Cupriavidus taiwanensis LMG 19424]
 gi|193224626|emb|CAQ70637.1| octaprenyl diphosphate synthase [Cupriavidus taiwanensis LMG 19424]
          Length = 345

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 191/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L TA  L Y G+ H  LA  
Sbjct: 36  DMRAVDAVIRQRLSSEVPLIEQIGEYIIGAGGKRLRPVILLLTARALGYDGNRHHELAAV 95

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   +
Sbjct: 96  VEFIHTATLLHDDVVDESELRRGRDTANAVFGNAASVLVGDFLYSRAFQMMVDAGSMRIM 155

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS     +AEGE+ QL    + DVT E YL VI+ KTA LF AA ++ ++++G    +
Sbjct: 156 EILSNATNVIAEGEVLQLLNMHDPDVTVERYLQVIRYKTAKLFEAAAQLGAVLSGADAQM 215

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG  +G AFQL+DD+LDY     +MGKN G+D R GKPTLP++   + GT  ++
Sbjct: 216 EEAAAEYGRRIGTAFQLIDDMLDYTASAEQMGKNAGDDLREGKPTLPLLHLMEHGTAEQR 275

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    E+    F  +  + AL  T   A    + A+ + R  P S+ K++L
Sbjct: 276 QLARDAIVQG--GTEHFDAVFAAIHASGALEVTFEAARREAEAAEQAARQFPPSALKETL 333

Query: 311 MEVVDFCLQR 320
           +++  F LQR
Sbjct: 334 IQLCAFSLQR 343


>gi|62260098|gb|AAX77879.1| unknown protein [synthetic construct]
          Length = 360

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/326 (41%), Positives = 201/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 30  LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYN 89

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 90  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 149

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 150 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 209

Query: 181 SLIA-GVQNSVRQA--LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+   Q+  +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 210 GVISLDKQDYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 269

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 270 TIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYADLAKQ 325

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ + D  + R N
Sbjct: 326 QIDFLPDSEYKQAMILLCDLAVNRKN 351


>gi|238797569|ref|ZP_04641066.1| Octaprenyl-diphosphate synthase [Yersinia mollaretii ATCC 43969]
 gi|238718566|gb|EEQ10385.1| Octaprenyl-diphosphate synthase [Yersinia mollaretii ATCC 43969]
          Length = 323

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 190/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   ELTAPDMAAVNTTILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALHYQGTKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTGLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + ++++A 
Sbjct: 128 SLRVLTLMSEATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLAN 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A + G
Sbjct: 188 ASEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMRNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  ++   +  I  G      L+     M++  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 TSEQEAMIRQAIEQGN-GRHLLEPVLAAMQQCGSLDYTRQRAEEEADKAIAALQILPESE 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    +QR
Sbjct: 307 YRLALEGLAHIAVQR 321


>gi|293602311|ref|ZP_06684757.1| octylprenyl diphosphate synthase [Achromobacter piechaudii ATCC
           43553]
 gi|292819073|gb|EFF78108.1| octylprenyl diphosphate synthase [Achromobacter piechaudii ATCC
           43553]
          Length = 321

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 189/310 (60%), Gaps = 3/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ V+ +I +R+ SDV +I  +  Y+I +GGKR+RP + L  A  L Y G +H LLA  
Sbjct: 13  DMKAVDAVIRERLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYEGTHHQLLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S   +
Sbjct: 73  VEFIHTATLLHDDVVDESDLRRGRETANAVFGNAASVLVGDYLYSRSFEMMVEADSMRIM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QL    + DV+++ YL V++ KTA LF AA +V +++AG     
Sbjct: 133 SILSEATTVIAEGEVLQLLNVHDPDVSQDRYLQVVRYKTAKLFEAAAQVGAVLAGATPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             A  +YG ++G AFQLVDDVLDY G+   +GKN+G+D R GKPTLP+I   + GT +++
Sbjct: 193 EAAAAAYGRHVGTAFQLVDDVLDYSGDAAALGKNVGDDLREGKPTLPLIRVMEVGTPQQQ 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G      +  A   ++   AL      A +   +A+++L   P S +  SL
Sbjct: 253 QLIRDAIKTGDADFAAVAAA---IQATDALEHARLAAVAEADRAREALSIYPVSPFLNSL 309

Query: 311 MEVVDFCLQR 320
           +E   F + R
Sbjct: 310 LEFCAFAVNR 319


>gi|332528440|ref|ZP_08404432.1| farnesyltranstransferase [Hylemonella gracilis ATCC 19624]
 gi|332042119|gb|EGI78453.1| farnesyltranstransferase [Hylemonella gracilis ATCC 19624]
          Length = 316

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 166/249 (66%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M +V+ +I +R+ S V ++  V +Y+I +GGKRLRP L L  +  L+YRG +   LA  +
Sbjct: 1   MREVDRVISERLDSGVPLVGQVARYIIGAGGKRLRPALLLLVSGALDYRGPHRHSLAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVDDS LRRG   A   +GN  SVLVGDFL S+AF M++E +S   +E
Sbjct: 61  EFIHTATLLHDDVVDDSKLRRGNPTANETFGNAASVLVGDFLYSRAFQMMVEAQSMRVME 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            L+     +AEGE++QL    N D+ E  Y+HVI+SKTA LF A+    +++AG   ++ 
Sbjct: 121 VLAEATNVIAEGEVQQLMNMHNADLNEAGYVHVIRSKTAKLFEASARCGAILAGADKTLE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
            A   YG  LG AFQ++DDVLDY G+ + MGK++G+D R GK TLP+I A QRGT+ E+ 
Sbjct: 181 AACADYGQALGTAFQVIDDVLDYAGDAHVMGKSLGDDLREGKATLPLIAAMQRGTESERQ 240

Query: 252 FWKSTINDG 260
             +S I  G
Sbjct: 241 RIRSAIESG 249


>gi|52425655|ref|YP_088792.1| IspA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307707|gb|AAU38207.1| IspA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 358

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM+KVN  IL ++ SDV +I  +  Y+I SGGKR+RPM+    A  L Y+
Sbjct: 38  IKTIQALVSDDMQKVNEEILAQLNSDVPLINQLGYYIIHSGGKRIRPMIANLAAKALNYQ 97

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            + H+  A  IEF+HTATLLHDDVVD+S +RRG   A   +GN  SVLVGD++ +++F M
Sbjct: 98  DNKHITCAAFIEFLHTATLLHDDVVDESDMRRGNPTANAEFGNAASVLVGDYMHTRSFQM 157

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E  S   L+ +S     +AEGE++QL   ++ D TE++Y+ VI SKTA LF  + +  
Sbjct: 158 MTELGSLRILQVMSAATNVIAEGEVQQLMNVRDPDTTEQNYMKVIYSKTARLFEVSTQTV 217

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    ++ + L++YG  LG AFQLVDD+LDY      +GKNIG+D   GKPTLP++ 
Sbjct: 218 AILADAGAAIEEGLQNYGRYLGTAFQLVDDILDYSANAATLGKNIGDDLAEGKPTLPLLH 277

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + G  ++    ++ I  G  + + L +   IM E+++L      A    QKA D+L  
Sbjct: 278 AMRHGNPQQAELIRNIILQGG-NRDALDEVLTIMHEHKSLDYAMEHAKQEAQKAVDALAP 336

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LPD+ +K++++ +    + R
Sbjct: 337 LPDNIYKRAMISLAYLSVDR 356


>gi|163858994|ref|YP_001633292.1| putative octaprenyl-diphosphate synthase [Bordetella petrii DSM
           12804]
 gi|163262722|emb|CAP45025.1| putative octaprenyl-diphosphate synthase [Bordetella petrii]
          Length = 308

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 192/309 (62%), Gaps = 3/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M+ V+ +I  R+ S+V +I  +  Y+I +GGKR+RP + L  A  L Y+G++H LLA  +
Sbjct: 1   MKAVDAVIRGRLDSEVVLIRTIADYIIGAGGKRMRPAMVLMMARALGYQGEHHRLLAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGD+L S++F M++E  S   ++
Sbjct: 61  EFIHTATLLHDDVVDESDLRRGRETANAMFGNAASVLVGDYLYSRSFEMMVEAGSMRIMQ 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE+ QL    + DV++  YL V++ KTA LF AA +V +++AG      
Sbjct: 121 ILSEATTIIAEGEVLQLLNVHDPDVSQARYLQVVRYKTAKLFEAAAQVGAVLAGASPEQE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +A  +YG ++G AFQLVDDVLDY G+   +GKN+G+D R GKPTLP+I   + G  +++ 
Sbjct: 181 EAAAAYGRHIGTAFQLVDDVLDYSGDAQALGKNVGDDLREGKPTLPLIRVMETGAPQQRE 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             ++ I  G      + +A   ++   AL      A +    A+ +L  LP S ++KSL+
Sbjct: 241 LIRNAIKTGDADFAAVAQA---IQATDALEHARQAALAEADAARQALAGLPISVYQKSLL 297

Query: 312 EVVDFCLQR 320
           E   F + R
Sbjct: 298 EFCAFAVNR 306


>gi|261378364|ref|ZP_05982937.1| octaprenyl-diphosphate synthase [Neisseria cinerea ATCC 14685]
 gi|269145472|gb|EEZ71890.1| octaprenyl-diphosphate synthase [Neisseria cinerea ATCC 14685]
          Length = 324

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/332 (40%), Positives = 208/332 (62%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQKHLSEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGRS 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDNEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE+Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEEYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V S++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGSILGNAPPECEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND ++++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRLALENADRSY-FAKIHEYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K++++ +    L R++
Sbjct: 293 VDCAIAALDTLPDSEAKEAMIRLAQESLVRVS 324


>gi|113869207|ref|YP_727696.1| trans-hexaprenyltranstransferase [Ralstonia eutropha H16]
 gi|113527983|emb|CAJ94328.1| Trans-hexaprenyltranstransferase [Ralstonia eutropha H16]
          Length = 328

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 190/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L TA  + Y G+ H  LA  
Sbjct: 19  DMRAVDAVIRQRLSSEVPLIEQIGEYIIGAGGKRLRPVILLLTARAMGYDGNRHHELAAV 78

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   +
Sbjct: 79  VEFIHTATLLHDDVVDESELRRGRDTANAVFGNAASVLVGDFLYSRAFQMMVDAGSMRIM 138

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS     +AEGE+ QL    + DVT E YL VI+ KTA LF AA ++ +++AG    +
Sbjct: 139 EILSNATNVIAEGEVLQLLNMHDPDVTVERYLQVIRYKTAKLFEAAAQLGAVLAGADAQM 198

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG  +G AFQL+DD+LDY     +MGKN G+D R GKPTLP++   + GT  ++
Sbjct: 199 EEAAAEYGRRIGTAFQLIDDMLDYTASAEQMGKNAGDDLREGKPTLPLLHLLEHGTPEQR 258

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    E+    F  +  + AL  T   A    + A+ + R  P S  K++L
Sbjct: 259 QLARDAIVRG--GTEHFDAVFAAIHASGALDVTFEAARREAEAAEQAARQFPPSELKETL 316

Query: 311 MEVVDFCLQR 320
           +++  F LQR
Sbjct: 317 IQLCAFSLQR 326


>gi|160871595|ref|ZP_02061727.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Rickettsiella
           grylli]
 gi|159120394|gb|EDP45732.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase) [Rickettsiella
           grylli]
          Length = 322

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 189/314 (60%), Gaps = 2/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  KD+++V+ LI + + +D+ +IP + K+LI SGGKRLRP++ L +A    Y+G  H  
Sbjct: 9   LVKKDLDEVDALINRCLYADIPLIPQLAKHLINSGGKRLRPLIALLSAKAFGYQGKEHRR 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA ++E IH ATLLHDDV+D S LRRGK  A  +WGN  SVLVGDFL S+AF ++ +  +
Sbjct: 69  LAASLELIHGATLLHDDVIDGSVLRRGKKTANSLWGNSASVLVGDFLYSRAFQLISQINN 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L +L+    TLA+ E+ QL    N+DV E   L VI+ KT VLFS A E  +++   
Sbjct: 129 SRVLTSLADATNTLAQSEVLQLINCYNVDVDEAYCLKVIQGKTGVLFSIAAEQPAMLTER 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             +   A+  YGM+LGIAFQL+DD LDY G+  ++GK++G D   GKPTLP+I A Q  +
Sbjct: 189 PEAEISAMAHYGMHLGIAFQLIDDSLDYSGDPQQLGKSLGNDLSEGKPTLPIIYALQHAS 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +    K+ +  G      L     I++   AL  T   A  Y +K+   L  +PDS +
Sbjct: 249 AEQAQLLKTALTQG--DQNKLMTIIPILQSTSALEYTRTLARHYIEKSLTYLNLIPDSDY 306

Query: 307 KKSLMEVVDFCLQR 320
           +++L  +  F ++R
Sbjct: 307 RQALAHLTTFAIER 320


>gi|152985492|ref|YP_001350541.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa PA7]
 gi|150960650|gb|ABR82675.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa PA7]
          Length = 322

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D   V+ +I +++ S V ++  +  Y+I +GGKRLRP+L L     L Y+GD+  LLA 
Sbjct: 12  EDFTAVDGIIRRQLTSRVPLVEKIGDYIISAGGKRLRPLLVLLAGKTLGYKGDDLCLLAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEF+HT+TLLHDDVVD S LRRG+  A  +WGN  SVLVGDFL +++F M++E  S   
Sbjct: 72  TIEFLHTSTLLHDDVVDASGLRRGRSTANALWGNAPSVLVGDFLYARSFEMMVELGSMPV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +  +S     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +      
Sbjct: 132 MRIISQATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALCRAGEE 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL+ +G  LGIAFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I+  + GT+ +
Sbjct: 192 QAEALRRFGDYLGIAFQLVDDLLDYRGDAATLGKNVGDDLAEGKPTLPLIVTMRDGTEEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               +  I  G    ++L+     +    AL  T   A  Y  +A   L  LPD+ ++ +
Sbjct: 252 AALVRKAIQQG--GSQDLESVCAAVEAAGALDYTANLARDYAARAIACLESLPDNEYRAA 309

Query: 310 LMEVVDFCLQRLN 322
           L+E+ +F + R +
Sbjct: 310 LVELSEFAVARTH 322


>gi|121998628|ref|YP_001003415.1| trans-hexaprenyltranstransferase [Halorhodospira halophila SL1]
 gi|121590033|gb|ABM62613.1| Trans-hexaprenyltranstransferase [Halorhodospira halophila SL1]
          Length = 323

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 191/321 (59%), Gaps = 3/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  + +L   DM +VN LI +R+ SDV +I  +  +++ SGGKRLRPM+ L  A    Y+
Sbjct: 3   LDAIRELAADDMAEVNRLIEERLSSDVVLINQLAYHIVHSGGKRLRPMVVLLAARACGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +HV LA  IEFIHTATLLHDDVVD S +RRGK  A  +WGN+ SVLVGDFL ++AF M
Sbjct: 63  GKDHVQLAAIIEFIHTATLLHDDVVDGSDMRRGKQTAHTIWGNEASVLVGDFLYTRAFEM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S   L  L+    T+A GE+ QL      D+TE DY  VI  KTA LF A  +  
Sbjct: 123 MVELDSMAVLRILARATNTIARGEVMQLMNVHEPDLTEADYRQVIYRKTATLFEAGCQNG 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG+ ++  +AL +YG +LG A+QLVDD LDY G+ +E+GKNIG+D   GK T+P+I 
Sbjct: 183 AVLAGLDDAGCEALAAYGRHLGTAYQLVDDALDYSGDASEIGKNIGDDLAEGKTTMPLIH 242

Query: 241 AFQRGTKREKNFWKSTINDGKI-SVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
           A + G   +++  +  I  G +  +E + +A  I +   A            Q  +    
Sbjct: 243 AMREGEPADRDLIRQAIEAGGLDQMEAVGRA--IEKTGSAEYTRRLAEVEVEQAVEQLTS 300

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            +P S W+ +L+ +    + R
Sbjct: 301 AVPGSPWRDALVHLARNSISR 321


>gi|238761751|ref|ZP_04622725.1| Octaprenyl-diphosphate synthase [Yersinia kristensenii ATCC 33638]
 gi|238699865|gb|EEP92608.1| Octaprenyl-diphosphate synthase [Yersinia kristensenii ATCC 33638]
          Length = 323

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/315 (41%), Positives = 189/315 (60%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DLT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   DLTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALGYQGTKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + +++++ 
Sbjct: 128 SLRVLTLMSAATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAILSD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                   L++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A + G
Sbjct: 188 ATPEQELTLQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMRNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I +G      L+   + M++  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 TSEQAAMIRQAIEEGN-GRHLLEPVLVAMQQCGSLDYTRQRAEEEADKAIAALQILPESE 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++ +L  +    +QR
Sbjct: 307 YRLALEGLAHIAVQR 321


>gi|254495951|ref|ZP_05108859.1| octaprenyl diphosphate synthase IspB [Legionella drancourtii
           LLAP12]
 gi|254354829|gb|EET13456.1| octaprenyl diphosphate synthase IspB [Legionella drancourtii
           LLAP12]
          Length = 322

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 198/312 (63%), Gaps = 2/312 (0%)

Query: 9   LKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           + D   VN LI+ +I S + +I D+  ++I SGGKRLRP+L L  +    Y+G+ H+ LA
Sbjct: 11  IDDFNAVNALIVNKIESQIGLIDDMSHHVIESGGKRLRPLLVLLASNACSYQGNAHIALA 70

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
             +EF HTATLLHDDVVD+S LRRG+  A  +WG++ S+LVGD+L +Q+  +++++ +  
Sbjct: 71  AMVEFFHTATLLHDDVVDESTLRRGRETANNIWGSKASILVGDYLFTQSIELMVDSGNPA 130

Query: 129 ALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQN 188
            L+  +  A  ++ GE++QLS   N  +T E+Y  VI++KTA+LF+AA  +  +++    
Sbjct: 131 ILKLFANTALEISCGEVKQLSNRHNPALTFEEYFDVIRAKTALLFAAAACIGPMLSDASK 190

Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248
            V+ +L +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q G++R
Sbjct: 191 EVQDSLYAYGLHLGNAFQLIDDALDYCSDAKTIGKNIGDDLADGKATLPLIHALQHGSER 250

Query: 249 EKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKK 308
           +K     ++  G  S+E L +  I + E +A+  T+  A      A   L  LPDS +K 
Sbjct: 251 QKQQIIESLKKG--SLEFLPEILIALEETKAIEYTKKVAAQEIDTALSFLMVLPDSKYKN 308

Query: 309 SLMEVVDFCLQR 320
           +L ++  F LQR
Sbjct: 309 ALTQLAQFALQR 320


>gi|15599765|ref|NP_253259.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa PAO1]
 gi|107099768|ref|ZP_01363686.1| hypothetical protein PaerPA_01000786 [Pseudomonas aeruginosa PACS2]
 gi|116052711|ref|YP_793028.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893664|ref|YP_002442533.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa LESB58]
 gi|254238683|ref|ZP_04932006.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa C3719]
 gi|254244534|ref|ZP_04937856.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa 2192]
 gi|296391383|ref|ZP_06880858.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa PAb1]
 gi|313107214|ref|ZP_07793413.1| octylprenyl diphosphate synthase [Pseudomonas aeruginosa 39016]
 gi|9950815|gb|AAG07957.1|AE004870_8 octaprenyl-diphosphate synthase [Pseudomonas aeruginosa PAO1]
 gi|115587932|gb|ABJ13947.1| octylprenyl diphosphate synthase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126170614|gb|EAZ56125.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa C3719]
 gi|126197912|gb|EAZ61975.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa 2192]
 gi|218773892|emb|CAW29706.1| octaprenyl-diphosphate synthase [Pseudomonas aeruginosa LESB58]
 gi|310879915|gb|EFQ38509.1| octylprenyl diphosphate synthase [Pseudomonas aeruginosa 39016]
          Length = 322

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D   V+ +I +++ S V ++  +  Y+I +GGKRLRP+L L     L Y+GD+  LLA 
Sbjct: 12  EDFTAVDGIIRRQLTSRVPLVEKIGDYIISAGGKRLRPLLVLLAGKTLGYKGDDLCLLAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEF+HT+TLLHDDVVD S LRRG+  A  +WGN  SVLVGDFL +++F M++E  S   
Sbjct: 72  TIEFLHTSTLLHDDVVDASGLRRGRSTANALWGNAPSVLVGDFLYARSFEMMVELGSMPV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +  +S     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +      
Sbjct: 132 MRIISQATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALCQAGEE 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL+ +G  LGIAFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I+  + GT+ +
Sbjct: 192 QSEALRRFGDYLGIAFQLVDDLLDYRGDAATLGKNVGDDLAEGKPTLPLIVTMRDGTEEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               +  I  G    ++L+     +    AL  T   A  Y  +A   L  LPD+ ++ +
Sbjct: 252 AALVRKAIQQG--GSQDLESVCAAVEAAGALDYTANLARDYAARAIACLDTLPDNEYRSA 309

Query: 310 LMEVVDFCLQRLN 322
           L+E+ +F + R +
Sbjct: 310 LVELSEFAVARTH 322


>gi|49083716|gb|AAT51120.1| PA4569 [synthetic construct]
          Length = 323

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D   V+ +I +++ S V ++  +  Y+I +GGKRLRP+L L     L Y+GD+  LLA 
Sbjct: 12  EDFTAVDGIIRRQLTSRVPLVEKIGDYIISAGGKRLRPLLVLLAGKTLGYKGDDLCLLAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEF+HT+TLLHDDVVD S LRRG+  A  +WGN  SVLVGDFL +++F M++E  S   
Sbjct: 72  TIEFLHTSTLLHDDVVDASGLRRGRSTANALWGNAPSVLVGDFLYARSFEMMVELGSMPV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +  +S     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +      
Sbjct: 132 MRIISQATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALCQAGEE 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +AL+ +G  LGIAFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I+  + GT+ +
Sbjct: 192 QSEALRRFGDYLGIAFQLVDDLLDYRGDAATLGKNVGDDLAEGKPTLPLIVTMRDGTEEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               +  I  G    ++L+     +    AL  T   A  Y  +A   L  LPD+ ++ +
Sbjct: 252 AALVRKAIQQG--GSQDLESVCAAVEAAGALDYTANLARDYAARAIACLDTLPDNEYRSA 309

Query: 310 LMEVVDFCLQRLN 322
           L+E+ +F + R +
Sbjct: 310 LVELSEFAVARTH 322


>gi|254293445|ref|YP_003059468.1| trans-hexaprenyltranstransferase [Hirschia baltica ATCC 49814]
 gi|254041976|gb|ACT58771.1| Trans-hexaprenyltranstransferase [Hirschia baltica ATCC 49814]
          Length = 340

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 198/321 (61%), Gaps = 1/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  L +L  +D+  V  L+ +R  S V  IPD+  YLI +GGKRLRP++TLA A     +
Sbjct: 18  MDTLTELVAEDLSSVEALLSERAISSVATIPDMSAYLIGAGGKRLRPLITLAAAYAAGGK 77

Query: 61  GDNHVL-LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC 119
           G   +  LA A+E+IHTATLLHDDVVD+S LRRGK AA+++WGN  S+LVGDFL ++AF 
Sbjct: 78  GSAPLHSLAAAVEYIHTATLLHDDVVDESDLRRGKKAAKMLWGNSASILVGDFLFARAFT 137

Query: 120 MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           +++ET+S   L+ LS  +C +AEGE++QL+     D+  EDY+ ++++KTA LF AA   
Sbjct: 138 LMVETRSLRILDILSNASCVIAEGEVKQLAAIGKADLPIEDYMDIVEAKTAALFEAAARA 197

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            +L    +      L  YG  LG AFQLVDD LDY G  + +GK++G+DFR GK TLPV+
Sbjct: 198 GALTVVAEGKESDGLAEYGRRLGRAFQLVDDALDYDGSTSVIGKSVGDDFREGKLTLPVL 257

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
           LA + G    + FW   ++  K +  +L  A   +R+   +  T   A     KAK +L 
Sbjct: 258 LAREHGDADARAFWDRAMDVSKQTEADLDIAIDYIRKADTVKATLDAARDEVAKAKAALE 317

Query: 300 CLPDSSWKKSLMEVVDFCLQR 320
            LP S +  +L ++ DF + R
Sbjct: 318 VLPSSEYVDALADIADFVVDR 338


>gi|222109984|ref|YP_002552248.1| polyprenyl synthetase [Acidovorax ebreus TPSY]
 gi|221729428|gb|ACM32248.1| Polyprenyl synthetase [Acidovorax ebreus TPSY]
          Length = 327

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 178/274 (64%), Gaps = 2/274 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM++V+ +I  R+ S V ++ +V +Y+I +GGKRLRP L L  +  L Y G     
Sbjct: 14  LIADDMQEVDKVIASRLQSAVPLVGEVARYIISAGGKRLRPALLLLMSGALGYTGSQRFN 73

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL ++AF M++ET S
Sbjct: 74  LAAVVEFIHTATLLHDDVVDESTLRRGRPTANENFGNPASVLVGDFLYTRAFQMMVETSS 133

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E L+     +AEGE++QL  + +  ++E  YL+VI+SKTA LF A+  +++++A  
Sbjct: 134 LRVMEILAEATNVIAEGEVQQLMNTHDASLSESGYLNVIRSKTAKLFEASARLAAVLAAS 193

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              +  A  SYG  LG AFQ++DDVLDY G  +EMGKN+G+D R GK TLP+I+A QRG 
Sbjct: 194 PPEIEHACASYGQALGTAFQVIDDVLDYDGNAHEMGKNLGDDLREGKVTLPLIIAMQRGN 253

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRAL 280
            +E+   +S I  G  S + L     I+++  AL
Sbjct: 254 TQEQALLRSIIETG--STDELSSVISIIKKTGAL 285


>gi|28868024|ref|NP_790643.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851260|gb|AAO54338.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|330878952|gb|EGH13101.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330966393|gb|EGH66653.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 322

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 190/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDIRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +     + 
Sbjct: 133 KILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCKASEAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 TEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 IELSEFAVARTH 322


>gi|325277088|ref|ZP_08142742.1| polyprenyl synthetase [Pseudomonas sp. TJI-51]
 gi|324097770|gb|EGB95962.1| polyprenyl synthetase [Pseudomonas sp. TJI-51]
          Length = 322

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 197/312 (63%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +A   ++ 
Sbjct: 133 QILSKATRVIAEGEVLQLSRVRDASTTEEVYMEVIRGKTAMLFEASTHSAAALAEATDAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTLPLIYTMREGTAEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L++  + + E+ AL  T   A  Y ++A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLEQIRVAVEESGALQYTAELARDYVKRAIACLEVLPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|332160062|ref|YP_004296639.1| octaprenyl diphosphate synthase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607378|emb|CBY28876.1| octaprenyl-diphosphate synthase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664292|gb|ADZ40936.1| octaprenyl diphosphate synthase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862049|emb|CBX72215.1| octaprenyl-diphosphate synthase [Yersinia enterocolitica W22703]
          Length = 323

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DLT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   DLTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALGYQGTKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRSFQMMTSLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + +++++ 
Sbjct: 128 SLRVLTLMSDATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAASQSAAVLSD 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ATEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I +G      L+   + M++  +L  T  RA     KA  +L+ LP+S 
Sbjct: 248 TPEQAAMIRQAIEEGN-GRHLLEPVLVAMQQCGSLDYTRQRAEEEADKAIAALQVLPESD 306

Query: 306 WKKSLMEVVDFCLQR 320
            + +L  +    +QR
Sbjct: 307 HRLALEGLAHIAVQR 321


>gi|78484685|ref|YP_390610.1| trans-hexaprenyltranstransferase [Thiomicrospira crunogena XCL-2]
 gi|78362971|gb|ABB40936.1| polyprenyl synthetase [Thiomicrospira crunogena XCL-2]
          Length = 321

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 198/319 (62%), Gaps = 7/319 (2%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K+++D    D+E  + LIL ++ SDV +I  +  Y+I SGGKRLRP+L L +A   +Y+G
Sbjct: 8   KLIQD----DIEATDQLILSKLSSDVVLINQIGHYIINSGGKRLRPLLVLLSAHACDYKG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H+ LA  IEFIHT+TLLHDDVVD+S  RRG   A  VWGN  SVLVGDFL S++F M+
Sbjct: 64  KDHLTLAAVIEFIHTSTLLHDDVVDESETRRGNQTANEVWGNAASVLVGDFLYSRSFEMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           +E      +E +S     +AEGE+ QL    + D T + Y+ VI  KTA LF AA  +  
Sbjct: 124 VEPGIMRVMEVMSETTNVIAEGEVLQLLNCHDADTTSQRYMEVIHRKTAKLFEAATLLGP 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++ G +  +  A  SYG +LG AFQL+DD LDY  + +E+GKN+G+D   GKPTLP+I  
Sbjct: 184 IL-GKKPELESAFSSYGRHLGAAFQLIDDALDYTADADELGKNLGDDLAEGKPTLPLIYV 242

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            + GT+ EK+  +  I    I +  LK+   I++ + A+  T+  A    +KAK +L  L
Sbjct: 243 LENGTENEKSLIRKAIETEGIKL--LKEVTSIIQTSGAIQYTQEVATQEAEKAKAALAPL 300

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            DS  K++L+ + D  +QR
Sbjct: 301 NDSEIKQALLSLADLAVQR 319


>gi|229592556|ref|YP_002874675.1| octaprenyl-diphosphate synthase [Pseudomonas fluorescens SBW25]
 gi|229364422|emb|CAY52224.1| octaprenyl-diphosphate synthase [Pseudomonas fluorescens SBW25]
          Length = 322

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 190/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDGIIKKQLTSKVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRETANAMWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ + G     
Sbjct: 133 KILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALCGATVEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 AEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+     +  + +L  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRKAIQKGGI--EDLEAIRAAVEASGSLEYTAQLARDYVARAIKCLEALPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|56459585|ref|YP_154866.1| geranylgeranyl pyrophosphate synthase [Idiomarina loihiensis L2TR]
 gi|56178595|gb|AAV81317.1| Geranylgeranyl pyrophosphate synthase [Idiomarina loihiensis L2TR]
          Length = 324

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 134/321 (41%), Positives = 191/321 (59%), Gaps = 1/321 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+ +  L   DM  VN LI +++ SDV +I  +  Y++ SGGKRLRP+L +     L Y 
Sbjct: 4   MQSINALAKDDMLGVNALIGEQLQSDVALINQLGLYIVNSGGKRLRPLLAILACRALGYE 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H  LA  IEFIHTATLLHDDVVD+S LRRG+  A  V+GN+ SVLVGDFL ++AF +
Sbjct: 64  GNDHRKLATIIEFIHTATLLHDDVVDESELRRGRKTANAVFGNEASVLVGDFLYTRAFQL 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++  S   L  L+     ++EGE+ QL    + D +E  Y +VI  KTA LF AA E++
Sbjct: 124 MVDLDSLRILRILADATNIISEGEVLQLMNCNDPDTSEASYFNVIYGKTAKLFEAATELA 183

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++      V Q L  YG  LG AFQLVDD++DY  +   MGKN G+D   GKPTLP++ 
Sbjct: 184 GVLTAQDEKVTQQLADYGRYLGTAFQLVDDLMDYTADSESMGKNAGDDLAEGKPTLPLLY 243

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G + E+   +  I  G    E+L+     M    AL  T  +A    ++A++SL  
Sbjct: 244 AMWHGNEIEQKLIREAIEQGD-GREHLQTVLTAMERTGALQYTRDKALEAAEQARESLSE 302

Query: 301 LPDSSWKKSLMEVVDFCLQRL 321
           LPDS +K++L+ +    + R+
Sbjct: 303 LPDSDYKQALLTLTHLAVDRV 323


>gi|312962998|ref|ZP_07777484.1| octaprenyl-diphosphate synthase [Pseudomonas fluorescens WH6]
 gi|311282767|gb|EFQ61362.1| octaprenyl-diphosphate synthase [Pseudomonas fluorescens WH6]
          Length = 322

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 190/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I +++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDGIIKQQLTSKVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRETANAMWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ + G     
Sbjct: 133 KILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALCGASAEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 AEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+     +  + +L  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRKAIQKGGI--EDLESIRAAVEASGSLDYTAQLARDYVARAIKCLEALPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|330504899|ref|YP_004381768.1| polyprenyl synthetase [Pseudomonas mendocina NK-01]
 gi|328919185|gb|AEB60016.1| polyprenyl synthetase [Pseudomonas mendocina NK-01]
          Length = 322

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 195/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I +++ S V ++  +  Y+I +GGKRLRP+L L +   L Y+ D+  LLA  
Sbjct: 13  DFTAVDAIIRQQVVSRVPLVEKIGDYIISAGGKRLRPLLVLLSGRALGYQADDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSDMRRGRSTANAQWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG   + 
Sbjct: 133 KILSHATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHAAAALAGANEAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LGIAFQLVDD+LDY+G+  E+GKN+G+D   GKPTLP+I   + GT+ + 
Sbjct: 193 REALRTFGDHLGIAFQLVDDLLDYKGDAAELGKNVGDDLAEGKPTLPLIYTMREGTEEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+     +    AL  T   A  Y ++A   L  LP   ++ +L
Sbjct: 253 ALVRRAIQKGGI--EDLESIRAAVDAAGALDYTAQLARDYAERAIACLDVLPAGEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+  F + R +
Sbjct: 311 IELSRFAVARTH 322


>gi|66043965|ref|YP_233806.1| trans-hexaprenyltranstransferase [Pseudomonas syringae pv. syringae
           B728a]
 gi|289674837|ref|ZP_06495727.1| trans-hexaprenyltranstransferase [Pseudomonas syringae pv. syringae
           FF5]
 gi|63254672|gb|AAY35768.1| Trans-hexaprenyltranstransferase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330941237|gb|EGH44102.1| trans-hexaprenyltranstransferase [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330954228|gb|EGH54488.1| trans-hexaprenyltranstransferase [Pseudomonas syringae Cit 7]
 gi|330977523|gb|EGH77469.1| trans-hexaprenyltranstransferase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 322

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 189/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDVRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +       
Sbjct: 133 KILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNAPQEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|197333941|ref|YP_002155036.1| octaprenyl-diphosphate synthase [Vibrio fischeri MJ11]
 gi|197315431|gb|ACH64878.1| octaprenyl-diphosphate synthase [Vibrio fischeri MJ11]
          Length = 323

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 190/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM  VN  IL ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y G
Sbjct: 4   KAIQALTADDMAIVNETILAQLNSDVALINQLGFYIVSGGGKRLRPVLAILSAKALGYEG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  KDHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAEFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S + L  +S     +AEGE+ QL    + + TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TSLGSIKILSLMSEAVNVIAEGEVLQLMNCNDPNTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      +  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPQEIETALQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G K +    +  I +G   ++ L      M E  +L  T+ +A     KA   L  L
Sbjct: 244 MMHGNKEQNAMIREAIENGN-GLDKLDPILACMEEVGSLEYTKQKADEEADKAIAELATL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L  +    ++R
Sbjct: 303 PESDYKEALKALAHLAVKR 321


>gi|254363100|ref|ZP_04979154.1| octaprenyl-diphosphate synthase [Mannheimia haemolytica PHL213]
 gi|153094987|gb|EDN75550.1| octaprenyl-diphosphate synthase [Mannheimia haemolytica PHL213]
          Length = 315

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 192/314 (61%), Gaps = 5/314 (1%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN  IL ++ S+V +I  +  Y+I  GGKR+RP++ +  A  L YRG  H+  A  
Sbjct: 1   DMQAVNAEILAQLNSEVLLINQLGHYIIAGGGKRIRPLIAVLAARALGYRGKKHITAAAF 60

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ +++F M+ +  S   L
Sbjct: 61  IEFVHTATLLHDDVVDESDMRRGRPTANAHFGNAASVLVGDFIYTRSFQMMTDLDSLRVL 120

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + +S     LAEGE++QL    + + TE +Y+ VI +KTA LF AA +  ++ A     +
Sbjct: 121 KVMSAATNALAEGEVQQLMNVNDPNTTEANYMRVIYNKTARLFEAATQCVAIAADASEEI 180

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             ALK+YG  LG AFQL+DD+LDY  +   +GKN+G+DF  GKPTLP++ A     K  K
Sbjct: 181 ETALKNYGCYLGTAFQLIDDILDYSAQSESLGKNVGDDFVEGKPTLPLLHAMHAADKAGK 240

Query: 251 N----FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
                  ++ I +G   +E + +   IM+E+++L     +A    QKA DSL  LP+S +
Sbjct: 241 TTQAELIRNAIENGG-ELEQIPQVLAIMQEHQSLDYAMQKAREEAQKAVDSLGVLPESEY 299

Query: 307 KKSLMEVVDFCLQR 320
           K++L+ +    + R
Sbjct: 300 KQALVSLAYLSVDR 313


>gi|59710884|ref|YP_203660.1| octaprenyl diphosphate synthase [Vibrio fischeri ES114]
 gi|59478985|gb|AAW84772.1| octaprenyl diphosphate synthase [Vibrio fischeri ES114]
          Length = 323

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 130/319 (40%), Positives = 192/319 (60%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM  VN  IL ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y G
Sbjct: 4   KAIQALTADDMAIVNETILAQLNSDVALINQLGFYIVSGGGKRLRPVLAILSAKALGYEG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  KDHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAEFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S + L  +S     +AEGE+ QL    + + TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TSLGSIKILSLMSEAVNVIAEGEVLQLMNCNDPNTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      +  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNDAPQEIETALQNYGKYLGTAFQLIDDVMDYTSDGKDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G + +    +  I +G   ++ L+     M+E  +L  T+ +A     KA   L  L
Sbjct: 244 MMHGNEEQNAMIREAIENGN-GLDKLEPILACMKEVGSLEYTKQKADEEADKAIAELAIL 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L  +    ++R
Sbjct: 303 PESDYKEALKALAHLAVKR 321


>gi|297183903|gb|ADI20025.1| geranylgeranyl pyrophosphate synthase [uncultured gamma
           proteobacterium EB000_65A11]
          Length = 321

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 129/311 (41%), Positives = 189/311 (60%), Gaps = 4/311 (1%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ LI   + + V ++ ++  YLI +GGKRLRP+L L  A    Y+   H+ LA  
Sbjct: 12  DFSAVDVLIKSSLVTRVPLVEEISTYLIEAGGKRLRPLLVLLAARACNYQQHQHINLATI 71

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTA LLHDDVVD+S LRRG+      WGN  SVLVGDFL S+AF M++E      +
Sbjct: 72  IEFLHTAMLLHDDVVDESDLRRGRKTVNAAWGNPASVLVGDFLHSRAFEMMVEIGDLRVM 131

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS    T+AEGE++QL   +N D TE+ Y+ VI  KTA+LF AA    +++AG     
Sbjct: 132 EILSHATNTIAEGEVQQLGNIRNPDATEQSYIEVINRKTAMLFEAASHSGAVLAGASPEQ 191

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             +L+ YG +LG+AFQL+DD+LDY G   ++GKN+G+DF  GK TLP+I+A + G+  + 
Sbjct: 192 ELSLQQYGCHLGVAFQLIDDILDYEGSTEQLGKNVGDDFAEGKVTLPLIVAMRNGSPEQA 251

Query: 251 NFWKSTINDGKIS-VENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +  +  I  G+++ ++NL K    ++    L  TE  A +   KA   L  LP S +K +
Sbjct: 252 STVRQAILTGEVADIDNLLKT---VKATGGLQYTEALAVAEIDKATACLEKLPSSVYKDA 308

Query: 310 LMEVVDFCLQR 320
           + ++  + + R
Sbjct: 309 MHDLARYSINR 319


>gi|313200295|ref|YP_004038953.1| trans-hexaprenyltranstransferase [Methylovorus sp. MP688]
 gi|312439611|gb|ADQ83717.1| Trans-hexaprenyltranstransferase [Methylovorus sp. MP688]
          Length = 309

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 187/309 (60%), Gaps = 2/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M+ V+ +I K + SDV +I  V +Y+I  GGKRLRP L L +A         H  LA  +
Sbjct: 1   MQAVDAVIRKSLHSDVVLINQVAEYIINGGGKRLRPALVLLSAGAFGEVNARHHELAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+SA+RRG+  A  ++GN  SVLVGDF+ S+AF M++  +S   +E
Sbjct: 61  EFIHTATLLHDDVVDESAMRRGRATANTLFGNAASVLVGDFIYSRAFQMMVGVESMRVME 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            L+     +AEGE+ QL    + D+T+E YL VI  KTA LF AA  + ++I        
Sbjct: 121 VLAEATNIIAEGEVLQLLNVHDADITDEAYLKVIHYKTAKLFEAATRLGAIICSASEQDE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           QA+  YGM LG AFQL+DDVLD+ G+  E+GKN+G+D   GKPTLP+++A + GT  +  
Sbjct: 181 QAMAEYGMRLGTAFQLIDDVLDFSGDSQEIGKNLGDDLAEGKPTLPLLIAMRLGTTAQAQ 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I +G   ++ L      + E  AL      A    +   D+++ LPDS  +++L+
Sbjct: 241 TIRKAIEEG--GLDELPAVMQAVHETGALDQVRAIARQEAKAGCDAIQHLPDSPSRQALL 298

Query: 312 EVVDFCLQR 320
           ++ +F + R
Sbjct: 299 KLAEFAVDR 307


>gi|300690362|ref|YP_003751357.1| octaprenyl diphosphate synthase [Ralstonia solanacearum PSI07]
 gi|299077422|emb|CBJ50048.1| octaprenyl diphosphate synthase [Ralstonia solanacearum PSI07]
          Length = 322

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 193/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L YRG +H  LA 
Sbjct: 12  EDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANALGYRGKHHHELAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 72  VVEFIHTATLLHDDVVDESELRRGRRTANAVFGNAASVLVGDFLYSRAFQMMVQADSMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 132 MQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 192 TEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLREGKPTLPLIHLLSHGTEEQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A +++  LP S + ++
Sbjct: 252 RALARQAIEQG--GTEHFDAIFAAIQASGALEYTRKTAEREASAAAEAINALPPSLFLQT 309

Query: 310 LMEVVDFCLQR 320
           L+++  F LQR
Sbjct: 310 LIDLCAFSLQR 320


>gi|302188811|ref|ZP_07265484.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. syringae
           642]
          Length = 322

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 190/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDVRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S + +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMDVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +     + 
Sbjct: 133 KILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNASEAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G +  E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKGGL--EDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|224823689|ref|ZP_03696798.1| Polyprenyl synthetase [Lutiella nitroferrum 2002]
 gi|224604144|gb|EEG10318.1| Polyprenyl synthetase [Lutiella nitroferrum 2002]
          Length = 360

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 194/319 (60%), Gaps = 2/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
            +   L   DM+ V+ +I  R+ SDV +I  V +Y+I +GGKRLRP+LTL     L+YRG
Sbjct: 42  PLFRSLLADDMQTVDRVIRARLHSDVVLIRQVAEYIISAGGKRLRPVLTLLAGKALDYRG 101

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           ++   LA  IEFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL ++AF M+
Sbjct: 102 EHLHELAAMIEFIHTATLLHDDVVDESELRRGRETANALFGNAASVLVGDFLYTRAFQMM 161

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
           + T++   LE ++     +AEGE+ QL    N DVTE  YL VI+ KTA LF AA  V +
Sbjct: 162 VTTRNMAILEVMAEATNIIAEGEVLQLLNIGNTDVTEAQYLQVIQYKTAKLFEAASRVGA 221

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           LIA       +AL  YGM+LG AFQ++DDVLDY G+   +GK++G+D   GKPTLP+I  
Sbjct: 222 LIAAASPEQEKALADYGMHLGTAFQIIDDVLDYSGDAETIGKSLGDDLAEGKPTLPLIHT 281

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
            + G+       +  I + +   +   +    ++   AL   +  A    ++A  ++  L
Sbjct: 282 MRHGSPEAATTVRDAIENAR--GDRFHEVLAAVQSCGALDYAKSEAVRAAEQAVAAIAGL 339

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           PDS  K++L+E+    ++R
Sbjct: 340 PDSPSKQALVELARLSVER 358


>gi|39996419|ref|NP_952370.1| octaprenyl-diphosphate synthase [Geobacter sulfurreducens PCA]
 gi|39983299|gb|AAR34693.1| octaprenyl-diphosphate synthase [Geobacter sulfurreducens PCA]
 gi|298505429|gb|ADI84152.1| octaprenyl diphosphate synthase [Geobacter sulfurreducens KN400]
          Length = 322

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 188/310 (60%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D++ V     K + SDV +I  V +Y++ SGGKR+RPML L +A +  Y+GD HV LA  
Sbjct: 11  DLKNVELQFRKDLESDVYLIRKVGEYVLASGGKRIRPMLLLLSAKLCGYQGDRHVPLASV 70

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTATLLHDDVVD++ LRRG  +A  VWGN+ SVLVGDFL S++F +++E      L
Sbjct: 71  IEFIHTATLLHDDVVDNATLRRGNASANEVWGNEASVLVGDFLFSKSFSLMVEAGDLRIL 130

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + +S     +AEGE+ QL  + +L++T+E Y+ V+KSKTAVL SAA E  +++       
Sbjct: 131 KVISGATTIIAEGEVLQLLCTSDLEMTQERYIEVVKSKTAVLLSAACEAGAILGTSSAEQ 190

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           ++AL+ +GM+LGIAFQL+DD LDY     + GK IG D   GK TLP+I    + +  E+
Sbjct: 191 QEALRDFGMDLGIAFQLMDDTLDYTASEEQFGKEIGHDLEEGKITLPLIHTLMKCSDEER 250

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
               + +    +   + +  F ++ +   +  T   A  Y  + K  L    DS  K +L
Sbjct: 251 ETIAAVVEKEILEPGDFESVFTLVHKYGGIEYTVSVANEYIARCKAHLGAFVDSQEKAAL 310

Query: 311 MEVVDFCLQR 320
           +E+ D+ + R
Sbjct: 311 IELADYVVNR 320


>gi|37528362|ref|NP_931707.1| octaprenyl diphosphate synthase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787800|emb|CAE16915.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase) (OPP synthetase) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 323

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 191/316 (60%), Gaps = 1/316 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RP++ +  + +L Y+GD H+ 
Sbjct: 9   LTADDMAAVNETILSQLNSDVTLINQLGYYIISGGGKRIRPIIAILASRVLGYQGDKHIT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           +A  IEFIHTATLLHDDVVD+S +RRGK  A  ++GN  SVLVGDF+ +++F M+    S
Sbjct: 69  VAALIEFIHTATLLHDDVVDESDMRRGKATANAMFGNAASVLVGDFIYTRSFQMMTALNS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ +S     +AEGE+ QL    + +++E+DY+ VI SKTA LF  A   S++++  
Sbjct: 129 MRVLKLMSEATNVIAEGEVLQLMNCNDPNISEDDYMRVIYSKTARLFEVAAHSSAILSNA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                 AL++YG  LG AFQL+DD+LDY  + + +GKN G+D   GKPTLP++ A   GT
Sbjct: 189 TPEQEMALQNYGRYLGTAFQLIDDLLDYNADSDTLGKNTGDDLNEGKPTLPLLHAMNHGT 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +    +  I  G      L+     M++  +L  T  RA     KA  +L+ L +S +
Sbjct: 249 PEQSALIREAIEKGN-GRHLLETVLTTMKQCGSLEYTRKRAEEEADKAIAALQALENSPY 307

Query: 307 KKSLMEVVDFCLQRLN 322
           K++L+ +    +QRL+
Sbjct: 308 KQALVGLAHIAVQRLS 323


>gi|119472626|ref|ZP_01614617.1| Octaprenyl-diphosphate synthase [Alteromonadales bacterium TW-7]
 gi|119444830|gb|EAW26131.1| Octaprenyl-diphosphate synthase [Alteromonadales bacterium TW-7]
          Length = 323

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 191/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM  VN LI  ++ S+V ++  +  Y++ SGGKR+RPML +  A  L Y 
Sbjct: 3   IKAIQALIESDMNDVNQLIHAQMRSEVALVNQLGLYIVNSGGKRVRPMLAILAAKALGYT 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H+ LA  +EFIHTATLLHDDVVD+S LRRG   A   +GN  SVLVGDF+ +++F +
Sbjct: 63  GKDHITLATIVEFIHTATLLHDDVVDESNLRRGTPTANAEFGNAASVLVGDFIYTRSFQL 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++     + ++ L+     +AEGE+ QL    + D TE  Y+ VI SKTA LF AA  ++
Sbjct: 123 MVGLGKMQIMQILADATNIIAEGEVLQLMNCNDPDTTEASYMQVIYSKTAKLFEAATGLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I     +   AL  YGM+LG AFQLVDDVLDY  + N++GKNIG+D   GKPTLP+I 
Sbjct: 183 AIITNNDEATLNALNLYGMHLGTAFQLVDDVLDYNADANQLGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G   +    +  I      +E+L++    +++  AL  T  +A     KA   L  
Sbjct: 243 AMQHGNAHQTQLIRDAIEHSN-GMEHLEEILSTLKQTNALEFTMQKAELEADKAIACLDF 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K +L+ +    + R
Sbjct: 302 LPESEYKHALVSLARIAVDR 321


>gi|120599984|ref|YP_964558.1| trans-hexaprenyltranstransferase [Shewanella sp. W3-18-1]
 gi|146292082|ref|YP_001182506.1| trans-hexaprenyltranstransferase [Shewanella putrefaciens CN-32]
 gi|120560077|gb|ABM26004.1| Trans-hexaprenyltranstransferase [Shewanella sp. W3-18-1]
 gi|145563772|gb|ABP74707.1| Trans-hexaprenyltranstransferase [Shewanella putrefaciens CN-32]
          Length = 331

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 188/310 (60%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  + Y GD H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARTVSYEGDAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  +   L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDNMRVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + D TEE Y+ VI  KTA LF AA  +++++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATLLAAVLAGASTEQ 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL +YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I A   GT  E+
Sbjct: 201 ETALGNYGKYLGTAFQLTDDLLDYTADTEELGKNIGDDLAEGKPTLPLIYAIAHGTNEER 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    + + K    +    AL  T+ +A    +KA  +L  LPDS +K++L
Sbjct: 261 QLIRQAIEQGD-GTQAIDKIVAALHHCGALTYTQQKAIEESEKAIAALDVLPDSEFKEAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 VSLAKISVDR 329


>gi|255066032|ref|ZP_05317887.1| octaprenyl-diphosphate synthase [Neisseria sicca ATCC 29256]
 gi|255049577|gb|EET45041.1| octaprenyl-diphosphate synthase [Neisseria sicca ATCC 29256]
          Length = 324

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 202/326 (61%), Gaps = 8/326 (2%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ +VN +I + + SDV +I  +  Y+I +GGKRLRP++T+  A  
Sbjct: 1   MLENLPYFQRHLPEDLSRVNEVINQAVQSDVALISQIGTYIISAGGKRLRPIMTILAAKS 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y GD    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDGDKLYALAAMVEFIHTSTLLHDDVVDESDLRRGRETANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++++ S   LE ++     +AEGE+ QL    N D+TE  Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVDSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEAQYVQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGNAAPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           P+I   + G+K+  +  +  + +   S  + +K    +  + AL  +   A    ++A  
Sbjct: 241 PLIYLMRNGSKQVADDVRHALENADRS--SFQKIHDYVVHSDALTYSISEARKAVEQAVA 298

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
           SL  LPDS  K++++++ +  L R++
Sbjct: 299 SLAVLPDSEVKQAMIQLAEESLARVS 324


>gi|319775186|ref|YP_004137674.1| octaprenyl diphosphate synthase [Haemophilus influenzae F3047]
 gi|317449777|emb|CBY85984.1| octaprenyl diphosphate synthase [Haemophilus influenzae F3047]
          Length = 329

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA DS+  LP+
Sbjct: 252 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDSIAILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +KK+L+ +    + R
Sbjct: 311 SDYKKALISLAYLSVDR 327


>gi|71735497|ref|YP_273004.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556050|gb|AAZ35261.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 322

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +       
Sbjct: 133 RILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNAPEVQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRDAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|296313619|ref|ZP_06863560.1| octaprenyl-diphosphate synthase [Neisseria polysaccharea ATCC
           43768]
 gi|296839857|gb|EFH23795.1| octaprenyl-diphosphate synthase [Neisseria polysaccharea ATCC
           43768]
          Length = 324

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 136/332 (40%), Positives = 204/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y       LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDGKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++++ S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVDSDSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++     N  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSYFEKIHNY-VVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVAALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|187931635|ref|YP_001891619.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187712544|gb|ACD30841.1| octaprenyl-diphosphate synthase [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 325

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 200/326 (61%), Gaps = 8/326 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L  +D++  N  I+  +CSDV +I  +  Y+I SGGKRLRP+L +  A  L Y 
Sbjct: 4   LKDIQALIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GDKHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N +++EE+Y+ VI  KTA LF AA E++
Sbjct: 124 MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 181 SLIA-GVQNSVRQA--LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+   Q+  +    +K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQDYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    T++++   K  I  G+  ++ +    I M ++   VD  Y+ A  Y   AK 
Sbjct: 244 TIYALANVTEQQQQILKKAIEKGEYRIDEI----IAMVKDSGAVDYSYKVACQYADLAKQ 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +  LPDS +K++++ +    + R N
Sbjct: 300 QIDFLPDSEYKQAMILLCGLAVNRKN 325


>gi|264676899|ref|YP_003276805.1| polyprenyl synthetase [Comamonas testosteroni CNB-2]
 gi|299529717|ref|ZP_07043154.1| Polyprenyl synthetase [Comamonas testosteroni S44]
 gi|262207411|gb|ACY31509.1| Polyprenyl synthetase [Comamonas testosteroni CNB-2]
 gi|298722580|gb|EFI63500.1| Polyprenyl synthetase [Comamonas testosteroni S44]
          Length = 309

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M +V+ +I +R+ + V +I  + +Y+I +GGKRLRP L L  A  L ++G N  +LA  +
Sbjct: 1   MREVDIVIAQRLTTSVPLIAQISQYIIAAGGKRLRPALLLLIAGALGHQGKNKYILAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E IHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL +++F M++E  S   L+
Sbjct: 61  ELIHTATLLHDDVVDESTLRRGRATANETFGNPASVLVGDFLHTRSFQMMVEVGSMRVLQ 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE++QL  + +  + E  YLHVI+SKTA LF A+ ++++++AG    V 
Sbjct: 121 ILSDATNVIAEGEVQQLINTHDASLNEAGYLHVIRSKTAQLFEASAQLAAVLAGATPEVE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           QA  +YG  LG AFQ++DDVLDY G   EMGKN+G+D R GK TLP+I A QRG+  +  
Sbjct: 181 QACAAYGQALGTAFQIIDDVLDYTGNTQEMGKNLGDDLREGKCTLPLIAAMQRGSAEQAA 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++ I  G  S + L     I+R   AL      A++  Q+A D+L  LP +++
Sbjct: 241 IVRNAIEQG--STDQLDAVVEIVRSTGALDVARAAAHAEAQRAIDALASLPSNAY 293


>gi|320326220|gb|EFW82274.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320330645|gb|EFW86622.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330881372|gb|EGH15521.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330891602|gb|EGH24263.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 322

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +       
Sbjct: 133 RILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNAPEVQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|253991517|ref|YP_003042873.1| octaprenyl diphosphate synthase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638395|emb|CAR67017.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase (opp synthetase) [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782967|emb|CAQ86132.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase (opp synthetase) [Photorhabdus asymbiotica]
          Length = 323

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 186/316 (58%), Gaps = 1/316 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RP++ +  A  L Y+ D H+ 
Sbjct: 9   LTADDMAAVNEAILSQLNSDVALINQLGYYIISGGGKRIRPIIAILAARALGYQSDKHIT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+    S
Sbjct: 69  VAALIEFIHTATLLHDDVVDESDMRRGKATANATFGNAASVLVGDFIYTRSFQMMTTLNS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ +S     +AEGE+ QL    + +++E+DY+ VI SKTA LF  A   S++I+  
Sbjct: 129 MRVLKLMSEATNVIAEGEVLQLMNCNDPNISEDDYMRVIYSKTARLFEVAAHSSAIISNA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                 AL+ YG  LG AFQL+DD+LDY  + N +GKN G+D   GKPTLP++ A   G 
Sbjct: 189 TPEQETALQDYGRYLGTAFQLIDDLLDYDADSNTLGKNTGDDLNEGKPTLPLLHAMNHGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +    +  I  G      L+   I M++  +L  T  RA     KA  +L+ L  S +
Sbjct: 249 PEQSQLIRKAIEKGN-GRHLLETVLITMKQCGSLEYTRKRAEEEADKAIAALQVLESSPY 307

Query: 307 KKSLMEVVDFCLQRLN 322
           K++L+ +    +QRL+
Sbjct: 308 KQALVGLAHIAVQRLS 323


>gi|289625167|ref|ZP_06458121.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289651351|ref|ZP_06482694.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298485383|ref|ZP_07003473.1| octaprenyl diphosphate synthase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160081|gb|EFI01112.1| octaprenyl diphosphate synthase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330869163|gb|EGH03872.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330988777|gb|EGH86880.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 322

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +       
Sbjct: 133 RILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNAPEVQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDTLPPSEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|301169600|emb|CBW29201.1| octaprenyl diphosphate synthase [Haemophilus influenzae 10810]
          Length = 329

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 252 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +KK+L+ +    + R
Sbjct: 311 SEYKKALISLAYLSVDR 327


>gi|261365500|ref|ZP_05978383.1| octaprenyl-diphosphate synthase [Neisseria mucosa ATCC 25996]
 gi|288566037|gb|EFC87597.1| octaprenyl-diphosphate synthase [Neisseria mucosa ATCC 25996]
          Length = 324

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 201/326 (61%), Gaps = 8/326 (2%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ +VN +I K + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLSRVNEVINKAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKS 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y GD    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDGDKLYALAAMVEFIHTSTLLHDDVVDESDLRRGRETANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++++ S   LE ++     +AEGE+ QL    N D+TE  Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVDSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEAQYVQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGNAPPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKD 296
           P+I   + G+K+  +  +  + +   S  + +K    +  + AL  +   A    ++A  
Sbjct: 241 PLIYLMRNGSKQVADDVRHALENADRS--SFQKIHDYVVRSDALTYSISEARKAVEQAVA 298

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQRLN 322
           SL  LPDS  K++++++ +  L R++
Sbjct: 299 SLAVLPDSEVKQAMIQLAEESLARVS 324


>gi|5712726|gb|AAD47627.1| octylprenyl diphosphate synthase-like protein [Pseudomonas sp.
           BG33R]
          Length = 322

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 189/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I +++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDGIIKQQLTSKVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDF+ S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRETANAMWGNAPSVLVGDFMYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+ F A+   ++ + G     
Sbjct: 133 KILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMFFEASTHSAAALCGATAEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G NLG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 AEALRTFGDNLGVAFQLVDDLLDYKGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+     +  + +L  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRKAIQKGGI--EDLEAIRAAVEASGSLEYTAQLARDYVARAIQCLEALPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|332286668|ref|YP_004418579.1| octaprenyl-diphosphate synthase [Pusillimonas sp. T7-7]
 gi|330430621|gb|AEC21955.1| octaprenyl-diphosphate synthase [Pusillimonas sp. T7-7]
          Length = 308

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 132/309 (42%), Positives = 193/309 (62%), Gaps = 3/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M+ V+ +I  R+ SDV +I  +  Y++ +GGKR+RP + L  A  L Y+G NH LLA  +
Sbjct: 1   MKAVDAVIRARLNSDVVLIRTIGDYIVGAGGKRMRPAMLLMMANALGYQGGNHHLLAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++++ S  A+ 
Sbjct: 61  EFIHTATLLHDDVVDESDLRRGRSTANAVFGNAASVLVGDYLYSRSFEMMVQSGSMPAMS 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE+ QL    + DV+ + YL V++ KTA LF AA +V ++I G      
Sbjct: 121 VLSAATTVIAEGEVLQLLNVHDPDVSLDRYLQVVRYKTAKLFEAATQVGAIIGGATTEQE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
            A  +YG ++G AFQL+DDVLDY G    +GKN+G+D R GKPT+P+I   + GT ++K 
Sbjct: 181 AAAAAYGRHIGTAFQLIDDVLDYSGGAEALGKNVGDDLREGKPTMPLIRVMEVGTGQQKQ 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G      + +A   +++ +AL  T   A +    A+++L  LP S  +KSL+
Sbjct: 241 LIQDAIRTGDADFAAVARA---IQDTQALDYTRQAAIAEAALAREALAVLPVSVHQKSLL 297

Query: 312 EVVDFCLQR 320
           E   F ++R
Sbjct: 298 EFCSFAVER 306


>gi|261401641|ref|ZP_05987766.1| octaprenyl-diphosphate synthase [Neisseria lactamica ATCC 23970]
 gi|313667728|ref|YP_004048012.1| octaprenyl-diphosphate synthase [Neisseria lactamica ST-640]
 gi|269208281|gb|EEZ74736.1| octaprenyl-diphosphate synthase [Neisseria lactamica ATCC 23970]
 gi|313005190|emb|CBN86623.1| octaprenyl-diphosphate synthase [Neisseria lactamica 020-06]
          Length = 324

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I SGGKRLRP++T+     
Sbjct: 1   MLENLPYFQQHLSEDLAKVNKVINRAVQSDVALIAQIGTYIIGSGGKRLRPIMTILAGRS 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  D    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDDKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K++++ +    L R++
Sbjct: 293 VDCAVAALDALPDSEAKEAMIRLARESLVRVS 324


>gi|24375152|ref|NP_719195.1| octaprenyl-diphosphate synthase [Shewanella oneidensis MR-1]
 gi|24349926|gb|AAN56639.1|AE015800_12 octaprenyl-diphosphate synthase [Shewanella oneidensis MR-1]
          Length = 323

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 189/310 (60%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+G+ H+ LA  
Sbjct: 13  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVDYQGEAHLKLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S   L
Sbjct: 73  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDSMRVL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + D TEE Y+ VI  KTA LF AA  +++++AG     
Sbjct: 133 RVLADTTNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATLLAAVLAGASPEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LG AFQL DD+LDY  + +E+GKNIG+D   GKPTLP+I A   GT+ EK
Sbjct: 193 ETALGDYGKYLGTAFQLTDDLLDYTADSDELGKNIGDDLAEGKPTLPLIYAIAHGTEEEK 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G      ++K    +    AL  T+ +A     KA  +L  LPDS +K +L
Sbjct: 253 QLIRQAIEQGD-GTHAIEKIVAALHHCGALNYTQQKAIEESNKAIAALSVLPDSDFKTAL 311

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 312 ISLAKISVDR 321


>gi|254805638|ref|YP_003083859.1| octaprenyl-diphosphate synthase [Neisseria meningitidis alpha14]
 gi|254669180|emb|CBA07918.1| octaprenyl-diphosphate synthase [Neisseria meningitidis alpha14]
 gi|325145122|gb|EGC67404.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M01-240013]
 gi|325205404|gb|ADZ00857.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M04-240196]
          Length = 324

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 135/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYALAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVTALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|319425378|gb|ADV53452.1| Polyprenyl synthetase [Shewanella putrefaciens 200]
          Length = 331

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 189/310 (60%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  + Y GD H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARTVSYEGDAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  +   L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDNMRVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + D TEE Y+ VI  KTA LF AA  +++++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATLLAAVLAGATPEH 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL +YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I A   GT+ E+
Sbjct: 201 ETALGNYGKYLGTAFQLTDDLLDYTADTEELGKNIGDDLAEGKPTLPLIYAIAHGTEEER 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    + + K    +    AL  T+ +A    +KA  +L  LPDS +K++L
Sbjct: 261 QLIRQAIEQGD-GTQAIDKIVAALHHCGALAYTQQKAIEESEKAIAALDVLPDSDFKEAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 VALAKISVDR 329


>gi|134095950|ref|YP_001101025.1| octaprenyl diphosphate synthase [Herminiimonas arsenicoxydans]
 gi|133739853|emb|CAL62904.1| Octaprenyl-diphosphate synthase (Octaprenyl pyrophosphate
           synthetase) (OPP synthetase) [Herminiimonas
           arsenicoxydans]
          Length = 329

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 192/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+ +I +++ S+V ++  +  Y+I +GGKR+RP+L L  A  L YRG +   LA  
Sbjct: 20  DMSAVDAVIRQKLHSEVALVNQIADYIISAGGKRIRPVLVLLMANALGYRGTHQYDLAAV 79

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL S+AF M++   +  A+
Sbjct: 80  VEFIHTATLLHDDVVDESELRRGRKTANALFGNAASVLVGDFLHSRAFQMMVTVGNIRAM 139

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + L+     +AEGE+ QL    + D++EE Y  VI+SKTA LF AA ++ +LIAG     
Sbjct: 140 QILADATNVIAEGEVLQLLNMHDPDISEERYTQVIRSKTAKLFEAAAQLGALIAGASEDE 199

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG +LG AFQL+DDVLDY G   ++GKN+G+D R GK TLP+I   + G   ++
Sbjct: 200 IEAAAEYGRSLGTAFQLIDDVLDYSGHAEDIGKNVGDDLREGKATLPLIYLMEHGNTEQR 259

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +S I +G    E+     + +  + AL  T+ +A     +A  S+  LP+S +K +L
Sbjct: 260 ELVRSCIENGD--EEHFDAVLLAVTTSGALDYTKRKAEEAAARAAASIAGLPESQFKDAL 317

Query: 311 MEVVDFCLQR 320
           + +  F + R
Sbjct: 318 LNLSSFAVHR 327


>gi|241668473|ref|ZP_04756051.1| polyprenyl synthetase family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877007|ref|ZP_05249717.1| octaprenyl-diphosphate synthase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843028|gb|EET21442.1| octaprenyl-diphosphate synthase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 325

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/324 (40%), Positives = 205/324 (63%), Gaps = 8/324 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K +++L  +D+E  N  I+  + S+V +I  +  Y+I SGGKRLRP+L +  +  L Y 
Sbjct: 4   LKDIQNLIKQDIENNNQFIINSLSSEVVLINQISHYIINSGGKRLRPLLVMLFSRALNYT 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GNDHLACAAIIEFIHTATLLHDDVVDDSHLRRGKETANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N++++EEDY +VI  KTA LF AA E++
Sbjct: 124 MVGLDNMKIMQILADATNKISEGEVLQLLNARNIELSEEDYTNVIYCKTAKLFEAACELA 183

Query: 181 SLIAGVQNS---VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+  + S   ++ ++K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQSYSKLQNSIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    +  E+   K  I  G+  +  +    I + ++   V+  Y+ A  Y  KAK+
Sbjct: 244 TIYALANTSSAEQKKIKDAIEKGQYDISEI----INIVKSSGAVEYSYQVACQYADKAKE 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           S+  LP+S +K++++ + D  ++R
Sbjct: 300 SISFLPESEYKQAMILLCDLAVKR 323


>gi|237801840|ref|ZP_04590301.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024698|gb|EGI04754.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 319

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 188/308 (61%), Gaps = 2/308 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDIRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +     + 
Sbjct: 133 KILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCKASEAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 TEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDAL 310

Query: 311 MEVVDFCL 318
           +E+ +F +
Sbjct: 311 VELSEFAV 318


>gi|146281341|ref|YP_001171494.1| octylprenyl diphosphate synthase [Pseudomonas stutzeri A1501]
 gi|145569546|gb|ABP78652.1| octylprenyl diphosphate synthase [Pseudomonas stutzeri A1501]
 gi|327479520|gb|AEA82830.1| octylprenyl diphosphate synthase [Pseudomonas stutzeri DSM 4166]
          Length = 322

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 193/312 (61%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L +   L ++G+   LLA  
Sbjct: 13  DFAAVDGIIRKQLTSRVPLVEKIGDYITSAGGKRLRPLLVLLSGSALGHQGEQLRLLAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HT+TLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL +++F M++E  S   +
Sbjct: 73  IEFLHTSTLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYARSFEMMVELDSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             +S     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG     
Sbjct: 133 RIISQATRVIAEGEVLQLSKVRDASTTEEIYMEVIRGKTAMLFEASTHSAATLAGASEQQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LGIAFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 REALRTFGDHLGIAFQLVDDLLDYQGDAETLGKNVGDDLAEGKPTLPLIYTMREGTAEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +  + AL  T   A  Y ++A   L  +P + ++ +L
Sbjct: 253 ALVRKAIQKG--GLEDLESIRSAVEASGALDYTAKLARDYAERAIACLEVIPANQYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +++  F + R +
Sbjct: 311 VQLCRFAVARTH 322


>gi|319897631|ref|YP_004135828.1| octaprenyl diphosphate synthase [Haemophilus influenzae F3031]
 gi|317433137|emb|CBY81511.1| octaprenyl diphosphate synthase [Haemophilus influenzae F3031]
          Length = 329

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 195/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL++YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEAQEKALQNYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 252 HGNPQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 311 SEYKQALISLAYLSVDR 327


>gi|146308698|ref|YP_001189163.1| polyprenyl synthetase [Pseudomonas mendocina ymp]
 gi|145576899|gb|ABP86431.1| Polyprenyl synthetase [Pseudomonas mendocina ymp]
          Length = 322

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 195/312 (62%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I +++ S V ++  +  Y+I +GGKRLRP+L L +   L Y+ D+  LLA  
Sbjct: 13  DFTAVDGIIRQQVVSRVPLVEKIGDYIISAGGKRLRPLLVLLSGRALGYQADDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A   WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSDMRRGRSTANAQWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG   + 
Sbjct: 133 KILSHATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALAGANEAQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           R+AL+++G +LGIAFQLVDD+LDY+G+  E+GKN+G+D   GKPTLP+I   + G++ + 
Sbjct: 193 REALRTFGDHLGIAFQLVDDLLDYKGDAAELGKNVGDDLAEGKPTLPLIYTMREGSEEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+     +    AL  T   A  Y ++A   L  LP   ++ +L
Sbjct: 253 ALVRRAIQKGGI--EDLESIRAAVDAAGALDYTARLARDYAERAIACLDVLPAGEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+  F + R +
Sbjct: 311 IELSRFAVARTH 322


>gi|160900919|ref|YP_001566501.1| polyprenyl synthetase [Delftia acidovorans SPH-1]
 gi|160366503|gb|ABX38116.1| Polyprenyl synthetase [Delftia acidovorans SPH-1]
          Length = 359

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 172/274 (62%), Gaps = 2/274 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM +V+ +I +R+ + V +I  + +Y+I +GGKRLRP L L     L Y G +  +
Sbjct: 46  LITDDMREVDHVIAQRLTTTVPLIAQISQYIIAAGGKRLRPALLLMVCNALGYEGRDRHV 105

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +E IHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL S++F M++E  S
Sbjct: 106 LAAVVELIHTATLLHDDVVDESTLRRGRPTANETFGNPASVLVGDFLHSRSFQMMVEVGS 165

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ LS     +AEGE++QL  + +  + E  YLHVI+SKTA LF A+ ++ +++A  
Sbjct: 166 MRVLKILSDATNVIAEGEVQQLINTHDASLDEAGYLHVIRSKTAQLFEASAQLGAVLADA 225

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              + QA   YG  LG AFQ++DDVLDY G+  EMGKN+G+D R GK TLP+I A QRGT
Sbjct: 226 PREIEQACAIYGQALGTAFQIIDDVLDYTGDTQEMGKNLGDDLREGKCTLPLIAAMQRGT 285

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRAL 280
             +    ++ I  G  S E L     I+R   AL
Sbjct: 286 PEQAAIVRNAIEQG--STEQLSAVVDIVRSTGAL 317


>gi|229845932|ref|ZP_04466044.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 7P49H1]
 gi|229810936|gb|EEP46653.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 7P49H1]
          Length = 323

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 195/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 6   IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 66  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 126 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSETNYMRVIYSKTARLFEVAGQAAAIV 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL++YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 186 AGGTEAQEKALQNYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 246 HGNAQQAALIREAIEQGG-KREAIDEVLTIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 305 SEYKQALISLAYLSVDR 321


>gi|330813965|ref|YP_004358204.1| octaprenyl-diphosphate synthase / Dimethylallyltransferase /
           Geranyltranstransferase (farnesyldiphosphate synthase) /
           Geranylgeranyl pyrophosphate synthetase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487060|gb|AEA81465.1| octaprenyl-diphosphate synthase / Dimethylallyltransferase /
           Geranyltranstransferase (farnesyldiphosphate synthase) /
           Geranylgeranyl pyrophosphate synthetase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 338

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 192/312 (61%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           ++E+V+  I +++ S VE+I ++  YLI SGGKRLRP+LT+A++ +  Y+GD H+ LA  
Sbjct: 27  EIEEVDSFIKEKLSSHVELIGEMSSYLIQSGGKRLRPLLTIASSELFGYQGDRHIKLAAC 86

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +E IH ATLLHDDV+D S  RRGK     +WGN+ S+L GD+LL + F +++E  S E L
Sbjct: 87  VELIHNATLLHDDVIDKSDFRRGKKTNNNLWGNKNSILTGDYLLGRCFEIMVEDGSLEVL 146

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS V+  +A+GE+ QL   K ++  E+ YL +I SKT+ LF+A++ V   I     + 
Sbjct: 147 KLLSSVSSEIAQGEILQLQHEKEVETLEKTYLEIIGSKTSSLFAASMRVGGCINDKSKNE 206

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           ++AL S+G NLGI FQ+ DD+LDY  +    GK IG DF  GK TLP+I+ +Q+ ++ E+
Sbjct: 207 KEALTSFGFNLGICFQITDDILDYYSDKIAFGKVIGNDFYEGKVTLPIIMLYQKSSESER 266

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              K      + + E L     +M + + +   + RA  +   + DSL   P+S  K  L
Sbjct: 267 LALKEMFVRKERTKEELAYTLNLMTKYQVIASCKKRAEHFSSVSADSLGIFPESKEKTRL 326

Query: 311 MEVVDFCLQRLN 322
            E+  + + R+N
Sbjct: 327 QELAFYIVNRIN 338


>gi|325134983|gb|EGC57614.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M13399]
 gi|325202853|gb|ADY98307.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M01-240149]
 gi|325208846|gb|ADZ04298.1| octaprenyl-diphosphate synthase [Neisseria meningitidis NZ-05/33]
          Length = 324

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVTALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|145632254|ref|ZP_01787989.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 3655]
 gi|144987161|gb|EDJ93691.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 3655]
          Length = 323

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 193/317 (60%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 6   IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 66  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 126 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSETNYMRVIYSKTARLFEVAGQAAAIV 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG      +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 186 AGGTEVQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA DS+  LP+
Sbjct: 246 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDSIAILPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +KK+L+ +    + R
Sbjct: 305 SDYKKALISLAYLSVDR 321


>gi|332531718|ref|ZP_08407603.1| octaprenyl-diphosphate synthase / dimethylallyltransferase /
           geranyltranstransferase (farnesyldiphosphate synthase) /
           geranylgeranyl pyrophosphate synthetase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038694|gb|EGI75136.1| octaprenyl-diphosphate synthase / dimethylallyltransferase /
           geranyltranstransferase (farnesyldiphosphate synthase) /
           geranylgeranyl pyrophosphate synthetase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 323

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/320 (40%), Positives = 195/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM  VN LI  ++ SDV ++  +  Y++ SGGKR+RPML +  A  L Y+
Sbjct: 3   IKAIQALIESDMNDVNQLIHAQMRSDVALVNQLGLYIVSSGGKRVRPMLAILAAKALGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H+ LA  +EFIHTATLLHDDVVD+S LRRG   A   +GN  SVLVGDF+ +++F +
Sbjct: 63  GKDHITLATIVEFIHTATLLHDDVVDESNLRRGTPTANAEFGNAASVLVGDFIYTRSFQL 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++     + ++ L+     +AEGE+ QL    + D TE  Y+ VI SKTA LF AA  ++
Sbjct: 123 MVGLGKMQIMQVLADATNIIAEGEVLQLMNCNDPDTTEASYMQVIYSKTAKLFEAATGLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I     +   AL  YGM+LG AFQLVDDVLDY  +  ++GKNIG+D   GKPTLP+I 
Sbjct: 183 AIITEQDQATLDALNLYGMHLGTAFQLVDDVLDYNADAEQLGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G++++    +  I      +E+L++    +++  AL  T  +A    +KA   L  
Sbjct: 243 AMQHGSEQQTLLIRDAIEHSN-GMEHLEEILTALKQTNALEFTMQKAELEAEKAIACLDF 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L +S +K++L+ +    + R
Sbjct: 302 LAESDYKQALISLARIAVDR 321


>gi|226946118|ref|YP_002801191.1| trans-hexaprenyltranstransferase [Azotobacter vinelandii DJ]
 gi|226721045|gb|ACO80216.1| Trans-hexaprenyltranstransferase [Azotobacter vinelandii DJ]
          Length = 322

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+I +GGKRLRP+L L     L    +   LLA A
Sbjct: 13  DFSAVDGIIRKQLTSRVPLVETIGDYIISAGGKRLRPLLVLLCGNALGKCDERMRLLAAA 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HT+TLLHDDVVDDS LRRG+  +  +WGN  SVLVGDFL ++ F M++E  S   +
Sbjct: 73  IEFLHTSTLLHDDVVDDSELRRGRSTSNALWGNAPSVLVGDFLYARCFEMLVELASMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             +S     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF AA   ++ +AG  +  
Sbjct: 133 RIMSQATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEAASHGAASLAGATSEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+ +G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 AEALRCFGDSLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPGQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L      +    AL  T  RA  + ++A   L  LP   ++ +L
Sbjct: 253 ALVRRAIQKGGI--EDLTAIVAAVEAAGALDYTARRAREHAERAIACLDTLPPGEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+  F + R +
Sbjct: 311 VELSRFAVARTH 322


>gi|221068969|ref|ZP_03545074.1| Polyprenyl synthetase [Comamonas testosteroni KF-1]
 gi|220713992|gb|EED69360.1| Polyprenyl synthetase [Comamonas testosteroni KF-1]
          Length = 309

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/295 (44%), Positives = 188/295 (63%), Gaps = 2/295 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M +V+ +I +R+ + V +I  + +Y+I +GGKRLRP L L  A  L ++G N  +LA  +
Sbjct: 1   MREVDIVIAQRLTTSVPLIAQISQYIIAAGGKRLRPALLLLIAGALGHQGKNKYILAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E IHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL +++F M++E  S   L+
Sbjct: 61  ELIHTATLLHDDVVDESTLRRGRATANETFGNPASVLVGDFLHTRSFQMMVEVGSMRVLQ 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE++QL  + +  + E  YLHVI+SKTA LF A+ ++++++AG    + 
Sbjct: 121 ILSDATNVIAEGEVQQLINTHDASLNEAGYLHVIRSKTAQLFEASAQLAAVLAGATPEME 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           QA  +YG  LG AFQ++DDVLDY G   EMGKN+G+D R GK TLP+I A QRG+  +  
Sbjct: 181 QACATYGQALGTAFQIIDDVLDYTGNAQEMGKNLGDDLREGKCTLPLIAAMQRGSAEQAA 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++ I  G  S + L     I+R   AL      A++  Q+A D+L  LP +++
Sbjct: 241 IVRNAIEQG--STDQLDAVVDIVRSTGALDIARAAAHAEAQRAIDALAALPGNAY 293


>gi|304413337|ref|ZP_07394810.1| octaprenyl diphosphate synthase [Candidatus Regiella insecticola
           LSR1]
 gi|304284180|gb|EFL92573.1| octaprenyl diphosphate synthase [Candidatus Regiella insecticola
           LSR1]
          Length = 327

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/322 (41%), Positives = 198/322 (61%), Gaps = 12/322 (3%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           +++LT KDM  VN  I +++ SDV +I ++  Y+I +GGKR+RPM+ +  A  L Y+G+ 
Sbjct: 11  VKELTAKDMATVNDTIEEQMRSDVALITEISHYIINNGGKRIRPMIAILVAQALGYKGNQ 70

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ +A  IEFIHTATLLHDDVVD+S LRRGK      +GN  SVLVGDF+ ++AF M+ +
Sbjct: 71  HITIAVLIEFIHTATLLHDDVVDNSDLRRGKATVNAQFGNAASVLVGDFIYTRAFQMMTQ 130

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S   LE +S     +A+GE++QL   K+  +TEE+YL VI SKTA LF AA + S+++
Sbjct: 131 LGSMRVLEVMSTATNMIAKGEVQQLINCKDPRITEENYLSVIGSKTAKLFEAASQSSAIL 190

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG       AL+ YG ++GIAFQL+DD+LDY  E N  GK  G D   GK TLP++ A +
Sbjct: 191 AGANKEKELALQRYGHHIGIAFQLIDDLLDYSPE-NSTGKKSGADLAEGKVTLPLLHAIE 249

Query: 244 RGTKREKNFWKSTI--NDGK---ISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
           +GT  +     + I  ++G+    SV+ + K +  +   R    TE        KA   L
Sbjct: 250 KGTPEQTALLCNAIQQDNGRHLFTSVQQVLKEYGSLNYTRQCAKTE------ANKAIAEL 303

Query: 299 RCLPDSSWKKSLMEVVDFCLQR 320
           + LP++ ++ +L ++  F + R
Sbjct: 304 QVLPENPYRIALEKLAKFSIMR 325


>gi|257487512|ref|ZP_05641553.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 322

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 187/312 (59%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +       
Sbjct: 133 RILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNAPEVQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++  L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDVL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|167627921|ref|YP_001678421.1| polyprenyl synthetase family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167597922|gb|ABZ87920.1| polyprenyl synthetase family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 325

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 205/324 (63%), Gaps = 8/324 (2%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K +++L  +D+E  N  I+  + S+V +I  +  Y+I SGGKRLRP+L +  +  L Y 
Sbjct: 4   LKDIQNLIKQDIENNNQFIINSLSSEVVLINQISHYIINSGGKRLRPLLVMLFSRALNYT 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G++H+  A  IEFIHTATLLHDDVVDDS LRRGK  A  V+GN  SVL GDFL S+AF M
Sbjct: 64  GNDHLACAAIIEFIHTATLLHDDVVDDSHLRRGKETANNVFGNAASVLTGDFLYSRAFQM 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   + + ++ L+     ++EGE+ QL  ++N++++EEDY +VI  KTA LF AA E++
Sbjct: 124 MVGLDNMQIMQILADATNKISEGEVLQLLNARNIELSEEDYTNVIYCKTAKLFEAACELA 183

Query: 181 SLIAGVQNS---VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
            +I+  + S   ++ ++K+YG+ LG AFQ+ DDVLDY  +   +GKNIG+D   GK TLP
Sbjct: 184 GVISLDKQSYSKLQNSIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYR-AYSYGQKAKD 296
            I A    +  E+   K  I  G+  +  +    I + ++   V+  Y+ A  Y  K+K+
Sbjct: 244 TIYALANTSSAEQKKIKDAIEKGQYDISEI----INIVKSSGAVEYSYQVACQYADKSKE 299

Query: 297 SLRCLPDSSWKKSLMEVVDFCLQR 320
           S+  LP+S +K++++ + D  ++R
Sbjct: 300 SISFLPESEYKQAMILLCDLAVKR 323


>gi|34496302|ref|NP_900517.1| octaprenyl-diphosphate synthase [Chromobacterium violaceum ATCC
           12472]
 gi|34102155|gb|AAQ58522.1| octaprenyl-diphosphate synthase [Chromobacterium violaceum ATCC
           12472]
          Length = 309

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 192/309 (62%), Gaps = 2/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M+ V+ +I  R+ SDV +I  V +Y+I +GGKRLRP+LTL +   L YRG++   LA  I
Sbjct: 1   MQTVDGVIRARLHSDVVLIRQVAEYIISAGGKRLRPILTLLSGRALGYRGEHLFELAAMI 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL ++AF M++ T++   LE
Sbjct: 61  EFIHTATLLHDDVVDESDLRRGRKTANALFGNAASVLVGDFLYTRAFQMMVTTRNMTILE 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            ++     +AEGE+ QL    N DV+E++YL VI+ KTA LF AA  V +LIA       
Sbjct: 121 VMAEATNIIAEGEVLQLLNIGNTDVSEDEYLKVIQYKTAKLFEAAARVGALIADASAEQV 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +A+  YGM LG AFQ++DDVLDY G+ + +GK++G+D   GKPTLP+I   + G+     
Sbjct: 181 RAMADYGMYLGTAFQIIDDVLDYSGDADTIGKSLGDDLAEGKPTLPLIYTMRNGSSEASA 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  + +   + +        ++   AL   +  A    ++A  SL+ +PDS  +++L+
Sbjct: 241 LVRDALENA--NRDRFHDVLNAVQSCGALEYAKNEAVKMAEQAIASLQSIPDSEVRQALI 298

Query: 312 EVVDFCLQR 320
           E+    + R
Sbjct: 299 ELARLSVDR 307


>gi|121603663|ref|YP_980992.1| trans-hexaprenyltranstransferase [Polaromonas naphthalenivorans
           CJ2]
 gi|120592632|gb|ABM36071.1| Trans-hexaprenyltranstransferase [Polaromonas naphthalenivorans
           CJ2]
          Length = 327

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 192/309 (62%), Gaps = 2/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M  ++ +I +R+ S+V ++  V +Y+I +GGKRLRP L L     L+YRG     LA  +
Sbjct: 19  MRAMDAVIARRLQSEVPLVAQVSQYIIAAGGKRLRPALVLLMCGALDYRGAQRFNLAAVV 78

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL S+AF M++E      ++
Sbjct: 79  EFIHTATLLHDDVVDESTLRRGRSTANEIFGNPASVLVGDFLYSRAFQMMVEVGDMRIMQ 138

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            L+     +AEGE+ QL    +  +TE  YL VI+SKTA LF A+  +++L+A    +V 
Sbjct: 139 TLAEATNVIAEGEVLQLMNMHDAGLTEAGYLRVIRSKTAKLFEASARLAALLAQSSPAVE 198

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           Q    YG  LG AFQ++DDVLDY GEV EMGKN+G+D R GK TLP+I+A QRGT+ E+ 
Sbjct: 199 QHCAEYGQALGTAFQVIDDVLDYDGEVLEMGKNLGDDLREGKVTLPLIIAMQRGTQAERA 258

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G    E + +   I+++  AL  T   A +   +A ++L+ LP + +  +L 
Sbjct: 259 TIRQAIETG--GTEQMAQVINIVQKTGALRATRDAAATEALRALNALQNLPQNPYSHALE 316

Query: 312 EVVDFCLQR 320
           ++    L R
Sbjct: 317 QLASQLLAR 325


>gi|16272821|ref|NP_439042.1| octaprenyl-diphosphate synthase [Haemophilus influenzae Rd KW20]
 gi|260579972|ref|ZP_05847802.1| heptaprenyl diphosphate synthase component II [Haemophilus
           influenzae RdAW]
 gi|1170590|sp|P44916|ISPB_HAEIN RecName: Full=Octaprenyl-diphosphate synthase; AltName:
           Full=All-trans-octaprenyl-diphosphate synthase; AltName:
           Full=Octaprenyl pyrophosphate synthase; Short=OPP
           synthase
 gi|1573899|gb|AAC22540.1| octaprenyl-diphosphate synthase (ispB) [Haemophilus influenzae Rd
           KW20]
 gi|260093256|gb|EEW77189.1| heptaprenyl diphosphate synthase component II [Haemophilus
           influenzae RdAW]
 gi|309751451|gb|ADO81435.1| Octaprenyl-diphosphate synthase [Haemophilus influenzae R2866]
          Length = 329

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANTQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 252 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 311 SEYKQALISLAYLSVDR 327


>gi|209693963|ref|YP_002261891.1| octaprenyl-diphosphate synthase [Aliivibrio salmonicida LFI1238]
 gi|208007914|emb|CAQ78045.1| octaprenyl-diphosphate synthase [Aliivibrio salmonicida LFI1238]
          Length = 323

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 189/319 (59%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM  VN  IL ++ SDV +I  +  Y++  GGKRLRP+L + +A  L Y G
Sbjct: 4   KAIQALTADDMAIVNETILAQLNSDVALINQLGFYIVSGGGKRLRPVLAILSAKALGYEG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
            +H + A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ +++F M+
Sbjct: 64  KDHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAEFGNAASVLVGDFIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
               S + L  +S     +AEGE+ QL    + + TEE Y+ VI SKTA LF AA ++ +
Sbjct: 124 TSLGSIKILSLMSESVNVIAEGEVLQLMNCNDPNTTEESYMQVIYSKTARLFEAATQIGA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           ++      +  AL++YG  LG AFQL+DDV+DY  +  +MGKN+G+D   GKPTLP++ A
Sbjct: 184 ILNNASQEIETALQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDDLAEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G   +    +  I  G   ++ L      M+E  +L  T+ +A     KA   L  +
Sbjct: 244 MNNGNAEQAAMIRHAIEQGN-GLDKLDPILACMKEVGSLEYTKQKADEEADKAIAELSII 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
           P+S +K++L  +    ++R
Sbjct: 303 PESEYKEALKALAHLAVKR 321


>gi|68249468|ref|YP_248580.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 86-028NP]
 gi|329122893|ref|ZP_08251464.1| octaprenyl-diphosphate synthase [Haemophilus aegyptius ATCC 11116]
 gi|68057667|gb|AAX87920.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 86-028NP]
 gi|327471824|gb|EGF17264.1| octaprenyl-diphosphate synthase [Haemophilus aegyptius ATCC 11116]
          Length = 329

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 252 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 311 SEYKQALISLAYLSVDR 327


>gi|270265042|ref|ZP_06193305.1| hypothetical protein SOD_k00780 [Serratia odorifera 4Rx13]
 gi|270040976|gb|EFA14077.1| hypothetical protein SOD_k00780 [Serratia odorifera 4Rx13]
          Length = 310

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 185/309 (59%), Gaps = 1/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M  VN  IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+GD H+ +A  I
Sbjct: 1   MAAVNATILEQLNSDVTLINQLGYYIISGGGKRIRPMIAVLAARALHYQGDKHITVAALI 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M+   +S   L 
Sbjct: 61  EFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLESLRVLA 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S++++    +  
Sbjct: 121 LMSEAVNVIAEGEVLQLMNVNDPDITEESYMRVIYSKTARLFEAAAQSSAILSEASEAEE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +AL+ YG  LG AFQL+DD+LDY  + + +GKN G+D   GKPTLP++ A + G   +  
Sbjct: 181 KALQDYGRYLGTAFQLIDDLLDYSADGSTLGKNTGDDLNEGKPTLPLLHAMRNGNSAQTA 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G      L+     M++  +L  T  RA     KA  +L+ LP+S  + +L 
Sbjct: 241 MIREAIEQGS-GRHLLEPVLQAMQQCGSLEYTRQRAEEEADKAIAALQVLPESPHRSALE 299

Query: 312 EVVDFCLQR 320
            +    +QR
Sbjct: 300 GLAHLAVQR 308


>gi|145638300|ref|ZP_01793910.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae PittII]
 gi|145272629|gb|EDK12536.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae PittII]
          Length = 323

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 6   IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 66  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 126 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 186 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANTQALGKNVGDDLAEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 246 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 305 SEYKQALISLAYLSVDR 321


>gi|58040424|ref|YP_192388.1| decaprenyl diphosphate synthase [Gluconobacter oxydans 621H]
 gi|58002838|gb|AAW61732.1| Decaprenyl diphosphate synthase [Gluconobacter oxydans 621H]
          Length = 315

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 194/313 (61%), Gaps = 4/313 (1%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG----DNHVLL 67
           M+  N  I+ R+ S V +IP +  +L+ +GGKRLRP+LTLA++ +  Y+       HV L
Sbjct: 1   MQACNRAIIARMESPVPLIPQLGAHLVAAGGKRLRPLLTLASSRLCGYKSTPENQRHVGL 60

Query: 68  ACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ 127
           A  +EFIHTATLLHDDVVD+S LRRG  +A  V+GN+ SVLVGDFL +++F ++    S 
Sbjct: 61  AACVEFIHTATLLHDDVVDESNLRRGLASANAVFGNKASVLVGDFLFARSFQLMTADGSL 120

Query: 128 EALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQ 187
           + +  LS  + T+AEGE+ Q+    +L    + YL VI  KTA LF+AA  V +++A   
Sbjct: 121 KVMAILSDASATIAEGEVLQMVTQNDLSTPVDRYLEVIHGKTAALFAAACRVGAVVADRP 180

Query: 188 NSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTK 247
            +   AL  +G NLG+AFQLVDD LDY  +   +GK +G+D R GK TLPV+ A++ G+ 
Sbjct: 181 EAEELALDRFGTNLGMAFQLVDDALDYAADQQILGKTVGDDMREGKITLPVLAAYEAGSA 240

Query: 248 REKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWK 307
            ++ FW+  I  G+ +  +L  A  ++ +  A+  T  RA +Y  +A D+L   PDS  +
Sbjct: 241 EDRAFWERVIEKGEQTEADLPHALALIEKTGAIATTIARAQAYAAEAVDALSIFPDSELR 300

Query: 308 KSLMEVVDFCLQR 320
           + + E V + + R
Sbjct: 301 RLMTETVQYTVDR 313


>gi|77361572|ref|YP_341147.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase)(OPP synthetase) [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76876483|emb|CAI87705.1| Octaprenyl-diphosphate synthase (Octaprenyl pyrophosphate
           synthetase)(OPP synthetase) [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 323

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 194/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L   DM  VN LI  ++ SDV ++  +  Y++ SGGKR+RPML +  A  L Y+
Sbjct: 3   IKAIQALIENDMNDVNQLIHAQMRSDVALVNQLGLYIVNSGGKRVRPMLAILAARALGYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H+ LA  +EFIHTATLLHDDVVD+S LRRG   A   +GN  SVLVGDF+ +++F +
Sbjct: 63  GKDHITLATIVEFIHTATLLHDDVVDESNLRRGTPTANAEFGNAASVLVGDFIYTRSFQL 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++     + ++ L+     +AEGE+ QL    + D TE  Y+ VI SKTA LF AA  ++
Sbjct: 123 MVGLGKMQVMQVLADATNIIAEGEVLQLMNCNDPDTTEASYMQVIYSKTAKLFEAATGLA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I     +   AL  YGM+LG AFQLVDDVLDY  + +++GKNIG+D   GKPTLP+I 
Sbjct: 183 AIITEQNQATLDALNLYGMHLGTAFQLVDDVLDYNADADQLGKNIGDDLAEGKPTLPLIY 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G +++    +  I      +++L++    +++  AL  T  +A     KA   L  
Sbjct: 243 AMQHGNEQQTQLIRDAIEHSN-GMDHLEEILAALKQTNALEFTMQKAELEADKAIACLDF 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L +S +K++L+ +    + R
Sbjct: 302 LAESEYKQALVSLARIAVDR 321


>gi|119944297|ref|YP_941977.1| octaprenyl-diphosphate synthase [Psychromonas ingrahamii 37]
 gi|119862901|gb|ABM02378.1| octaprenyl-diphosphate synthase [Psychromonas ingrahamii 37]
          Length = 331

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 193/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ ++  +M +VN LI +++ SDV +I  +  Y+I SGGKR+RP++T+  A  L   
Sbjct: 11  IKTIQRISATEMNQVNKLITEQLSSDVALINQLGFYIINSGGKRIRPLITVLAAKALGIH 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
             N   LA  IEFIHTATLLHDDVVDDS LRRGK  A  V+G+  SVLVGDFL +++F M
Sbjct: 71  DQNTTKLAAIIEFIHTATLLHDDVVDDSDLRRGKKTANAVFGSAASVLVGDFLYTRSFQM 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + + ++ + ++ LS     +AEGE+ QL    + D TE+ Y+ +I  KTA LF AA ++ 
Sbjct: 131 MTQLRNLKVMDILSSATNIIAEGEVLQLMNCNDPDTTEKKYMDIIYFKTAKLFEAATQLV 190

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++      +  AL +YG  LG AFQL DDV+DY  + +EMGKN G+D   GKPTLP++ 
Sbjct: 191 AVLGEQSEEIETALLNYGKYLGTAFQLTDDVMDYNSDASEMGKNTGDDLAEGKPTLPLLY 250

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q G K++    K  I  G   +++  +    + +  AL   + RA     KA  +L  
Sbjct: 251 AIQHGNKKQATLIKEAIKKGN-GMDHFDEIMQALHDTNALEYAKKRALEEADKAIKALVI 309

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           +PDS +K++L+ +      R
Sbjct: 310 IPDSEYKQALISLAHIAADR 329


>gi|145629957|ref|ZP_01785739.1| octaprenyl-diphosphate synthase [Haemophilus influenzae R3021]
 gi|145634043|ref|ZP_01789754.1| octaprenyl-diphosphate synthase [Haemophilus influenzae PittAA]
 gi|145636989|ref|ZP_01792653.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae PittHH]
 gi|145641936|ref|ZP_01797510.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae R3021]
 gi|148828062|ref|YP_001292815.1| octaprenyl-diphosphate synthase [Haemophilus influenzae PittGG]
 gi|229844760|ref|ZP_04464899.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 6P18H1]
 gi|144984238|gb|EDJ91661.1| octaprenyl-diphosphate synthase [Haemophilus influenzae R3021]
 gi|145268487|gb|EDK08480.1| octaprenyl-diphosphate synthase [Haemophilus influenzae PittAA]
 gi|145269847|gb|EDK09786.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae PittHH]
 gi|145273415|gb|EDK13287.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae 22.4-21]
 gi|148719304|gb|ABR00432.1| octaprenyl-diphosphate synthase [Haemophilus influenzae PittGG]
 gi|229812474|gb|EEP48164.1| octaprenyl-diphosphate synthase [Haemophilus influenzae 6P18H1]
          Length = 323

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 6   IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 66  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 126 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 186 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 246 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 305 SEYKQALISLAYLSVDR 321


>gi|91776572|ref|YP_546328.1| trans-hexaprenyltranstransferase [Methylobacillus flagellatus KT]
 gi|91710559|gb|ABE50487.1| Trans-hexaprenyltranstransferase [Methylobacillus flagellatus KT]
          Length = 322

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 189/311 (60%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM+KV+ +I K + SDV +I  V  Y+I SGGKRLRP L L +A         H  LA 
Sbjct: 12  EDMQKVDAVIRKALHSDVVLINQVADYIINSGGKRLRPTLVLLSAGAFGRIEAKHHELAA 71

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IE IHT+TLLHDDVVD+S+LRRGK  A  ++GN  SVLVGDF+ S+ F M++  +S   
Sbjct: 72  IIELIHTSTLLHDDVVDESSLRRGKATANTLFGNAASVLVGDFIYSRTFQMMVGIQSMRV 131

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           +E LS    T+AEGE+ QL    + D+T+E YL VI  KTA LF AA  + ++I G    
Sbjct: 132 MEVLSDATNTIAEGEVLQLLNVHDADITDEAYLRVIHYKTAKLFEAATRLGAIICGTDAQ 191

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A+  YGM LG AFQLVDDVLD  G+ +E+GKN+G+D   GKPTLP++ A + GT+ +
Sbjct: 192 DEAAMAEYGMRLGTAFQLVDDVLDLSGDSSEIGKNLGDDLAEGKPTLPLLYAMRHGTEAQ 251

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               +++I  G   ++ L      ++   AL      A +       ++  LP+S++K++
Sbjct: 252 HEIIRNSIEKG--GLQELPAVVEAVKATGALEHVRELAKAEAAAGCAAIMHLPESTYKEA 309

Query: 310 LMEVVDFCLQR 320
           L+ + DF + R
Sbjct: 310 LLRLADFAVSR 320


>gi|77461082|ref|YP_350589.1| polyprenyl synthetase [Pseudomonas fluorescens Pf0-1]
 gi|77385085|gb|ABA76598.1| octaprenyl-diphosphate synthase [Pseudomonas fluorescens Pf0-1]
          Length = 322

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 192/312 (61%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDGIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDMRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANAMWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG     
Sbjct: 133 KILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALAGATAEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYKGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+   I +  + +L  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKGGI--EDLESIRIAVEASGSLEYTAQLARDYVARAIKCLDALPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|304386506|ref|ZP_07368794.1| octaprenyl-diphosphate synthase [Neisseria meningitidis ATCC 13091]
 gi|304339335|gb|EFM05407.1| octaprenyl-diphosphate synthase [Neisseria meningitidis ATCC 13091]
          Length = 324

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 206/332 (62%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++++ S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVDSGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        +ALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVAALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|309378666|emb|CBX22737.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 324

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 136/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I SGGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALIAQIGTYIIGSGGKRLRPIMTILAGRS 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDNEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K++++ +    L R++
Sbjct: 293 VDCAVAALDALPDSEAKEAMIRLARESLVRVS 324


>gi|227328594|ref|ZP_03832618.1| octaprenyl diphosphate synthase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 296

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 168/261 (64%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ +  LT +DM  VN +IL+++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L+Y 
Sbjct: 3   LEQITALTTQDMAAVNNVILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLAARALDYN 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GDKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   L  +S     +AEGE+ QL    + D+TEE Y+ VI SKTA LF AA + S
Sbjct: 123 MTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARLFEAAAQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           S++AG      +AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 SILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGK 261
           A + G   + +  +  I +G 
Sbjct: 243 AMRNGNAEQSSLIRKAIEEGN 263


>gi|148826474|ref|YP_001291227.1| octaprenyl-diphosphate synthase [Haemophilus influenzae PittEE]
 gi|148716634|gb|ABQ98844.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Haemophilus influenzae PittEE]
          Length = 323

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 6   IQKLADPDMQKVNQNILAQLNSDVSLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGAN 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 66  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 126 LESLKILGIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 186 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 246 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 305 SEYKQALISLAYLSVDR 321


>gi|261391852|emb|CAX49311.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase; OPP synthetase) [Neisseria meningitidis
           8013]
          Length = 324

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYALAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        +ALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVTALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|309973622|gb|ADO96823.1| Octaprenyl-diphosphate synthase [Haemophilus influenzae R2846]
          Length = 329

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 194/317 (61%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVSLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGAN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILGIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG   +  +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 252 HGNAQQAALIREAIEQGG-KREAIDEVLAIMTEHKSLDYAMNRAKEEAQKAVDAIEILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 311 SEYKQALISLAYLSVDR 327


>gi|262277442|ref|ZP_06055235.1| octaprenyl-diphosphate synthase [alpha proteobacterium HIMB114]
 gi|262224545|gb|EEY75004.1| octaprenyl-diphosphate synthase [alpha proteobacterium HIMB114]
          Length = 337

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 192/311 (61%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           ++KV+  I  ++ S VE++ ++  +L+ +GGKRLRP+LT+ ++ +  Y+G+ H+ LA  +
Sbjct: 27  LKKVDDHIKLKLSSHVELVGEMATHLMSTGGKRLRPLLTICSSEIFNYKGNRHINLAACV 86

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E IH ATLLHDDV+D S  RRG      +WGN++S+L GD+LLS+ F M+++  SQE L+
Sbjct: 87  ELIHNATLLHDDVIDKSESRRGFKTTNAIWGNKSSILAGDYLLSRCFEMMVDDGSQEVLK 146

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS V+  +A+GE+ QL   K +D+ E++YL +I +KTA LF A++ V   I    N  +
Sbjct: 147 ILSSVSSEIAQGEIMQLQFEKQVDMVEKNYLDIISAKTASLFGASMRVGGCINDRSNKEK 206

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +AL+SYG NLGI FQ+ DD+LDY  +    GK IG DF  GK TLP+IL FQ+ T +E+ 
Sbjct: 207 EALESYGRNLGICFQITDDILDYSSKEQVFGKKIGNDFLEGKITLPIILLFQKSTPKERE 266

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +   +    S  + ++   ++ + + +   + RA  +   A DSL     +   + L 
Sbjct: 267 MLQKYFSQSVRSENDFEQTLKLINKYQIIETCKKRADYFSNVASDSLSVFEKNFVVEKLQ 326

Query: 312 EVVDFCLQRLN 322
           E+  + + RLN
Sbjct: 327 ELSFYIVNRLN 337


>gi|251793088|ref|YP_003007814.1| octaprenyl-diphosphate synthase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534481|gb|ACS97727.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase)
           [Aggregatibacter aphrophilus NJ8700]
          Length = 323

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  ++ L+  DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + 
Sbjct: 3   MNAIQALSHADMQKVNESILAQLNSDVVLINQLGFYIVQGGGKRIRPLIAVLAARALGFE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G   +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 63  GPQAITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQL 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           V + +S + L  ++     LAEGE++QL    +   +EE+Y+ VI SKTA LF  A + +
Sbjct: 123 VAQLESLKILRIMADATNVLAEGEVQQLMNVNDPQTSEENYMRVIYSKTARLFEVAAQAA 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IAG   +  QAL+SYG  LG AFQLVDDVLDY   V  +GKN+G+D   GKPTLP++ 
Sbjct: 183 AIIAGSNEAQEQALQSYGRYLGTAFQLVDDVLDYSANVKALGKNVGDDLAEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G +++    +  I  G    E + +   IM E+++L     RA    QKA D+++ 
Sbjct: 243 AMHHGNEQQAALIREAIEQGG-KREAIDEVLAIMAEHKSLDYAMDRAKQEAQKAVDAIQI 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 302 LPESEYKQALISLAYLSVDR 321


>gi|114048617|ref|YP_739167.1| trans-hexaprenyltranstransferase [Shewanella sp. MR-7]
 gi|113890059|gb|ABI44110.1| Trans-hexaprenyltranstransferase [Shewanella sp. MR-7]
          Length = 331

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 189/310 (60%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+G+ H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVDYQGEAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S   L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDSMRVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + + TEE Y+ VI  KTA LF AA  +++++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPNTTEESYMRVIYCKTAKLFEAATLLAAVLAGATPEQ 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I A   GT+ E+
Sbjct: 201 ETALGDYGKYLGTAFQLTDDLLDYTADSEELGKNIGDDLAEGKPTLPLIYAIAHGTEEEQ 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G      ++K    +    AL  T+ +A     KA  +L  LPDS++K +L
Sbjct: 261 QLIRQAIEQGD-GTHAIEKIVAALHHCGALTYTQQKAIEESNKAIAALSVLPDSNFKTAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 ISLAKISVDR 329


>gi|270158512|ref|ZP_06187169.1| octaprenyl-diphosphate synthase [Legionella longbeachae D-4968]
 gi|289166652|ref|YP_003456790.1| octaprenyl-diphosphate synthase [Legionella longbeachae NSW150]
 gi|269990537|gb|EEZ96791.1| octaprenyl-diphosphate synthase [Legionella longbeachae D-4968]
 gi|288859825|emb|CBJ13806.1| putative octaprenyl-diphosphate synthase [Legionella longbeachae
           NSW150]
          Length = 322

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 201/317 (63%), Gaps = 2/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L +L  +D E VN LI++ I S +++I D+  ++I SGGKRLR +L L  +    Y G  
Sbjct: 6   LRNLVSEDFEAVNHLIIETIKSPIQLIDDIANHVIQSGGKRLRCLLVLLASRACGYEGKE 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H++LA  IEF HTATLLHDDV+DDS LRRG+  A  +WGN+ S+LVGD+L ++   +++E
Sbjct: 66  HIMLAAMIEFFHTATLLHDDVIDDSTLRRGRDTANKIWGNKASILVGDYLFTKYLELMVE 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
               + ++ L  +A  +  GE++Q S   N D++ E+Y  +I++KTA+LF+A+  + +LI
Sbjct: 126 VGDIDIIQLLIGIAPQMGCGEIQQFSNRHNADLSVEEYFDMIRAKTALLFAASSAIGALI 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           +  ++ +++A+ SYG++LG AFQL+DD LDY  +   +GKNIG+D   GK TLP++ A +
Sbjct: 186 SKSEHQIQKAMYSYGLHLGNAFQLIDDALDYCSDAQTIGKNIGDDLATGKITLPLLQALK 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            GT  ++   + ++  G  ++ +L      + E +A+  T   A      A D+L  LPD
Sbjct: 246 HGTAEQQIKIRESLEKG--TLLHLPAILAAITETKAIEYTRDIADKEADFAIDALSILPD 303

Query: 304 SSWKKSLMEVVDFCLQR 320
           S++K++L+++  +   R
Sbjct: 304 STYKQALVDLARYAAHR 320


>gi|95929474|ref|ZP_01312217.1| Trans-hexaprenyltranstransferase [Desulfuromonas acetoxidans DSM
           684]
 gi|95134590|gb|EAT16246.1| Trans-hexaprenyltranstransferase [Desulfuromonas acetoxidans DSM
           684]
          Length = 322

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 184/296 (62%)

Query: 25  SDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDV 84
           S+V +I  V +Y++ SGGKR+RPML L  A +  Y+G++H+ +A  +EFIHTATLLHDDV
Sbjct: 25  SEVTLIRKVGEYVLASGGKRMRPMLVLLCARLAAYQGESHIGVASVVEFIHTATLLHDDV 84

Query: 85  VDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGE 144
           VD + LRRG  +A  VWGN+ SVLVGDFL S++F +++ T S   L+ALS     +AEGE
Sbjct: 85  VDSADLRRGAASANNVWGNEASVLVGDFLFSKSFSIMVRTGSLPILQALSDATTNMAEGE 144

Query: 145 LRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIA 204
           + QL  + +LD++EE Y+ V++ KTAVL +AA     ++ GV     QAL+ +GM LGIA
Sbjct: 145 VLQLISTCDLDLSEERYMQVVRDKTAVLIAAACRCGGILGGVSAEQEQALQEFGMELGIA 204

Query: 205 FQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISV 264
           FQ +DD LDY  +  E GK  G D   GK TLP+I   +  ++ E++  +  +   ++S 
Sbjct: 205 FQFMDDALDYVADQAEFGKACGHDLEEGKMTLPLIETLRHCSRDERDRVEQIVEKDQLSD 264

Query: 265 ENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320
           E+L+K   ++ +   +  T  RA    + AK  L    D   K++L  + D+ + R
Sbjct: 265 EDLEKVIALIHQYDGIDYTRKRAKQLVESAKQRLAAFEDGEAKQALEILADYVVSR 320


>gi|325132994|gb|EGC55670.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M6190]
 gi|325136902|gb|EGC59499.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M0579]
 gi|325138982|gb|EGC61531.1| octaprenyl-diphosphate synthase [Neisseria meningitidis ES14902]
          Length = 324

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y       LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDGKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++++ S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVDSDSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        +ALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVTALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|54307607|ref|YP_128627.1| putative octaprenyl-diphosphate synthase [Photobacterium profundum
           SS9]
 gi|46912030|emb|CAG18825.1| putative octaprenyl-diphosphate synthase [Photobacterium profundum
           SS9]
          Length = 323

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 195/319 (61%), Gaps = 1/319 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRG 61
           K ++ LT  DM  V+  I  ++ SDV +I  +  Y++  GGKRLRPML +  A  L Y+G
Sbjct: 4   KAIQALTANDMAGVDAKIQAQLNSDVALINQLGFYIVSGGGKRLRPMLVVLAARALGYQG 63

Query: 62  DNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMV 121
           D H+  A  +EFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ +++F M+
Sbjct: 64  DKHITAAAFVEFIHTATLLHDDVVDESDMRRGKDTANAAFGNAASVLVGDYIYTRSFQMM 123

Query: 122 IETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSS 181
              +S + L+ +S     +AEGE++QL    + + TE++Y+ VI SKTA LF AA ++S+
Sbjct: 124 TSLRSLKILDIMSEATNVIAEGEVQQLMNCNDPNTTEDNYMQVIYSKTARLFEAATQISA 183

Query: 182 LIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241
           +I      V  AL+ YG  LG AFQL+DDVLDY  +  EMGKN+G+D   GKPTLP++ A
Sbjct: 184 IITESSTEVEVALQDYGRYLGTAFQLIDDVLDYVADGKEMGKNVGDDLSEGKPTLPLLHA 243

Query: 242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCL 301
              G + +    +  I      ++ L      MRE  +L  T+ RA    +KA  +L  +
Sbjct: 244 MHNGNEAQSAMIREAIEKSN-GMDKLNDILAAMREAGSLEYTQQRAEEEAEKAIAALAPI 302

Query: 302 PDSSWKKSLMEVVDFCLQR 320
            +S +K++L+++    ++R
Sbjct: 303 AESDYKEALIQLAHLAVKR 321


>gi|330811830|ref|YP_004356292.1| Octaprenyl-diphosphate synthase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379938|gb|AEA71288.1| Octaprenyl-diphosphate synthase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 322

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 192/312 (61%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDGIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDMRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN  SVLVGDFL S++F M++E  S   +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANAMWGNAPSVLVGDFLYSRSFEMMVELGSMPVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +AG     
Sbjct: 133 KILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEASTHSAAALAGASAEQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDY+G+   +GKN+G+D   GKPTLP+I   + GT  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYKGDAETLGKNVGDDLAEGKPTLPLIYTMREGTPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G I  E+L+   + +  + +L  T   A  Y  +A   L  LP S ++ +L
Sbjct: 253 ALVRQAIQKGGI--EDLESIRVAVEASGSLDYTANLARGYVARAIKCLDALPASEYRDAL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|260581709|ref|ZP_05849506.1| heptaprenyl diphosphate synthase component II [Haemophilus
           influenzae NT127]
 gi|260095302|gb|EEW79193.1| heptaprenyl diphosphate synthase component II [Haemophilus
           influenzae NT127]
          Length = 329

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 193/317 (60%), Gaps = 1/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + G N
Sbjct: 12  IQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLGFEGSN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +V +
Sbjct: 72  SITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQLVAQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S + L  ++     LAEGE++QL    + + +E +Y+ VI SKTA LF  A + ++++
Sbjct: 132 LESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARLFEVAGQAAAIV 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           AG      +AL+ YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ A +
Sbjct: 192 AGGTEVQEKALQDYGRYLGTAFQLVDDVLDYSANAQALGKNVGDDLAEGKPTLPLLHAMR 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G  ++    +  I  G    E + +   IM E+++L     RA    QKA D++  LP+
Sbjct: 252 HGNAQQAALIREAIEQGG-KREAIDEVLAIMAEHKSLDYAMNRAKEEAQKAVDAIEILPE 310

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+ +    + R
Sbjct: 311 SEYKQALISLAYLSVDR 327


>gi|121635537|ref|YP_975782.1| octaprenyl-diphosphate synthase [Neisseria meningitidis FAM18]
 gi|120867243|emb|CAM11012.1| octaprenyl-diphosphate synthase [Neisseria meningitidis FAM18]
          Length = 324

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y       LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDGKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++++ S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVDSDSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        +ALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVAALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|15676243|ref|NP_273375.1| octaprenyl-diphosphate synthase [Neisseria meningitidis MC58]
 gi|161870743|ref|YP_001599916.1| octaprenyl-diphosphate synthase [Neisseria meningitidis 053442]
 gi|218768897|ref|YP_002343409.1| octaprenyl-diphosphate synthase [Neisseria meningitidis Z2491]
 gi|7225547|gb|AAF40771.1| octaprenyl-diphosphate synthase [Neisseria meningitidis MC58]
 gi|121052905|emb|CAM09257.1| octaprenyl-diphosphate synthase [Neisseria meningitidis Z2491]
 gi|161596296|gb|ABX73956.1| octaprenyl-diphosphate synthase [Neisseria meningitidis 053442]
 gi|254670157|emb|CBA05202.1| octaprenyl-diphosphate synthase [Neisseria meningitidis alpha153]
 gi|316984329|gb|EFV63303.1| polyprenyl synthetase family protein [Neisseria meningitidis
           H44/76]
 gi|319411198|emb|CBY91603.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate
           synthetase; OPP synthetase) [Neisseria meningitidis WUE
           2594]
 gi|325128912|gb|EGC51766.1| octaprenyl-diphosphate synthase [Neisseria meningitidis N1568]
 gi|325140975|gb|EGC63481.1| octaprenyl-diphosphate synthase [Neisseria meningitidis CU385]
 gi|325198983|gb|ADY94439.1| octaprenyl-diphosphate synthase [Neisseria meningitidis G2136]
 gi|325199520|gb|ADY94975.1| octaprenyl-diphosphate synthase [Neisseria meningitidis H44/76]
          Length = 324

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        +ALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVTALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|325203440|gb|ADY98893.1| octaprenyl-diphosphate synthase [Neisseria meningitidis M01-240355]
          Length = 324

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 205/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        +ALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  +++   + +  +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRSY-FEKIHDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  LPDS  K +++++    L R++
Sbjct: 293 VDCAVAALDALPDSEVKDAMIQLAKESLVRVS 324


>gi|309783042|ref|ZP_07677761.1| octaprenyl-diphosphate synthase [Ralstonia sp. 5_7_47FAA]
 gi|308918150|gb|EFP63828.1| octaprenyl-diphosphate synthase [Ralstonia sp. 5_7_47FAA]
          Length = 325

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 130/311 (41%), Positives = 194/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L Y+G++   LA 
Sbjct: 15  EDMRAVDAVIRRRLGSEVVLINQIGEYIISAGGKRLRPVILLLVANALGYKGEHQHELAA 74

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 75  VVEFIHTATLLHDDVVDESDLRRGRKTANAVFGNAASVLVGDFLYSRAFQMMVQANSMRI 134

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 135 MQILADATNIISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 194

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 195 TEEAAAEYGRRIGTAFQIVDDLLDYTSTADQMGKNAGDDLREGKPTLPLIHLLSNGTEEQ 254

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A+ +   LP S ++++
Sbjct: 255 RALVRQAIEQG--GTEHFDAIFAAIQASGALEYTRQAAEREAAAAEAAANALPPSLFRQT 312

Query: 310 LMEVVDFCLQR 320
           L+++  F LQR
Sbjct: 313 LIDLCAFSLQR 323


>gi|319795463|ref|YP_004157103.1| polyprenyl synthetase [Variovorax paradoxus EPS]
 gi|315597926|gb|ADU38992.1| Polyprenyl synthetase [Variovorax paradoxus EPS]
          Length = 330

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 188/301 (62%), Gaps = 2/301 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           DL   DM +V+ +I +R+ + V ++  V +Y+I +GGKRLRP L L  +  L Y G+   
Sbjct: 16  DLIAGDMVEVDRVIARRLDTGVPLVSQVSQYIISAGGKRLRPALLLLMSGALGYTGEQRF 75

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            LA  +EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL S+AF M+++  
Sbjct: 76  NLAAVVEFIHTATLLHDDVVDESTLRRGRATANESFGNPASVLVGDFLYSRAFQMMLDAN 135

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           +   +E L+     +AEGE+ QL    +  + E  YL VI+SKTA LF A+  +++++AG
Sbjct: 136 NIRVMEILAEATNVIAEGEVLQLMNMHDASLDETAYLRVIRSKTAKLFEASTRLAAVLAG 195

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
           V   V +A  +YG  LG AFQ++DDVLDY G+ +E GKN+G+D R GK TLP+I A QRG
Sbjct: 196 VTPEVEEACATYGQALGTAFQVIDDVLDYAGDAHETGKNVGDDLREGKTTLPLIFAMQRG 255

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    ++ I  G  +   L K   I+RE  AL  +   A +  ++A D+LR  P +S
Sbjct: 256 TPEQSGLVRAAIEAGDTA--QLGKVVEIVRETGALDASRAAAAAEAKRAIDALRDFPSNS 313

Query: 306 W 306
            
Sbjct: 314 H 314


>gi|307611532|emb|CBX01209.1| hypothetical protein LPW_29081 [Legionella pneumophila 130b]
          Length = 322

 Score =  241 bits (615), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  +D   VN LI+ +I S V +I D+ ++++ SGGKRLRP++ L  +    Y+G +H+ 
Sbjct: 9   LVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKGKDHIS 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EF HTATLLHDDV+D+S LRRG+  A  +WG++ SVLVGD+L +Q+  +++E   
Sbjct: 69  LAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNLMVEVGI 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +E L  L+  +  +  GE++QL+   N  +T +DY  VI++KTA+LF+AA  +  ++   
Sbjct: 129 KEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIGPILTNA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              +R +L +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q G 
Sbjct: 189 PIEIRNSLYNYGLHLGNAFQLIDDALDYCSDATTLGKNIGDDLADGKATLPLIHALQNGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++   + ++  G +S  +L    I + +  A+  T+  A      A  +L  LPDS +
Sbjct: 249 ATQQQQIRESLMKGSLS--HLPDILIAIEQTEAIPFTKRIAAQEVDSALSALEILPDSVY 306

Query: 307 KKSLMEVVDFCLQR 320
           K++L+++  F L+R
Sbjct: 307 KEALVDLAKFALER 320


>gi|331008742|gb|EGH88798.1| octylprenyl diphosphate synthase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 322

 Score =  241 bits (615), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 186/312 (59%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   V+ +I K++ S V ++  +  Y+  +GGKRLRP+L L     L   GD+  LLA  
Sbjct: 13  DFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGDDLRLLAAT 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD S +RRG+  A  +WGN   VLVGDFL S++F M++E  S E +
Sbjct: 73  IEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPRVLVGDFLYSRSFEMMVELGSMEVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             LS     +AEGE+ QLS  ++   TEE Y+ VI+ KTA+LF A+   ++ +       
Sbjct: 133 RILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEASTHSAAALCNAPEVQ 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL+++G +LG+AFQLVDD+LDYRG+   +GKN+G+D   GKPTLP+I   + G+  + 
Sbjct: 193 SEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTLPLIYTMREGSPEQA 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G   +E+L+     +    AL  T   A  Y  +A   L  LP S ++  L
Sbjct: 253 ALVRQAIQKG--GLEDLESIRNAVESAGALDYTAQLARDYAARAIACLDALPPSEYRDVL 310

Query: 311 MEVVDFCLQRLN 322
           +E+ +F + R +
Sbjct: 311 VELSEFAVARTH 322


>gi|311109204|ref|YP_003982057.1| polyprenyl synthetase family protein [Achromobacter xylosoxidans
           A8]
 gi|310763893|gb|ADP19342.1| polyprenyl synthetase family protein [Achromobacter xylosoxidans
           A8]
          Length = 308

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 185/309 (59%), Gaps = 3/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M+ V+ +I +R+ S+V +I  +  Y+I +GGKR+RP + L  A  L Y G +H LLA  +
Sbjct: 1   MKAVDAVIRERLNSEVVLIRTIGDYIIGAGGKRMRPAMVLMVARALGYEGTHHQLLAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGD+L S++F M++E  S   + 
Sbjct: 61  EFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDYLYSRSFEMMVEANSMRVMS 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE+ QL    + DV++E YL V++ KTA LF AA +V +++AG      
Sbjct: 121 ILSEATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKLFEAAAQVGAVLAGATPEQE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
            A  +YG ++G AFQLVDDVLDY G+   +GKN+G+D R GKPTLP+I   + GT  ++ 
Sbjct: 181 AAAAAYGRHVGTAFQLVDDVLDYSGDAAALGKNVGDDLREGKPTLPLIRVMEVGTPEQQQ 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G      +  A   ++   AL      A +    A+ +L   P S +  SL+
Sbjct: 241 LIRDAIKTGDADFAAVAAA---IQATDALEHARQAAVAEADLARQALSGYPISPFLNSLL 297

Query: 312 EVVDFCLQR 320
           E   F + R
Sbjct: 298 EFCAFAVNR 306


>gi|54298645|ref|YP_125014.1| hypothetical protein lpp2709 [Legionella pneumophila str. Paris]
 gi|53752430|emb|CAH13862.1| hypothetical protein lpp2709 [Legionella pneumophila str. Paris]
          Length = 322

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 199/317 (62%), Gaps = 2/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + +L  +D   VN LI+ +I S V +I D+ ++++ SGGKRLRP++ L  +    Y+G +
Sbjct: 6   IRELVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKGKD 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H+ LA  +EF HTATLLHDDV+D+S LRRG+  A  +WG++ SVLVGD+L +Q+  +++E
Sbjct: 66  HISLAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNLMVE 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
              +E L  L+  +  +  GE++QL+   N  +T +DY  VI++KTA+LF+AA  +  ++
Sbjct: 126 VGIKEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIGPIL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
                 +R +L +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q
Sbjct: 186 TNAPIEIRDSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADGKATLPLIHALQ 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
            G   ++   + ++  G +S  +L    I + +  A+  T+  A      A  +L  LPD
Sbjct: 246 NGNATQQQQIRESLMKGSLS--HLPDILIAIEQTEAIPFTKRIAAQEVDSALSALEILPD 303

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K++L+++  F L+R
Sbjct: 304 SVYKEALVDLAKFALER 320


>gi|113969238|ref|YP_733031.1| trans-hexaprenyltranstransferase [Shewanella sp. MR-4]
 gi|113883922|gb|ABI37974.1| Trans-hexaprenyltranstransferase [Shewanella sp. MR-4]
          Length = 331

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 188/310 (60%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+G+ H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVDYQGEAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S   L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDSMRVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + + TEE Y+ VI  KTA LF AA  +++++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPNTTEESYMRVIYCKTAKLFEAATLLAAVLAGATPEQ 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I A   GT+ E+
Sbjct: 201 ETALGDYGKYLGTAFQLTDDLLDYTADSEELGKNIGDDLAEGKPTLPLIYAIAHGTEEEQ 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G      ++K    +    AL  T+ +A     KA  +L  LPDS +K +L
Sbjct: 261 QLIRQAIEQGD-GTHAIEKIVAALHHCGALTYTQQKAIEESNKAIAALAVLPDSDFKTAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 ISLAKISVDR 329


>gi|260912975|ref|ZP_05919460.1| octaprenyl-diphosphate synthase [Pasteurella dagmatis ATCC 43325]
 gi|260632965|gb|EEX51131.1| octaprenyl-diphosphate synthase [Pasteurella dagmatis ATCC 43325]
          Length = 358

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 190/320 (59%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ ++ L   DM+K N  IL ++ S+V +I  +  Y+I SGGKR+RPM+ +  A  L Y 
Sbjct: 38  IETIQQLIQLDMQKTNEAILAQLNSNVALINQLGYYIIQSGGKRIRPMIAILAARALGYT 97

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            D  +  A  IEFIHTATLLHDDVVD+S LRRG   A   +GN  SVLVGDF+ ++AF +
Sbjct: 98  SDEPITCATFIEFIHTATLLHDDVVDESELRRGNPTANAEFGNAASVLVGDFIYTRAFQL 157

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +  S   L+ +S     +AEGE++QL    + + TEE+Y+ VI  KTA LF AA   S
Sbjct: 158 MTQLNSLRILKVMSDATNVIAEGEVQQLMNVNDPNTTEENYMQVIYGKTARLFEAATHCS 217

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++A    +  +AL+ YG  LG AFQLVDD+LDY      +GKN+G+D   GKPTLP++ 
Sbjct: 218 AILAKATAAQEKALQDYGRYLGTAFQLVDDILDYSSNAQTLGKNLGDDLAEGKPTLPLLH 277

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G   +    +  I  G    + L     IM E+++L     RA    QKA D++  
Sbjct: 278 AMHNGNPEQAKLIRDAIEQGG-KRDILDTVLAIMAEHKSLDYAMNRAKEEAQKAVDAIAL 336

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ +K++L+ +    ++R
Sbjct: 337 LPENEYKQALISLAYLSVER 356


>gi|117921658|ref|YP_870850.1| polyprenyl synthetase [Shewanella sp. ANA-3]
 gi|117613990|gb|ABK49444.1| Polyprenyl synthetase [Shewanella sp. ANA-3]
          Length = 331

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 188/310 (60%), Gaps = 1/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM+ VN LI K++ SDV +I  +  Y+I  GGKRLRP+L++  A  ++Y+G+ H+ LA  
Sbjct: 21  DMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVDYQGEAHLKLAAI 80

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTA+LLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL +++F M+ E  S   L
Sbjct: 81  IEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQMMTELDSMRVL 140

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
             L+     LAEGE+ QL    + + TEE Y+ VI  KTA LF AA  +++++AG     
Sbjct: 141 RVLADTTNVLAEGEVLQLMNCNDPNTTEESYMRVIYCKTAKLFEAATLLAAVLAGATPEQ 200

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL  YG  LG AFQL DD+LDY  +  E+GKNIG+D   GKPTLP+I A   GT+ E+
Sbjct: 201 EAALGDYGKYLGTAFQLTDDLLDYTADSEELGKNIGDDLAEGKPTLPLIYAIAHGTEEEQ 260

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G      ++K    +    AL  T+ +A     KA  +L  LPDS +K +L
Sbjct: 261 QLIRQAIEQGD-GTHAIEKIVAALHHCGALTYTQQKAIEESNKAIAALAVLPDSDFKTAL 319

Query: 311 MEVVDFCLQR 320
           + +    + R
Sbjct: 320 ISLAKISVDR 329


>gi|78223658|ref|YP_385405.1| polyprenyl synthetase [Geobacter metallireducens GS-15]
 gi|78194913|gb|ABB32680.1| Polyprenyl synthetase [Geobacter metallireducens GS-15]
          Length = 322

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 186/310 (60%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D++ V     K + SDV +I  V +Y++ SGGKR+RP L L  A +  Y GD HV LA  
Sbjct: 11  DLKNVEAQFKKDLESDVYLIRKVGEYVLASGGKRIRPTLLLLAAKLCGYTGDRHVPLASV 70

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTATLLHDDVVD++ LRRG  +A  VWGN+ SVLVGDFL S++F ++++      L
Sbjct: 71  IEFIHTATLLHDDVVDNATLRRGNASANEVWGNEASVLVGDFLFSKSFSLMVQAGDLRVL 130

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + +S     +AEGE+ QL  + +LD+T E Y+ V+KSKTAVL SAA E  +++       
Sbjct: 131 KVISDATTIIAEGEVLQLLCTSDLDMTLERYIEVVKSKTAVLLSAACEAGAILGKATPEQ 190

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL+ +GM+LGIAFQL+DD LDY     + GK IG D   GK TLP+I   ++ T  E+
Sbjct: 191 ELALRDFGMDLGIAFQLMDDTLDYTASEEQFGKEIGHDLEEGKITLPLIHTLRKCTDEER 250

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
               + +    +   + +  F ++ +   +  T   A  Y  + K+ L+  P S+ K++ 
Sbjct: 251 ETIAAVVEKEVMEPGDFEAVFALVHKYGGIQYTTEVAGEYIARCKEHLQAFPASTEKQAA 310

Query: 311 MEVVDFCLQR 320
           +++ D+ + R
Sbjct: 311 LDLADYVVSR 320


>gi|54295495|ref|YP_127910.1| hypothetical protein lpl2582 [Legionella pneumophila str. Lens]
 gi|148358609|ref|YP_001249816.1| octaprenyl diphosphate synthase IspB [Legionella pneumophila str.
           Corby]
 gi|53755327|emb|CAH16823.1| hypothetical protein lpl2582 [Legionella pneumophila str. Lens]
 gi|148280382|gb|ABQ54470.1| octaprenyl diphosphate synthase IspB [Legionella pneumophila str.
           Corby]
          Length = 322

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  +D   VN LI+ +I S V +I D+ ++++ SGGKRLRP++ L  +    Y+G +H+ 
Sbjct: 9   LVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKGKDHIS 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EF HTATLLHDDV+D+S LRRG+  A  +WG++ SVLVGD+L +Q+  +++E   
Sbjct: 69  LAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNLMVEVGI 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +E L  L+  +  +  GE++QL+   N  +T +DY  VI++KTA+LF+AA  +  ++   
Sbjct: 129 KEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIGPILTNA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              +R +L +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q G 
Sbjct: 189 PIEIRNSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADGKATLPLIHALQNGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++   + ++  G +S  +L    I + +  A+  T+  A      A  +L  LPDS +
Sbjct: 249 ATQQQQIRESLMKGSLS--HLPDILIAIEQTEAIPFTKRIAAQEVDSALSALEILPDSVY 306

Query: 307 KKSLMEVVDFCLQR 320
           K++L+++  F L+R
Sbjct: 307 KEALVDLAKFALER 320


>gi|220936362|ref|YP_002515261.1| octaprenyl-diphosphate synthase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997672|gb|ACL74274.1| octaprenyl-diphosphate synthase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 322

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/314 (43%), Positives = 187/314 (59%), Gaps = 2/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   DM  VN  I +R+ S V +I  +  Y+I SGGKRLRP+L L +A         H+ 
Sbjct: 9   LVADDMNAVNDRIRERLQSSVVLINQLGHYIINSGGKRLRPLLVLLSARACGAGDRRHID 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IEFIHTATLLHDDVVD S LRRG+  A  ++GN+ SVLVGDFL S++F M++E  S
Sbjct: 69  LAAIIEFIHTATLLHDDVVDASELRRGRETANALFGNEASVLVGDFLYSRSFEMMVEIGS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E L+    T+AEGE+ QL    + D  EE Y+ VI+SKTA LF AA  + +++ G 
Sbjct: 129 MRVMEILAHTTNTIAEGEVLQLLNCHDADTPEERYMEVIQSKTAKLFEAAARIGAVLGGQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
             SV QA+ +YGM+LG AFQL+DDVLDY     EMGKN+G+D   GKPTLP+I A + G 
Sbjct: 189 PESVEQAMAAYGMHLGTAFQLIDDVLDYGASAEEMGKNMGDDLAEGKPTLPLIHAMRVGD 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +    +  I  G     +  +   I++   +L  T   A +   +A  SL  LPD+  
Sbjct: 249 ADQAGLIREAIEQGGRDYAD--RVLGIIQATGSLDYTRAVAAAEADRAAASLAVLPDTPE 306

Query: 307 KKSLMEVVDFCLQR 320
           +++L  +  F + R
Sbjct: 307 RQALEFLARFSVTR 320


>gi|270159180|ref|ZP_06187836.1| solanesyl diphosphate synthase [Legionella longbeachae D-4968]
 gi|289165992|ref|YP_003456130.1| octaprenyl-diphosphate synthase [Legionella longbeachae NSW150]
 gi|269987519|gb|EEZ93774.1| solanesyl diphosphate synthase [Legionella longbeachae D-4968]
 gi|288859165|emb|CBJ13094.1| putative octaprenyl-diphosphate synthase [Legionella longbeachae
           NSW150]
          Length = 322

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 197/310 (63%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D   VN LI+ +I S + +I  +  ++I SGGKRLRP+L L T+    Y+G +H+ LA  
Sbjct: 13  DFNAVNNLIINKIESQIGLIDKMSHHMIESGGKRLRPLLVLLTSNACGYQGQDHIDLAAM 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EF HTATLLHDDV+D+S LRRG+  A  +WG++ S+LVGD+L +Q+  ++++  + E L
Sbjct: 73  VEFFHTATLLHDDVIDESTLRRGRQTANNIWGSKASILVGDYLFTQSIELMVDINNPEVL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           +  +  A  ++ GE++QL+   N  +T E+Y  VI++KTA+LF+AA  +  +++     +
Sbjct: 133 KLFARTALEISCGEVKQLTNRHNPALTFEEYFDVIRAKTALLFAAAACIGPILSNSSKEM 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           + AL +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q GT+ +K
Sbjct: 193 QNALYAYGLHLGNAFQLIDDALDYCSDAKTIGKNIGDDLADGKATLPLIYALQHGTEVQK 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              + ++  G  +++ L +    + E +A+  T+  A      A  +L  LPDS +K +L
Sbjct: 253 QQIEESLKHG--TLDFLPEILGALEETKAIEYTKGIAAKEVNTAISNLALLPDSKYKNAL 310

Query: 311 MEVVDFCLQR 320
           +E+  F L R
Sbjct: 311 IELAQFALLR 320


>gi|85058340|ref|YP_454042.1| octaprenyl diphosphate synthase [Sodalis glossinidius str.
           'morsitans']
 gi|84778860|dbj|BAE73637.1| octaprenyl-diphosphate synthase [Sodalis glossinidius str.
           'morsitans']
          Length = 323

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 188/320 (58%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           ++ + +LT +DM +VN  I +++ S+V +I  +  Y+I  GGKR+RPM+ +  A  L Y+
Sbjct: 3   IEQITELTAQDMAEVNTAIREQLNSEVALINQLGHYIISGGGKRIRPMIAVLAARALHYQ 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGDF+ ++AF M
Sbjct: 63  GKQHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +   +S   LE +S     +AEGE+ QL    + D+T ++Y+ VI SKTA LF AA + S
Sbjct: 123 MTALESLRVLELMSEAVNIIAEGEVLQLMNCNDPDITIDNYMRVIYSKTARLFEAASQSS 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++AG       AL+ YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ 
Sbjct: 183 AILAGADACQEAALRDYGRYLGTAFQLIDDLLDYGADGKTLGKNTGDDLNEGKPTLPLLH 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  +    +  I  G      L+     M +  +L  T   A     KA   L C
Sbjct: 243 AMRNGTPEQAALIRQAIEQGN-GRHLLETVLKTMHQCDSLGYTRRCAEEEADKAIACLDC 301

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           L  S ++ +L  +    +QR
Sbjct: 302 LSPSPYRDALESLAHVAVQR 321


>gi|37678653|ref|NP_933262.1| geranylgeranyl pyrophosphate synthase [Vibrio vulnificus YJ016]
 gi|37197393|dbj|BAC93233.1| geranylgeranyl pyrophosphate synthase [Vibrio vulnificus YJ016]
          Length = 306

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 180/296 (60%), Gaps = 1/296 (0%)

Query: 25  SDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDV 84
           +DV +I  +  Y+I  GGKRLRP+L + +A  L Y+G+ H   A  IEFIHTATLLHDDV
Sbjct: 10  NDVSLINQLGFYIISGGGKRLRPLLAVLSARALGYQGNAHTTAAAFIEFIHTATLLHDDV 69

Query: 85  VDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGE 144
           VD+S +RRGK  A   +GN  SVLVGDF+ +++F M+ E  S + L+ +S     +AEGE
Sbjct: 70  VDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMMTELGSMKILKLMSDAVNIIAEGE 129

Query: 145 LRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIA 204
           + QL    + D TEE Y+ VI SKTA LF AA ++ +++      V  AL++YG  LG A
Sbjct: 130 VLQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGAILNDAPAEVETALQNYGKYLGTA 189

Query: 205 FQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISV 264
           FQL+DDV+DY  +  EMGKN+G+D   GKPTLP++ A +          +  I +    +
Sbjct: 190 FQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLHAMRHTNAENAQMIREAIENAN-GM 248

Query: 265 ENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320
           E L     +M++  +L  TE +A     KA   L+ LP+S +K++L+ +    ++R
Sbjct: 249 ERLDDILAVMQQAGSLTYTEAKAMEEADKAIAELQVLPESEYKQALIALAHMAVKR 304


>gi|52842862|ref|YP_096661.1| octaprenyl diphosphate synthase IspB [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629973|gb|AAU28714.1| octaprenyl diphosphate synthase IspB [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 322

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  +D   VN LI+ +I S V +I D+ ++++ SGGKRLRP++ L  +    Y+G +H+ 
Sbjct: 9   LVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKGKDHIS 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EF HTATLLHDDV+D+S LRRG+  A  +WG++ SVLVGD+L +Q+  +++E   
Sbjct: 69  LAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNLMVEVGI 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +E L  L+  +  +  GE++QL+   N  +T +DY  VI++KTA+LF+AA  +  ++   
Sbjct: 129 KEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIGPILTNA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              +R +L +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q G 
Sbjct: 189 PIELRNSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADGKATLPLIHALQNGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++   + ++  G +S  +L    I + +  A+  T+  A      A  +L  LPDS +
Sbjct: 249 ATQQQQIRESLMKGSLS--HLPDILIAIEQTEAIPFTKRIAAQEVDSALSALEILPDSVY 306

Query: 307 KKSLMEVVDFCLQR 320
           K++L+++  F L+R
Sbjct: 307 KEALVDLAKFALER 320


>gi|296108301|ref|YP_003620002.1| octaprenyl diphosphate synthase IspB [Legionella pneumophila
           2300/99 Alcoy]
 gi|295650203|gb|ADG26050.1| octaprenyl diphosphate synthase IspB [Legionella pneumophila
           2300/99 Alcoy]
          Length = 322

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L  +D   VN LI+ +I S V +I D+ ++++ SGGKRLRP++ L  +    Y+G +H+ 
Sbjct: 9   LVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKGKDHIS 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EF HTATLLHDDV+D+S LRRG+  A  +WG++ SVLVGD+L +Q+  +++E   
Sbjct: 69  LAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNLMVEVGI 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +E L  L+  +  +  GE++QL+   N  +T +DY  VI++KTA+LF+AA  +  ++   
Sbjct: 129 KEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIGPILTNA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              +R +L +YG++LG AFQL+DD LDY  +   +GKNIG+D  +GK TLP+I A Q G 
Sbjct: 189 PIEIRDSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADGKATLPLIHALQNGN 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             ++   + ++  G +S  +L    I + +  A+  T+  A      A  +L  LPDS +
Sbjct: 249 ATQQQQIRESLMKGSLS--HLPDILIAIEQTEAIPFTKRIAAQEVDSALSALGILPDSVY 306

Query: 307 KKSLMEVVDFCLQR 320
           K++L+++  F L+R
Sbjct: 307 KEALVDLAKFALER 320


>gi|254427749|ref|ZP_05041456.1| polyprenyl synthetase superfamily [Alcanivorax sp. DG881]
 gi|196193918|gb|EDX88877.1| polyprenyl synthetase superfamily [Alcanivorax sp. DG881]
          Length = 323

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 191/311 (61%), Gaps = 3/311 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D E VN  I   + S+V +I +V  Y+I SGGKRLRP++ +  A    Y+GD HV +A  
Sbjct: 13  DFEAVNQFISHHLDSNVPLIREVGDYIIQSGGKRLRPLIAILCARAAGYQGDRHVDVAAI 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEF+HTATLLHDDVVD+S LRRG+     VWGN  SVLVGDFL+S+A  +++  +    L
Sbjct: 73  IEFLHTATLLHDDVVDESNLRRGRPTVNAVWGNAASVLVGDFLISRALQLMVALRHPRLL 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           +  S    T++EGE+ QL   ++ + +EE+Y+ VI  KTA +F +A E  +++   + S 
Sbjct: 133 DIFSQSTNTISEGEVLQLINVRDPNTSEENYMRVIHHKTAKMFESAAETGAVLGADEVSD 192

Query: 191 R-QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A  +YG +LGIAFQL+DDVLDY+G+ +E+GKN+G+D   GKPTLP+I     G+  +
Sbjct: 193 HVDAFATYGRHLGIAFQLIDDVLDYQGDASELGKNVGDDLAEGKPTLPLIYTIANGSPEQ 252

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
               K  I  G   +E+L++    +R +  L  T  +A    + A +++  +P S +K +
Sbjct: 253 ATLIKDAIRSG--GLEHLEQIVETVRASGGLQYTVDKAAEQTRIALEAIAQVPASPYKDA 310

Query: 310 LMEVVDFCLQR 320
           L  + +  L+R
Sbjct: 311 LFRLAEESLKR 321


>gi|261379260|ref|ZP_05983833.1| octaprenyl-diphosphate synthase [Neisseria subflava NJ9703]
 gi|284797691|gb|EFC53038.1| octaprenyl-diphosphate synthase [Neisseria subflava NJ9703]
          Length = 324

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/332 (39%), Positives = 203/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L         D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPDDLAKVNAVINQAVQSDVALISQIGTYIISAGGKRLRPIITILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + +  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGHDDEKLYSLAAMVEFIHTSTLLHDDVVDESELRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEQYVQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ---- 292
           P+I   + G+++         ND + ++EN  +++   + +  +V+++   YS  +    
Sbjct: 241 PLIYLMRNGSEQ-------AANDVRYALENADRSY-FEKIHDYVVNSDALPYSISEAKKA 292

Query: 293 --KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
             KA  SL  LPDS  K++++++    L R++
Sbjct: 293 VDKAIASLDVLPDSEVKEAMIQLAKESLARVS 324


>gi|322418219|ref|YP_004197442.1| poluprenyl synthetase [Geobacter sp. M18]
 gi|320124606|gb|ADW12166.1| Polyprenyl synthetase [Geobacter sp. M18]
          Length = 322

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 189/312 (60%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D++ V     K + SDV +I  V +Y++ SGGKR+RP L L  A +  Y G   V LA 
Sbjct: 10  EDLKNVELQFKKDLQSDVPLIRKVGEYVLSSGGKRIRPALVLLAARLCGYDGSRSVPLAS 69

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD++ LRRG  +A  +WGN+ SVLVGDFL S++F +++       
Sbjct: 70  VVEFIHTATLLHDDVVDNANLRRGLASANTLWGNEASVLVGDFLFSKSFSLMVTDGDLGI 129

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+     +AEGE+ QL  + +LD+T E Y+ V++SKTA+L SAA EV +++ G +  
Sbjct: 130 LKVLADATTMIAEGEVLQLVCTSDLDITVERYIEVVRSKTAILLSAACEVGAILGGAEPG 189

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
           +RQA+  YGM+LGIAFQL+DD LDY     + GK+IG D   GK TLP+I   ++ +  E
Sbjct: 190 LRQAVADYGMDLGIAFQLMDDTLDYTASQEQFGKSIGHDLEEGKITLPLIHTLKQCSDEE 249

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           ++   S +    +S E+ +    +++    +  T   A  +    K  L   P S  +++
Sbjct: 250 RDLIASVVEKDLLSDEDFELVLALVQRYGGIEHTVASAGEHVALCKKHLEKFPPSQAREA 309

Query: 310 LMEVVDFCLQRL 321
           + ++ D+ + R+
Sbjct: 310 MADLADYVVTRV 321


>gi|241760794|ref|ZP_04758885.1| octaprenyl-diphosphate synthase [Neisseria flavescens SK114]
 gi|241318691|gb|EER55243.1| octaprenyl-diphosphate synthase [Neisseria flavescens SK114]
          Length = 324

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/332 (39%), Positives = 203/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L         D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPDDLAKVNAVINQAVQSDVALISQIGTYIISAGGKRLRPIITILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + +  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGHDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEQYVQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASTEHEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ---- 292
           P+I   + G+++         ND + ++EN  +++   + +  +V+++   YS  +    
Sbjct: 241 PLIYLMRNGSEQ-------AANDVRHALENADRSY-FEKIHDYVVNSDALPYSISEAKKA 292

Query: 293 --KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
             KA  SL  LPDS  K++++++    L R++
Sbjct: 293 VDKAIASLDVLPDSEVKEAMIQLAKESLARVS 324


>gi|67459231|ref|YP_246855.1| octaprenyl-diphosphate synthase [Rickettsia felis URRWXCal2]
 gi|67004764|gb|AAY61690.1| Octaprenyl-diphosphate synthase [Rickettsia felis URRWXCal2]
          Length = 327

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 208/329 (63%), Gaps = 17/329 (5%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+
Sbjct: 5   VKIQQDLK-DEVTKLNDLIISCLKSDEELIETVGKYLLEAGGKRIRPLLTIITAKMFDYK 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 64  GDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF A+ EV
Sbjct: 124 MVASGSIKAMNVLAKASAIISEGEVIQLVKLNERRIITIDEYQQIVKSKTAELFGASCEV 183

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 184 GAIIAEQVDHISKDMRDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPLI 243

Query: 240 LAFQRGTKREKNFWKSTI-------NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ 292
             + +  +++K  W   I       ND  I V  L      M E+    +T     +   
Sbjct: 244 FLYNK-LEQDKQLWLENIIKCDKRTNDEFIKVREL------MIEHEIHNETVSYLSNLEN 296

Query: 293 KAKDSLRCLP-DSSWKKSLMEVVDFCLQR 320
           +A   L  +P  +S+K  L  ++ F L R
Sbjct: 297 EANKLLNKIPVQNSYKDYLFSIIRFILDR 325


>gi|297518736|ref|ZP_06937122.1| octaprenyl diphosphate synthase [Escherichia coli OP50]
          Length = 286

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 173/285 (60%), Gaps = 1/285 (0%)

Query: 36  YLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKV 95
           Y++  GGKR+RPM+ +  A  + Y G+ HV +A  IEFIHTATLLHDDVVD+S +RRGK 
Sbjct: 1   YIVSGGGKRIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKA 60

Query: 96  AARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLD 155
            A   +GN  SVLVGDF+ ++AF M+    S + LE +S     +AEGE+ QL    + D
Sbjct: 61  TANAAFGNAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPD 120

Query: 156 VTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYR 215
           +TEE+Y+ VI SKTA LF AA + S ++AG      + L+ YG  LG AFQL+DD+LDY 
Sbjct: 121 ITEENYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYN 180

Query: 216 GEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMR 275
            +  ++GKN+G+D   GKPTLP++ A   GT  +    ++ I  G      L+     M 
Sbjct: 181 ADGEQLGKNVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGN-GRHLLEPVLEAMN 239

Query: 276 ENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320
              +L  T  RA     KA  +L+ LPD+ W+++L+ +    +QR
Sbjct: 240 ACGSLEWTRQRAEEEADKAIAALQVLPDTPWREALIGLAHIAVQR 284


>gi|319639120|ref|ZP_07993876.1| octaprenyl-diphosphate synthase [Neisseria mucosa C102]
 gi|317399597|gb|EFV80262.1| octaprenyl-diphosphate synthase [Neisseria mucosa C102]
          Length = 324

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/332 (39%), Positives = 203/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L         D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPDDLAKVNAVINQAVQSDVALISQIGTYIISAGGKRLRPIITILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + +  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGHDDEKLYSLAAMVEFIHTSTLLHDDVVDESELRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEQYVQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ---- 292
           P+I   + G+++         ND + ++EN  +++   + +  +V+++   YS  +    
Sbjct: 241 PLIYLMRNGSEQ-------AANDVRHALENADRSY-FEKIHDYVVNSDALPYSISEAKKA 292

Query: 293 --KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
             KA  SL  LPDS  K++++++    L R++
Sbjct: 293 VDKAIASLDVLPDSEVKEAMIQLAKESLARVS 324


>gi|91786742|ref|YP_547694.1| trans-hexaprenyltranstransferase [Polaromonas sp. JS666]
 gi|91695967|gb|ABE42796.1| Trans-hexaprenyltranstransferase [Polaromonas sp. JS666]
          Length = 327

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 193/309 (62%), Gaps = 2/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M  ++ +I +R+ SDV ++  V +Y++ +GGKRLRP L L     L YRGD    LA  +
Sbjct: 19  MRGMDAVIERRLKSDVPLVSQVSQYIVAAGGKRLRPALLLLMCGALGYRGDQRYNLAAVV 78

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A   +GN  SVLVGDFL S+AF M++E      ++
Sbjct: 79  EFIHTATLLHDDVVDESTLRRGRATANEAFGNPASVLVGDFLYSRAFQMMVEAGDMRVMQ 138

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            L+     +AEGE+ QL    +  ++E+ YL VI+SKTA LF A+  +++L+A     V 
Sbjct: 139 TLAEATNVIAEGEVLQLMNMHDATLSEDGYLRVIRSKTAKLFEASARLAALLAQSPPPVE 198

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           Q+   YG  LG AFQ++DDVLDY G+V+EMGKN+G+D R GK TLP+I+A QR T+ E+ 
Sbjct: 199 QSCADYGQALGTAFQVIDDVLDYDGDVSEMGKNLGDDLREGKTTLPLIIAMQRCTELERA 258

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G    + + +   I+++  AL  T   A +  Q+A D+L+ LP + +  +L 
Sbjct: 259 VIRRAIETG--GTDQMPQIIAIVQQTGALQATRDAAAAEAQRALDALQVLPQNPYSNALG 316

Query: 312 EVVDFCLQR 320
            +    LQR
Sbjct: 317 HLASQLLQR 325


>gi|293398312|ref|ZP_06642503.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae F62]
 gi|291611236|gb|EFF40320.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae F62]
          Length = 324

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 202/332 (60%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPGHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  + +   +    +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRGY-FEKIRDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  L DS  K +++++    L R++
Sbjct: 293 VDCAVAALDALSDSEVKDAMIQLAKESLVRVS 324


>gi|71891880|ref|YP_277610.1| octaprenyl-diphosphate synthase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71795986|gb|AAZ40737.1| octaprenyl-diphosphate synthase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 323

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 192/318 (60%), Gaps = 1/318 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + +LT +DME VN  I  R+ S++ +I  +V+Y++ SGGKR+RPM+TL TA  L Y+   
Sbjct: 6   ISELTEQDMEDVNSEIRTRLASEITLINKLVQYIVDSGGKRIRPMITLLTARALCYKKTQ 65

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           HV +A  IEFIHTATLLHDDVVD S +RRG+    +++GN  SVLVGDF+ ++AF M+ E
Sbjct: 66  HVTIATLIEFIHTATLLHDDVVDKSHMRRGRKTTNIIFGNAASVLVGDFIYTRAFQMMTE 125

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +S   L  ++     +A GE+ QL+   +  +T + Y+ +I SKTA LF  A + S+++
Sbjct: 126 LESLRILSLMADAVNIIAAGEILQLTHCNDPTITIDSYMKIIYSKTARLFEVASQSSAIL 185

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A       +AL++YG  +GIAFQLVDDVLDY       GKN+G D   GK TLP++ A  
Sbjct: 186 ADANTCQEKALRNYGRYMGIAFQLVDDVLDYSASETIFGKNVGNDLNEGKLTLPLLHAIH 245

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
             T ++ +    +I +G      L      M ++ +L  T  RA +  +KA   L  LP 
Sbjct: 246 HSTSKQASLIIQSIKEGN-HRHLLNIILDTMHQHGSLEYTRKRAETEIKKAISCLDILPP 304

Query: 304 SSWKKSLMEVVDFCLQRL 321
           S ++++L  +  + +QR+
Sbjct: 305 SPYRQALASLATYTVQRI 322


>gi|225075990|ref|ZP_03719189.1| hypothetical protein NEIFLAOT_01015 [Neisseria flavescens
           NRL30031/H210]
 gi|224952705|gb|EEG33914.1| hypothetical protein NEIFLAOT_01015 [Neisseria flavescens
           NRL30031/H210]
          Length = 324

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 133/332 (40%), Positives = 201/332 (60%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L         D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPDDLAKVNVVINQAVQSDVALISQIGTYIISAGGKRLRPIITILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + +  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGHDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRKTANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE YL VI+ KTA LF AA
Sbjct: 121 AFQLMVGSGSMRILEVMADATNIIAEGEVMQLMNIGNTDITEEQYLQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPEHEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ---- 292
           P+I   + G++          ND + ++EN  +++   + +  +V+++   YS  +    
Sbjct: 241 PLIYLMRNGSEL-------AANDVRHALENADRSY-FEKIHDYVVNSDALPYSISEAKKA 292

Query: 293 --KAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
             KA  SL  LPDS  K +++++    L R++
Sbjct: 293 VDKAIASLNVLPDSEVKDAMIQLAKESLARVS 324


>gi|325267223|ref|ZP_08133886.1| octaprenyl-diphosphate synthase [Kingella denitrificans ATCC 33394]
 gi|324981284|gb|EGC16933.1| octaprenyl-diphosphate synthase [Kingella denitrificans ATCC 33394]
          Length = 324

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 197/315 (62%), Gaps = 12/315 (3%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+ +VN +I + + SDV +I  +  Y+I SGGKRLRP+LT+ +   L Y  D    LA  
Sbjct: 15  DLSRVNVVINRAVQSDVALISQIGTYIIGSGGKRLRPILTILSGKCLGYDDDKLYSLAAM 74

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++AF +++ + S + L
Sbjct: 75  VEFIHTSTLLHDDVVDESELRRGRKTANNLFGNAAAVLVGDFLYTRAFQLMVGSGSLKIL 134

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E ++     +AEGE+ QL    N+D+TE+ YL VI+ KTA LF AA +V +++AG  +  
Sbjct: 135 EVMADATNIIAEGEVMQLMNIGNVDITEQQYLQVIQYKTAKLFEAAAQVGAILAGADDEQ 194

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +ALK +GM +G AFQ+VDDVLDY G V ++GKN+G+D   GKPTLP+I   Q+G++  +
Sbjct: 195 ERALKEFGMYMGTAFQIVDDVLDYSGSVEQIGKNVGDDLAEGKPTLPLIYLMQQGSQAAR 254

Query: 251 NFWKSTINDGKISVENLKKAFI-----IMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
                   D + +++N  +A+       + E+  L     +A     +A   L+ LPD+ 
Sbjct: 255 -------QDVRTALQNADRAYFDKIHQYVTESDVLEYCMTQAKEAVNQAIHCLKRLPDNE 307

Query: 306 WKKSLMEVVDFCLQR 320
             +++ ++ +  + R
Sbjct: 308 VTQAMRQMAELSVVR 322


>gi|59802000|ref|YP_208712.1| IspB [Neisseria gonorrhoeae FA 1090]
 gi|194099557|ref|YP_002002687.1| IspB [Neisseria gonorrhoeae NCCP11945]
 gi|239999762|ref|ZP_04719686.1| IspB [Neisseria gonorrhoeae 35/02]
 gi|240014919|ref|ZP_04721832.1| IspB [Neisseria gonorrhoeae DGI18]
 gi|240081510|ref|ZP_04726053.1| IspB [Neisseria gonorrhoeae FA19]
 gi|240113789|ref|ZP_04728279.1| IspB [Neisseria gonorrhoeae MS11]
 gi|240116523|ref|ZP_04730585.1| IspB [Neisseria gonorrhoeae PID18]
 gi|240118747|ref|ZP_04732809.1| IspB [Neisseria gonorrhoeae PID1]
 gi|240121989|ref|ZP_04734951.1| IspB [Neisseria gonorrhoeae PID24-1]
 gi|240124286|ref|ZP_04737242.1| IspB [Neisseria gonorrhoeae PID332]
 gi|240126497|ref|ZP_04739383.1| IspB [Neisseria gonorrhoeae SK-92-679]
 gi|240128960|ref|ZP_04741621.1| IspB [Neisseria gonorrhoeae SK-93-1035]
 gi|254494548|ref|ZP_05107719.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae 1291]
 gi|260439720|ref|ZP_05793536.1| IspB [Neisseria gonorrhoeae DGI2]
 gi|268595575|ref|ZP_06129742.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|268597610|ref|ZP_06131777.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae FA19]
 gi|268599861|ref|ZP_06134028.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae MS11]
 gi|268602196|ref|ZP_06136363.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae PID18]
 gi|268604462|ref|ZP_06138629.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae PID1]
 gi|268682915|ref|ZP_06149777.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae PID332]
 gi|268685081|ref|ZP_06151943.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268687344|ref|ZP_06154206.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|291042968|ref|ZP_06568706.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae DGI2]
 gi|59718895|gb|AAW90300.1| putative octaprenyl-diphosphate synthase [Neisseria gonorrhoeae FA
           1090]
 gi|193934847|gb|ACF30671.1| IspB [Neisseria gonorrhoeae NCCP11945]
 gi|226513588|gb|EEH62933.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae 1291]
 gi|268548964|gb|EEZ44382.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|268551398|gb|EEZ46417.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae FA19]
 gi|268583992|gb|EEZ48668.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae MS11]
 gi|268586327|gb|EEZ51003.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae PID18]
 gi|268588593|gb|EEZ53269.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae PID1]
 gi|268623199|gb|EEZ55599.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae PID332]
 gi|268625365|gb|EEZ57765.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268627628|gb|EEZ60028.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|291013107|gb|EFE05076.1| octaprenyl-diphosphate synthase [Neisseria gonorrhoeae DGI2]
 gi|317165053|gb|ADV08594.1| IspB [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 324

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 202/332 (60%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIRVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPGHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G+++         ND + ++EN  + +   +    +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQGSEQ-------VANDVRTALENADRGY-FEKIRDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  L DS  K +++++    L R++
Sbjct: 293 VDCAVAALDALSDSEVKDAMIQLAKESLVRVS 324


>gi|148265763|ref|YP_001232469.1| polyprenyl synthetase [Geobacter uraniireducens Rf4]
 gi|146399263|gb|ABQ27896.1| Polyprenyl synthetase [Geobacter uraniireducens Rf4]
          Length = 322

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 184/312 (58%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D++ V     K + SDV +I  V +Y++ SGGKR+RP L L +A +  Y GD HV LA 
Sbjct: 10  EDLKNVELQFKKDLQSDVPLIRKVGEYVLSSGGKRIRPALLLLSAKLCGYHGDRHVPLAS 69

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEFIHTATLLHDDVVD++ LRRG  +A  +WGN+ SVLVGDFL S++F +++       
Sbjct: 70  VIEFIHTATLLHDDVVDNANLRRGLASANTLWGNEASVLVGDFLFSKSFSLMVADGDLNV 129

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ LS     +AEGE+ QL  + +LDVT E Y+ V+KSKTA+L SAA +  +++    + 
Sbjct: 130 LKVLSGATTIIAEGEVLQLVCTSDLDVTTERYIEVVKSKTAILLSAACQSGAILGKASSE 189

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              AL+++GM LGIAFQLVDD LDY     + GK+IG D   GK TLP+I   Q  T  E
Sbjct: 190 REVALQNFGMELGIAFQLVDDTLDYVASEEQFGKSIGHDLEEGKITLPLIHTLQHCTAAE 249

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           K      ++   +  ++    F ++ +   +      A  Y  + K  L    DS  K +
Sbjct: 250 KEKIAEVVDKDVLDEDDFAAVFELVHQYGGIDHAVTVAKDYVARCKAYLDVFEDSPEKYA 309

Query: 310 LMEVVDFCLQRL 321
           L+ + D+ + R+
Sbjct: 310 LVNLADYVVTRV 321


>gi|240017367|ref|ZP_04723907.1| IspB [Neisseria gonorrhoeae FA6140]
          Length = 324

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 201/332 (60%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D+ KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S   LE ++     +AEGE+ QL    N D+TEE Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIRVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++        QALK YGM +G AFQ++DDVLDY GE  E GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGKASPGHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQ--KA 294
           P+I   ++G       ++   ND + ++EN  + +   +    +V ++  AYS G+  KA
Sbjct: 241 PLIYLMRQG-------FEQVANDVRTALENADRGY-FEKIRDYVVRSDALAYSIGEARKA 292

Query: 295 KD----SLRCLPDSSWKKSLMEVVDFCLQRLN 322
            D    +L  L DS  K +++++    L R++
Sbjct: 293 VDCAVAALDALSDSEVKDAMIQLAKESLVRVS 324


>gi|238757559|ref|ZP_04618744.1| Octaprenyl-diphosphate synthase [Yersinia aldovae ATCC 35236]
 gi|238704321|gb|EEP96853.1| Octaprenyl-diphosphate synthase [Yersinia aldovae ATCC 35236]
          Length = 323

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 188/315 (59%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +  A  L Y+G  H+
Sbjct: 8   ELTAPDMAAVNATILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALHYKGSKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A   +GN  SVLVGD++ ++AF M+   +
Sbjct: 68  TVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDYIYTRAFQMMTGLE 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L  +S     +AEGE+ QL    N D+TEE+Y+ VI SKTA LF AA + ++++A 
Sbjct: 128 SLRVLTLMSAATNVIAEGEVLQLMNCNNPDITEENYMQVIYSKTARLFEAAAQSAAVLAE 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                  AL++YG  LG AFQL+DD+LDY  +   +GKN G+D   GKPTLP++ A   G
Sbjct: 188 ASEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTTLGKNTGDDLNEGKPTLPLLHAMHNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T  +    +  I  G      L+     M++  +L  T  RA     KA  +L+ LP++ 
Sbjct: 248 TSEQALMIRQAIEQGN-GRHLLEPVLAAMQQCGSLDYTRQRAEEEADKAIAALQILPENE 306

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L  +    +QR
Sbjct: 307 YRQALEGLAHIAVQR 321


>gi|51473666|ref|YP_067423.1| octaprenyl-diphosphate synthase [Rickettsia typhi str. Wilmington]
 gi|51459978|gb|AAU03941.1| octaprenyl-diphosphate synthase [Rickettsia typhi str. Wilmington]
          Length = 327

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 131/322 (40%), Positives = 209/322 (64%), Gaps = 3/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL  +++ ++N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+
Sbjct: 5   VKIQQDLK-EEVTQLNDLIISCLKSDTELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA A+EFIH ATLLHDDVVDDS LRR K    ++WG++TS+LVGDFL SQ+F +
Sbjct: 64  GDNHIKLASAVEFIHAATLLHDDVVDDSTLRRFKPTVNVIWGSKTSILVGDFLFSQSFKL 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           +I +   +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF AA EV
Sbjct: 124 MIASGCIKAMNVLARASVIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFGAACEV 183

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + V + ++ +GM LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 184 GAIIAEQVDRVSEDVQDFGMLLGTIFQVIDDLLDYLGSDKQVGKNIGDDFLEGKVTLPLI 243

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
             + +  + +K + ++ I   K + ++  K   +M ++    +T     S   +A + L 
Sbjct: 244 FLYHKLEQDKKLWLENMIKSDKRTKDDFIKIRDLMLKHAIYNETVNYLSSLENEANNLLN 303

Query: 300 CLP-DSSWKKSLMEVVDFCLQR 320
            +P  + +K  L  ++ F L R
Sbjct: 304 KIPVQNIYKYYLFSIIRFILYR 325


>gi|257092398|ref|YP_003166039.1| polyprenyl synthetase [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257044922|gb|ACV34110.1| Polyprenyl synthetase [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 320

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 187/320 (58%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+   +L   DM  V+ +I +R+ SD+ ++  V +Y+I  GGKRLRP L L  A  L+YR
Sbjct: 1   MEQFYNLIELDMTAVDAVIRRRLHSDIALVRQVAEYIIQGGGKRLRPALVLLAAGALDYR 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H  LA  IEFIHTATLLHDDVVD S LRRG+  A  ++GN  SVLVGDFL S+AF M
Sbjct: 61  GTHHHELAAVIEFIHTATLLHDDVVDGSDLRRGRDTANAIFGNSASVLVGDFLYSRAFQM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++       +  LS     +AEGE+ QL    + DV E  YL VI+ KTA LF AA ++ 
Sbjct: 121 MVAVDDMRVMRVLSDATNVIAEGEVLQLMNCHDADVDEAGYLQVIRYKTAKLFEAAAQLG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++I G   +  Q + +YG++LG AFQL+DDVLDY G   E GK++G+D   GKPTLP+I 
Sbjct: 181 AIIGGGSAAAEQGMATYGIHLGTAFQLIDDVLDYSGAEVETGKHLGDDLAEGKPTLPLIF 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
             Q G   +    +  I  G    ++       +R   AL     +A +  + A  +L  
Sbjct: 241 VLQHGNTEQAACVRRAIESG--GRDDFPNVLAAIRATGALDYARRKARAEAELAAAALSV 298

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           +P S +K SL+E+  F + R
Sbjct: 299 VPASQYKDSLLELSLFAVAR 318


>gi|94312038|ref|YP_585248.1| polyprenyl synthetase [Cupriavidus metallidurans CH34]
 gi|93355890|gb|ABF09979.1| octaprenyl diphosphate synthase [Cupriavidus metallidurans CH34]
          Length = 325

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 190/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L +A   +Y G  H  LA  
Sbjct: 16  DMRAVDAVIRRRLSSEVPLIEQIGEYIIGAGGKRLRPVILLLSARAFDYEGHRHHELAAV 75

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M++E  S   +
Sbjct: 76  VEFIHTATLLHDDVVDESELRRGRDTANAVFGNAASVLVGDFLYSRAFQMMVEAGSMRIM 135

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS     +AEGE+ QL    + +VT E YL VI+ KTA LF A+ ++ +++AG    +
Sbjct: 136 EILSNATNVIAEGEVLQLLNMHDPEVTVERYLQVIRYKTAKLFEASAQLGAVLAGADAEM 195

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG  +G AFQL+DD+LDY     +MGKN G+D R GKPTLP++   + GT +++
Sbjct: 196 EEAAAEYGRRIGTAFQLIDDMLDYTASAEQMGKNAGDDLREGKPTLPLLHLLEHGTAQQR 255

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    E+    F  +  + AL  T   A    + A+ +    PDS  K++L
Sbjct: 256 ELARDAIVQG--GTEHFDAVFSAIHASGALDVTFAAAQREAEAAEKAAMQFPDSPLKQTL 313

Query: 311 MEVVDFCLQR 320
           +++  F LQR
Sbjct: 314 IDLCAFSLQR 323


>gi|261868528|ref|YP_003256450.1| octaprenyl-diphosphate synthase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413860|gb|ACX83231.1| octaprenyl-diphosphate synthase (Octaprenyl
           pyrophosphatesynthetase) (OPP synthetase)
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 329

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 130/320 (40%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           MK ++ L+  DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + 
Sbjct: 9   MKAIQALSHGDMQKVNESILAQLNSDVALINQLGFYIVQGGGKRIRPLIAVLAARALGFD 68

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G   +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 69  GQQAITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQL 128

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           V + +S + L  ++     LAEGE++QL    +   +EE+Y+ VI SKTA LF  A + +
Sbjct: 129 VAQLESLKILRIMADATNVLAEGEVQQLMNVNDPQTSEENYMRVIYSKTARLFEVAAQAA 188

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IAG  ++  +AL++YG  LG AFQLVDDVLDY    N +GKN+G+D   GKPTLP++ 
Sbjct: 189 AIIAGADDTQEKALQNYGRYLGTAFQLVDDVLDYSANANALGKNVGDDLAEGKPTLPLLH 248

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G  ++    +  I  G    + +     IM E+ +L     RA    QKA D+++C
Sbjct: 249 AMHHGNAQQAALIRKAIEQGG-RRDAIDDVLAIMAEHNSLDYAMNRAKQEAQKAVDAIQC 307

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K +L+ +    + R
Sbjct: 308 LPESEYKLALISLAYLSVDR 327


>gi|300721522|ref|YP_003710797.1| octaprenyl diphosphate synthase [Xenorhabdus nematophila ATCC
           19061]
 gi|297628014|emb|CBJ88563.1| octaprenyl diphosphate synthase [Xenorhabdus nematophila ATCC
           19061]
          Length = 323

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 185/316 (58%), Gaps = 1/316 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           LT  DM  VN  IL ++ SDV +I  +  Y+I  GGKR+RPM+ +     L+   + H+ 
Sbjct: 9   LTADDMAAVNETILNQLNSDVALINQLGYYIISGGGKRIRPMIAVLAGKALQCGDEKHIK 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           +A  IEFIHTATLLHDDVVD+S +RRGK  A  ++GN  SVLVGDF+ +++F M+ +  S
Sbjct: 69  VAALIEFIHTATLLHDDVVDESDMRRGKETANAIYGNAASVLVGDFIYTRSFQMMTDLDS 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              L+ +S     +AEGE+ QL    + D++E+DY+ VI SKTA LF  A   ++++A  
Sbjct: 129 MRVLKLMSDATNVIAEGEVMQLMNCNDPDISEDDYMRVIYSKTARLFEVAAHSAAILANA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
                 AL+ YG  LG AFQL+DD+LDY  + N +GKN G+D   GKPTLP++ A   GT
Sbjct: 189 TPEQEIALRDYGCYLGTAFQLIDDLLDYDSDNNTLGKNTGDDLNEGKPTLPLLHAMNHGT 248

Query: 247 KREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSW 306
             +    +  I  G      L      M++  +L  T  RA     KA  +L+ L DS +
Sbjct: 249 PEQSALIRDAIEKGN-GRHLLDTVLATMKQCGSLKYTRQRAEEEADKAISALQILDDSPY 307

Query: 307 KKSLMEVVDFCLQRLN 322
           K +L+ +    +QR++
Sbjct: 308 KAALVGLAHIAVQRVS 323


>gi|157964658|ref|YP_001499482.1| octaprenyl-diphosphate synthase [Rickettsia massiliae MTU5]
 gi|157844434|gb|ABV84935.1| Octaprenyl-diphosphate synthase [Rickettsia massiliae MTU5]
          Length = 363

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/316 (41%), Positives = 206/316 (65%), Gaps = 5/316 (1%)

Query: 9   LKD-MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLL 67
           LKD + K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+GDNH+ L
Sbjct: 47  LKDAVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYKGDNHIKL 106

Query: 68  ACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ 127
           A A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +++ + S 
Sbjct: 107 ASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKLMVASGSI 166

Query: 128 EALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF AA EV ++IA  
Sbjct: 167 KAMNVLAKASAIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFGAACEVGAIIAEQ 226

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I  + +  
Sbjct: 227 VDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQIGKNIGDDFLEGKVTLPLIFLYNK-L 285

Query: 247 KREKNFW-KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP-DS 304
           +++K  W ++ I   K + ++  K   +M ++    +T     +   +A   L  +P  +
Sbjct: 286 EQDKQLWLENIIKCDKRTKDDFVKIHDLMVKHEIYNETVNYLSNLENEASKLLNKIPVQN 345

Query: 305 SWKKSLMEVVDFCLQR 320
            +K  L  ++ F L R
Sbjct: 346 IYKDYLFSMIKFILDR 361


>gi|153825628|ref|ZP_01978295.1| octaprenyl-diphosphate synthase [Vibrio cholerae MZO-2]
 gi|149740658|gb|EDM54765.1| octaprenyl-diphosphate synthase [Vibrio cholerae MZO-2]
          Length = 304

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 179/302 (59%), Gaps = 1/302 (0%)

Query: 19  ILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTAT 78
           I   + SDV +I  +  Y+I  GGKRLRP+L + +A  L Y+G +H   A  IEFIHTAT
Sbjct: 2   IHAXLNSDVSLINQLGFYIISGGGKRLRPLLAVLSAKALGYQGSHHTTAAAFIEFIHTAT 61

Query: 79  LLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVAC 138
           LLHDDVVD+S LRRGK  A   +GN  SVLVGDF+ +++F M+ E  S + L+ +S    
Sbjct: 62  LLHDDVVDESDLRRGKATANAAFGNAASVLVGDFIYTRSFQMMTELGSMKILKLMSDAVN 121

Query: 139 TLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYG 198
            +AEGE++QL    + D TE  Y+ VI SKTA LF AA ++ +++      V  A+++YG
Sbjct: 122 VIAEGEVQQLMNCNDPDTTEASYMQVIYSKTARLFEAATQIGAILCDASPEVELAMQNYG 181

Query: 199 MNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTIN 258
             LG AFQL+DDV+DY  + +EMGKN+G+D   GKPTLP++ A Q G   +    +  I 
Sbjct: 182 KYLGTAFQLIDDVMDYTSDGDEMGKNVGDDLAEGKPTLPLLYAMQHGNPEQAAMIREAIE 241

Query: 259 DGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCL 318
                +  L +    M +  +L  T  +A     KA   L  LP+S +K++L+ +    +
Sbjct: 242 KAN-GMSRLNEILAAMEQTGSLQYTIEKALHEADKAIAELAVLPESEYKQALITLAHMAV 300

Query: 319 QR 320
            R
Sbjct: 301 NR 302


>gi|187930136|ref|YP_001900623.1| Polyprenyl synthetase [Ralstonia pickettii 12J]
 gi|187727026|gb|ACD28191.1| Polyprenyl synthetase [Ralstonia pickettii 12J]
          Length = 325

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 193/311 (62%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y++ +GGKRLRP++ L  A  L Y+G++   LA 
Sbjct: 15  EDMRAVDAVIRRRLGSEVVLINQIGEYIVSAGGKRLRPVILLLVANALGYKGEHQHELAA 74

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 75  VVEFIHTATLLHDDVVDESDLRRGRKTANAVFGNAASVLVGDFLYSRAFQMMVQANSMRI 134

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++    +
Sbjct: 135 MQILADATNIISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSDADAA 194

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
             +A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 195 TEEAAAEYGRRIGTAFQIVDDLLDYTSTADQMGKNAGDDLREGKPTLPLIHLLSNGTEEQ 254

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           +   +  I  G    E+    F  ++ + AL  T   A      A+ +   LP S ++++
Sbjct: 255 RALVRQAIEQG--GTEHFDAIFAAIQASGALEYTRQAAEREAAAAEAAANALPPSLFRQT 312

Query: 310 LMEVVDFCLQR 320
           L+++  F LQR
Sbjct: 313 LIDLCAFSLQR 323


>gi|189425336|ref|YP_001952513.1| polyprenyl synthetase [Geobacter lovleyi SZ]
 gi|189421595|gb|ACD95993.1| Polyprenyl synthetase [Geobacter lovleyi SZ]
          Length = 322

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 194/320 (60%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+   +L  +D+++V     K + SDV +I  V +Y++ SGGKR+RP + L  A + EY+
Sbjct: 1   MQAALELIGEDLKQVEEQFRKDLESDVPLIRKVGEYVLASGGKRIRPAMLLLAARLCEYQ 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+  + LA  +EFIHTATLLHDDVVD + LRRG  +A  +WGN+ SVL+GDFL S++F +
Sbjct: 61  GNQAIPLASVVEFIHTATLLHDDVVDSATLRRGLASANTLWGNEASVLIGDFLFSKSFSL 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++   S + L  +S     +AEGE+ QL  +  +++TE+ Y+ V+++KTAVL SAA +  
Sbjct: 121 MVAAGSLDVLRVMSKATTVIAEGEVLQLLYTGEVELTEQQYIEVVRAKTAVLLSAACQCG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++ GV     QAL  +GM LGIAFQL+DD+LDY     E GK+IG D   GK TLP+I 
Sbjct: 181 AILGGVSPEQEQALADFGMELGIAFQLMDDILDYTASEEEFGKSIGHDLEEGKLTLPLIH 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A +  +  E+    + I   +++ E+ +    +++    +  T  +A          L C
Sbjct: 241 ALRGCSDEERGAVTAIIEKDELTPEDFRLVSDLVQSYGGIEYTVEKARDCVANCARHLSC 300

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
            P +S K +L+++ ++ + R
Sbjct: 301 FPANSCKAALLDLAEYVVTR 320


>gi|197119777|ref|YP_002140204.1| octaprenyl diphosphate synthase [Geobacter bemidjiensis Bem]
 gi|197089137|gb|ACH40408.1| octaprenyl diphosphate synthase [Geobacter bemidjiensis Bem]
          Length = 322

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 187/312 (59%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D++ V     K + SDV +I  V +Y++ SGGKR+RP L L  A +  Y G+  V LA 
Sbjct: 10  EDLKNVELQFKKDLQSDVPLIRKVGEYVLSSGGKRIRPGLVLLAARLCGYDGNRSVPLAS 69

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD++ LRRG  +A  +WGN+ SVLVGDFL S++F +++       
Sbjct: 70  VVEFIHTATLLHDDVVDNANLRRGLASANTLWGNEASVLVGDFLFSKSFSLMVTDGDLRI 129

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+     +AEGE+ QL  + +LD+T E Y+ V++SKTA+L SAA EV +++      
Sbjct: 130 LKVLADATTIIAEGEVLQLVCTSDLDITVERYIEVVRSKTAILLSAACEVGAILGEADPV 189

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
            RQAL  YGM+LGIAFQL+DD LDY     + GK+IG D   GK TLP+I   +  T +E
Sbjct: 190 HRQALADYGMDLGIAFQLMDDTLDYTASEEQFGKSIGHDLEEGKITLPLIHTLRNCTSQE 249

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           ++   S +    +S E+  +   +++    +  T   A  Y    K  L   P S+ + +
Sbjct: 250 RDLIASVVEKELLSDEDFAQVLELVQRYGGIEHTVASAGEYVVLCKQHLEKFPPSATRDA 309

Query: 310 LMEVVDFCLQRL 321
           L E+ ++ + R+
Sbjct: 310 LAELAEYVVTRV 321


>gi|73542643|ref|YP_297163.1| trans-hexaprenyltranstransferase [Ralstonia eutropha JMP134]
 gi|72120056|gb|AAZ62319.1| Trans-hexaprenyltranstransferase [Ralstonia eutropha JMP134]
          Length = 325

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 190/310 (61%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L +A    Y G+ H  LA  
Sbjct: 16  DMRAVDAVIRQRLSSEVPLIEQIGEYIISAGGKRLRPVILLMSARAFGYDGNRHHELAAV 75

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   +
Sbjct: 76  VEFIHTATLLHDDVVDESELRRGRETANAVFGNAASVLVGDFLYSRAFQMMVDAGSMRIM 135

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS     +AEGE+ QL    + DVT E YL VI+ KTA LF A+ ++ +++AG   ++
Sbjct: 136 EILSNATNVIAEGEVLQLLNMHDPDVTIERYLQVIRYKTAKLFEASAQLGAVLAGADAAM 195

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +A   YG  +G AFQL+DD+LDY     +MGKN G+D R GKPTLP++   + GT  ++
Sbjct: 196 EEAAAEYGRRIGTAFQLIDDMLDYTASAEQMGKNAGDDLREGKPTLPLLHLLEYGTPEQR 255

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              +  I  G    E+    F  +  + AL  T   A    + A+ + +  P S WK +L
Sbjct: 256 VLAREAIVQG--GTEHFDAVFSAIHASGALDVTFEAARREAEAAEKAAQQFPASDWKDTL 313

Query: 311 MEVVDFCLQR 320
           + + +F LQR
Sbjct: 314 IALCEFSLQR 323


>gi|148244492|ref|YP_001219186.1| octaprenyl-diphosphate synthase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326319|dbj|BAF61462.1| octaprenyl-diphosphate synthase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 323

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 136/323 (42%), Positives = 196/323 (60%), Gaps = 5/323 (1%)

Query: 1   MKMLED---LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALML 57
           MK L D   L   D++K + +++ R+ S+V +I  +  Y+I +GGKRLRP+L L  A   
Sbjct: 1   MKNLSDIQSLIKLDLKKTDEILINRLSSNVALINQMSHYIIHAGGKRLRPLLLLLCARAT 60

Query: 58  EYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQA 117
            Y+G +H L+A  IE IHTATLLHDD+VD+S+ RRGK     VWGN  S+LVGDFL S+A
Sbjct: 61  GYQGTHHYLMAVVIELIHTATLLHDDIVDESSTRRGKDTVNEVWGNAPSILVGDFLYSRA 120

Query: 118 FCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAAL 177
           F +++E      +  LS     +AEGE+ QL   +N ++TE +Y  VIK KTA LF AA 
Sbjct: 121 FEIMVEPNLMSIMCILSKTTNNIAEGEVLQLLNCQNDELTEVEYYAVIKQKTACLFQAAT 180

Query: 178 EVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237
           ++  L++ V  +   ALK+YG++LG AFQ++DDVLDY  +   +GK +G+D   GK TLP
Sbjct: 181 QIGGLLSAVNKTQETALKNYGLHLGNAFQIIDDVLDYESDAKTIGKEVGDDLSEGKTTLP 240

Query: 238 VILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDS 297
           +I A    +  +K   K  IN    S   + +   I++  +A   T  +AY   Q AK S
Sbjct: 241 MIYALSHTSGNDKQLLKDAINQADNS--KIVQVIKILQSVKAFDYTRNQAYKSAQLAKQS 298

Query: 298 LRCLPDSSWKKSLMEVVDFCLQR 320
           L  +P+S +K +L+ + D  LQR
Sbjct: 299 LNLIPNSEYKDALILLCDLSLQR 321


>gi|332994564|gb|AEF04619.1| Geranylgeranyl pyrophosphate synthase [Alteromonas sp. SN2]
          Length = 324

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/315 (40%), Positives = 192/315 (60%), Gaps = 2/315 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L+  DM+ VN LI +++ SDV +I  +  Y++ SGGKRLRP+LT+ +A  +     +H  
Sbjct: 9   LSNDDMQAVNHLIQQQVDSDVALINQLGFYIVNSGGKRLRPLLTVLSARAMGIENADHHT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S +RRG+  A  V+GNQ SVLVGDFL +++F M++  K 
Sbjct: 69  LAAIVEFIHTATLLHDDVVDESTMRRGRETANAVFGNQASVLVGDFLYTRSFQMMVSLKR 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              ++ LS     +AEGE+ QL    +   TE  Y  VI  KTA LF AA ++++++   
Sbjct: 129 MRVMDILSEATNQIAEGEVLQLMNCNDASTTEARYFDVIYGKTARLFEAATQLAAVLTDQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA-FQRG 245
             +V  A++ YG +LG AFQL DD+LDY  + +EMGKN G+D   GKPTLP++ A +   
Sbjct: 189 PENVEHAMQEYGKHLGTAFQLADDILDYMADSDEMGKNAGDDLAEGKPTLPLLYAMWNTD 248

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           ++ +K   +  I      + +L +   IM    AL  T   A +  + A DSL  +PDS 
Sbjct: 249 SEEDKALIRDAIEQSN-GLPHLTRIQQIMESTGALDYTRTCANNEVKMAIDSLSIIPDSP 307

Query: 306 WKKSLMEVVDFCLQR 320
           +K++L+ +    ++R
Sbjct: 308 YKEALIALAHISVER 322


>gi|253995893|ref|YP_003047957.1| trans-hexaprenyltranstransferase [Methylotenera mobilis JLW8]
 gi|253982572|gb|ACT47430.1| Trans-hexaprenyltranstransferase [Methylotenera mobilis JLW8]
          Length = 322

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 188/310 (60%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           DM  V+  I + + S+V ++  V +Y+I SGGKRLRPML L  A +       H  LA  
Sbjct: 13  DMRMVDTTIRQSLHSEVALVNQVAEYIINSGGKRLRPMLVLLAAGLFGEIQTQHHQLAAV 72

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S+ RRG+  A  ++GN  SVLVGDF+ S+AF M++  ++   +
Sbjct: 73  VEFIHTATLLHDDVVDESSKRRGQSTANALFGNAASVLVGDFVYSRAFQMMVAVQNMRVM 132

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS     +AEGE+ QL    N D++++ YL VI  KTA LF AA  + ++I+      
Sbjct: 133 EVLSNATNVIAEGEVLQLLNVNNADISDKAYLQVIHYKTAKLFEAATRLGAIISEASAKD 192

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             AL +YGM+LG AFQL+DD+LD  G   ++GKN+G+D   GKPTLP++ A +     + 
Sbjct: 193 EAALTAYGMHLGTAFQLIDDILDLSGNSEDIGKNLGDDLAEGKPTLPLLYAMRNSNTEQS 252

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              ++ I  G   +E+L +   I+  + AL   +  A +   + + ++   P+S +K++L
Sbjct: 253 QLIRNAIEQG--GLEHLTQVVEIVNNSGALDHVKKIAEAESAQCRAAIAHFPESKFKQAL 310

Query: 311 MEVVDFCLQR 320
           +E+ DF + R
Sbjct: 311 IELADFAVTR 320


>gi|239947339|ref|ZP_04699092.1| octaprenyl-diphosphate synthase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921615|gb|EER21639.1| octaprenyl-diphosphate synthase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 326

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 176/250 (70%), Gaps = 2/250 (0%)

Query: 9   LKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLA 68
           L ++ K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+GDNH+ LA
Sbjct: 11  LDEVTKLNDLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYKGDNHIKLA 70

Query: 69  CAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQE 128
            A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F ++I + S +
Sbjct: 71  SAVEFIHTATLLHDDVVDDSTLRRFKPTANIIWGSKTSILVGDFLFSQSFKLMIASGSIK 130

Query: 129 ALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQ 187
           A+  L+  +  ++EGE+ QL  L++   +T E+Y  ++KSKTA LF A+ EV ++IA   
Sbjct: 131 AMNVLAKASAIISEGEVVQLVKLNERRIITIEEYQQIVKSKTAELFGASCEVGAIIAEQL 190

Query: 188 NSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTK 247
           + V + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I  + +  +
Sbjct: 191 DHVSKDMQDFGKLLGTIFQVIDDLLDYWGNDKQVGKNIGDDFLEGKVTLPLIFLYNK-LE 249

Query: 248 REKNFWKSTI 257
           ++   W   I
Sbjct: 250 QDTQLWLENI 259


>gi|183600352|ref|ZP_02961845.1| hypothetical protein PROSTU_03915 [Providencia stuartii ATCC 25827]
 gi|188020143|gb|EDU58183.1| hypothetical protein PROSTU_03915 [Providencia stuartii ATCC 25827]
          Length = 323

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 188/315 (59%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN  IL ++ SDV +I  +  Y++  GGKR+RPM+ +     L Y G  H+
Sbjct: 8   ELTSEDMSAVNEAILSQLNSDVALINQLGYYIVSGGGKRIRPMIAVLAGRSLGYSGQKHI 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A  V+GN  SVLVGDF+ +++F M+ +  
Sbjct: 68  QVAALIEFIHTATLLHDDVVDESDMRRGKQTANAVFGNAASVLVGDFIYTRSFQMMTDLD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ +S     +AEGE+ QL    + ++TEE+Y+ VI SKTA LF AA   S+++A 
Sbjct: 128 SMRVLKLMSEATNVIAEGEVLQLMNCNDPNITEENYMQVIYSKTARLFEAAAHASAILAS 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                 +AL+ YG  LG AFQL+DD+LDY  +  ++GKN G+D   GKPTLP++ A   G
Sbjct: 188 ATPEQEKALQDYGRYLGTAFQLIDDLLDYDADNKQLGKNTGDDLDEGKPTLPLLHAMNHG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
           T+ E    +  I  G      L      M+   +L  T  RA    QKA D+L  L DS 
Sbjct: 248 TEEEAALIRQAIEQGN-GRHLLDTVLATMKRCGSLEYTYARAKEESQKAIDALSTLDDSV 306

Query: 306 WKKSLMEVVDFCLQR 320
           +K +L+ + +  + R
Sbjct: 307 YKDALISLAEVAISR 321


>gi|241068508|ref|XP_002408454.1| geranylgeranyl pyrophosphate synthase/polyprenyl synthetase,
           putative [Ixodes scapularis]
 gi|215492442|gb|EEC02083.1| geranylgeranyl pyrophosphate synthase/polyprenyl synthetase,
           putative [Ixodes scapularis]
          Length = 345

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 123/264 (46%), Positives = 180/264 (68%), Gaps = 8/264 (3%)

Query: 1   MKMLEDLTLKDMEK------VNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATA 54
           +K LE +T  D  K      +N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA
Sbjct: 65  IKHLEKVTTADQAKYKELIILNDLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITA 124

Query: 55  LMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLL 114
            M +Y+GDNH+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL 
Sbjct: 125 KMFDYKGDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANIIWGSKTSILVGDFLF 184

Query: 115 SQAFCMVIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLF 173
           SQ+F ++I + S +A+  L+  +  ++EGE+ QL  L++   +T E+Y  ++KSKTA LF
Sbjct: 185 SQSFKLMIASGSIKAMNVLAKASAIISEGEVVQLVKLNERRIITIEEYQQIVKSKTAELF 244

Query: 174 SAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGK 233
            A+ EV ++IA   + V + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK
Sbjct: 245 GASCEVGAIIAEQLDHVSKDMQDFGKLLGTIFQVIDDLLDYWGNDKQVGKNIGDDFLEGK 304

Query: 234 PTLPVILAFQRGTKREKNFWKSTI 257
            TLP+I  + +  +++   W   I
Sbjct: 305 VTLPLIFLYNK-LEQDTQLWLENI 327


>gi|261854792|ref|YP_003262075.1| trans-hexaprenyltranstransferase [Halothiobacillus neapolitanus c2]
 gi|261835261|gb|ACX95028.1| Trans-hexaprenyltranstransferase [Halothiobacillus neapolitanus c2]
          Length = 325

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 185/305 (60%), Gaps = 2/305 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           + +L   DM +VN +I  ++ SDV +I  + +Y+I +GGKR RPM+ +  A  L      
Sbjct: 9   IRELAAPDMARVNTVIQAKLASDVALINQLSQYIIGAGGKRFRPMVLMLAAQALGGTSPW 68

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
              +A  +E IHTATLLHDDVVD+S LRRG+  A  ++GN  SVL GDFL S+AF M++E
Sbjct: 69  AAQMAAVVELIHTATLLHDDVVDESTLRRGRDTANALFGNAASVLTGDFLYSRAFEMMVE 128

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            +    +  L+     +AEGE+ QL    + DV+E+ Y+ VI  KTA LF+AA ++++++
Sbjct: 129 VQEPRVMAILAQATNRIAEGEVLQLMNMGDADVSEDRYVDVIVRKTATLFAAATQLAAVL 188

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
            G    V  AL +YG++LG AFQL+DDVLDY G+    GK++G+D   GKPTLP+I+A Q
Sbjct: 189 EGQPEEVEAALTAYGLHLGTAFQLIDDVLDYTGDEAHTGKHVGDDLAEGKPTLPLIIAMQ 248

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           RG +      +  I +      +++     +    AL  T +RA +   +AK ++  +PD
Sbjct: 249 RGDEATVAMIRRAITEQ--DARDIEAICSAIEHTGALAYTAHRAQAEADRAKQAIAAVPD 306

Query: 304 SSWKK 308
           S +K+
Sbjct: 307 SPFKE 311


>gi|73666686|ref|YP_302702.1| trans-hexaprenyltrans transferase [Ehrlichia canis str. Jake]
 gi|72393827|gb|AAZ68104.1| Trans-hexaprenyltrans transferase [Ehrlichia canis str. Jake]
          Length = 325

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 199/318 (62%), Gaps = 7/318 (2%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L+ L  +D++ +  LI +     + +I +++ +LI SGGKR+RP++      ML    +N
Sbjct: 12  LKSLIQQDLDAMEILISQHSDKHIALITEIIHHLIKSGGKRIRPIIFFIICKMLNCTNEN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +L+A AIEFIH ATLLHDDV+D+S LRRGK  +  +WGN+ S+LVGDFLL+ +F  +IE
Sbjct: 72  KILIAAAIEFIHNATLLHDDVIDESDLRRGKKTSNFIWGNKASILVGDFLLAISFQWLIE 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            K+   L  LS  + T+  GE++Q+  S N+++++E Y+ +I +KTA LF A  E ++ +
Sbjct: 132 CKNLNILSILSQTSNTIVVGEIQQMLSSHNINISKEKYIEIISAKTASLFGATCESAAHL 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A V     +ALKS+G N GIAFQ++DD+LDY     + GK +G D   GK TLPVI+A+Q
Sbjct: 192 AQVNLQESKALKSFGNNFGIAFQIMDDILDYTASNAQFGKKLGNDLSTGKTTLPVIIAYQ 251

Query: 244 RGTKREKNFWKSTINDGKISV-ENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
             T  EK FW       +ISV +NL++A   ++ + A+  +   A +Y  +AK  L    
Sbjct: 252 NATPEEKKFWD------QISVNQNLEQAISYIKSHNAIEKSLEIATAYIDQAKACLTIFS 305

Query: 303 DSSWKKSLMEVVDFCLQR 320
           +S++K  L +++D  L R
Sbjct: 306 ESNYKMCLNKLLDCILYR 323


>gi|84622979|ref|YP_450351.1| octaprenyl-diphosphate synthase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|122879101|ref|YP_200077.6| octaprenyl-diphosphate synthase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188577962|ref|YP_001914891.1| polyprenyl synthetase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84366919|dbj|BAE68077.1| octaprenyl-diphosphate synthase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188522414|gb|ACD60359.1| polyprenyl synthetase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 332

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 179/322 (55%), Gaps = 2/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  ++ L   DM  V+ +I +R+ SDV +I  +  ++I +GGKRLRPML +         
Sbjct: 13  LPQIQSLAAPDMAAVDAVIRRRLASDVMLINQIADHIISAGGKRLRPMLVILAGHAAGGS 72

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H  LA  IEFIHT+TLLHDDVVD+S LRRG+  A  +WGN  SVLVGDFL S++F +
Sbjct: 73  GPEHHQLAAIIEFIHTSTLLHDDVVDESDLRRGRSTANALWGNAPSVLVGDFLYSRSFQL 132

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E    E ++ L+     +AEGE+ QL    N D  E  YL VI+ KTAVLF+A   + 
Sbjct: 133 MVELDRMEVMQILADTTNRIAEGEVLQLLHVHNPDTDEAAYLRVIERKTAVLFAAGTRLG 192

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +L +G    V+Q L  YGM LG AFQ+ DDVLDY  E  E+GKN+G+D   GK TLP+I 
Sbjct: 193 ALASGADAQVQQQLYDYGMQLGFAFQIADDVLDYAAEAAELGKNLGDDLAEGKATLPLIH 252

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A        +   +  +  G  +   +      +     L  +  RA  Y   A+ +L  
Sbjct: 253 AMAHSDATTRERLRQIVEQGDAAA--MPDVLAAIHATGGLDYSRQRAGEYAAAAEQALDT 310

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S    +L  +  + ++R +
Sbjct: 311 LPYSPAVAALRGLARYAVERTH 332


>gi|304321515|ref|YP_003855158.1| polyprenyl synthetase family protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300417|gb|ADM10016.1| polyprenyl synthetase family protein [Parvularcula bermudensis
           HTCC2503]
          Length = 317

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 137/300 (45%), Positives = 191/300 (63%), Gaps = 1/300 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           +E  N +IL  + S V +IP+V ++LI +GGKRLRP++TLA A +    G+   LLA A+
Sbjct: 6   LESTNQVILDHLASSVPLIPEVARHLIAAGGKRLRPLMTLAAAELCGETGEGPRLLAGAV 65

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E IH ATLLHDDVVD+SALRRG   A +V+GN+ SVLVGDFL ++AF +++ T S E L 
Sbjct: 66  ELIHAATLLHDDVVDESALRRGLRTANIVFGNKESVLVGDFLFARAFELMVRTGSIEVLG 125

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS  +C +AEGE+ QL+ S+NL+  +  YL VI +KTA LF+AA E  +++AG      
Sbjct: 126 ILSKASCIIAEGEVLQLTTSQNLETPQTIYLDVISAKTAALFAAAAEAGAVVAGGDAEKV 185

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTK-REK 250
            A+++YG+N GIA+QLVDD LDY+     +GK  G+DFR GK TLPVI A+   T   E+
Sbjct: 186 AAMRAYGLNFGIAYQLVDDALDYQSSGAVLGKTAGDDFREGKMTLPVIRAYAASTSDEER 245

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
            FW+ TI D     ++  +A  +MR +R +      A  Y + A  SL   P    + +L
Sbjct: 246 QFWQRTIRDKDQRPDDFARANELMRRDRIVEACLQEARGYAEAAASSLAVFPVGDLRGTL 305


>gi|166711277|ref|ZP_02242484.1| octaprenyl-diphosphate synthase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 332

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 179/322 (55%), Gaps = 2/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  ++ L   DM  V+ LI +R+ SDV +I  +  ++I +GGKRLRPML +         
Sbjct: 13  LPQIQSLAAPDMAAVDALIRRRLASDVVLINQIADHIISAGGKRLRPMLVMLAGHAAGGS 72

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H  LA  IEFIHT+TLLHDDVVD+S LRRG+  A  +WGN  SVLVGDFL S++F +
Sbjct: 73  GPEHHQLAAIIEFIHTSTLLHDDVVDESDLRRGRSTANALWGNAPSVLVGDFLYSRSFQL 132

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E    E ++ L+     +AEGE+ QL    N D  E  YL VI+ KTAVLF+A   + 
Sbjct: 133 MVELDRMEVMQILADTTNRIAEGEVLQLLHVHNPDTDEAAYLRVIERKTAVLFAAGTRLG 192

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +L +G    V+Q L  YGM LG AFQ+ DDVLDY  E  E+GK++G+D   GK TLP+I 
Sbjct: 193 ALASGADAQVQQQLYDYGMQLGFAFQIADDVLDYAAEAAELGKSLGDDLAEGKATLPLIH 252

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A        +   +  +  G  +   +      +     L  +  RA  Y   A+ +L  
Sbjct: 253 AMAHSDATTRERLRQIVEQGDAAA--MPDVLAAIHATGGLDYSRQRAGEYAAAAEQALET 310

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S    +L  +  + ++R +
Sbjct: 311 LPYSPAVAALRGLARYAVERTH 332


>gi|34581601|ref|ZP_00143081.1| octaprenyl-diphosphate synthase [Rickettsia sibirica 246]
 gi|28262986|gb|EAA26490.1| octaprenyl-diphosphate synthase [Rickettsia sibirica 246]
          Length = 327

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 180/258 (69%), Gaps = 3/258 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+
Sbjct: 5   VKIQQDLK-DEVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 64  GDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF  A  V
Sbjct: 124 MVASGSIKAMNVLAKASAIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFGTACAV 183

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IAG  + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 184 GAIIAGQVDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPLI 243

Query: 240 LAFQRGTKREKNFWKSTI 257
             + +   ++K  W   I
Sbjct: 244 FLYNK-LAQDKQLWLENI 260


>gi|293390542|ref|ZP_06634876.1| heptaprenyl diphosphate synthase component II [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951076|gb|EFE01195.1| heptaprenyl diphosphate synthase component II [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 329

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ L+ +DM+K+N  IL ++ SDV +I  +  Y++  GGKR+RP++ +  A  L + 
Sbjct: 9   VKAIQALSHEDMQKINESILAQLNSDVALINQLGFYIVQGGGKRIRPLIAVLAARALGFD 68

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G   +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 69  GQQAITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQL 128

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           V + +S + L  ++     LAEGE++QL    +   +EE+Y+ VI SKTA LF  A + +
Sbjct: 129 VAQLESLKILRIMADATNVLAEGEVQQLMNVNDPQTSEENYMRVIYSKTARLFEVAAQAA 188

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IAG  ++  +AL++YG  LG AFQLVDDVLDY    N +GKN+G+D   GKPTLP++ 
Sbjct: 189 AIIAGADDTQEKALQNYGRYLGTAFQLVDDVLDYSANANALGKNVGDDLAEGKPTLPLLH 248

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G  ++    +  I  G    + +     IM E+ +L     RA    QKA D+++C
Sbjct: 249 AMHHGNAQQAALIRKAIEQGG-RRDAIDDVLAIMAEHNSLDYAMNRAKQEAQKAVDAIQC 307

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K +L+ +    + R
Sbjct: 308 LPESEYKLALISLAYLSVDR 327


>gi|268592839|ref|ZP_06127060.1| octaprenyl-diphosphate synthase [Providencia rettgeri DSM 1131]
 gi|291311626|gb|EFE52079.1| octaprenyl-diphosphate synthase [Providencia rettgeri DSM 1131]
          Length = 323

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 187/315 (59%), Gaps = 1/315 (0%)

Query: 6   DLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHV 65
           +LT +DM  VN  IL ++ SDV +I  +  Y++  GGKR+RPM+ +     L Y G  H 
Sbjct: 8   ELTTEDMSAVNEAILSQLNSDVALINQLGYYIVSGGGKRIRPMIAVLAGRSLGYSGHKHT 67

Query: 66  LLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK 125
            +A  IEFIHTATLLHDDVVD+S +RRGK  A  V+GN  SVLVGDF+ +++F M+ +  
Sbjct: 68  QVAALIEFIHTATLLHDDVVDESDMRRGKQTANAVFGNAASVLVGDFIYTRSFQMMTDLD 127

Query: 126 SQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAG 185
           S   L+ +S     +AEGE+ QL    + ++TEE+Y+ VI SKTA LF AA   S+++A 
Sbjct: 128 SMRVLKLMSEATNVIAEGEVLQLMNCNDPNITEENYMQVIYSKTARLFEAAAHASAILAN 187

Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245
                 +AL+ YG  +G AFQL+DD+LDY  +  ++GKN G+D   GKPTLP++ A Q G
Sbjct: 188 ATPEQEKALQDYGRYIGTAFQLIDDLLDYDADNAQLGKNTGDDLDEGKPTLPLLHAMQNG 247

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
            + E    +  I  G      L      M+   +L  T  RA    QKA D+L  + DS 
Sbjct: 248 NEEESALIRQAIEQGN-GRHLLDTVLATMKRCGSLEYTYARAQEEAQKAIDALNIIEDSI 306

Query: 306 WKKSLMEVVDFCLQR 320
           +K +L+ +    +QR
Sbjct: 307 YKDALIGLAYIAIQR 321


>gi|152998234|ref|YP_001343069.1| polyprenyl synthetase [Marinomonas sp. MWYL1]
 gi|150839158|gb|ABR73134.1| Polyprenyl synthetase [Marinomonas sp. MWYL1]
          Length = 326

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 128/323 (39%), Positives = 195/323 (60%), Gaps = 6/323 (1%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTL----ATALMLEY 59
           + D+   +  +VN  I+ ++ SD+ +I  +  Y+I +GGKRLRP+L L    A+A + + 
Sbjct: 6   IHDVVANEFGQVNDYIVSQLSSDIPLIEQIGYYIISNGGKRLRPLLVLLAAKASAELDKP 65

Query: 60  RGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFC 119
           + D  + +A  IEFIHT+TLLHDDVVD+S +RRGK  A   WGN  SVLVGDFL S+AF 
Sbjct: 66  KLDQAIQMATIIEFIHTSTLLHDDVVDESDMRRGKKTANEEWGNAPSVLVGDFLYSRAFQ 125

Query: 120 MVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++++  S + +  L+     +AEGE++QL    + D TEE YL VI+ KTA LF  A   
Sbjct: 126 IMVDVGSMQCMSVLAKTTNIIAEGEVQQLINCGDPDTTEESYLKVIQYKTAKLFEGAALC 185

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IAG     ++AL+ +GM +G AFQL+DDV+DY     EMGK++G+D   GKPTLP+I
Sbjct: 186 GAVIAGASKEHQEALRQFGMYVGTAFQLIDDVMDYTSTAEEMGKSVGDDLAEGKPTLPLI 245

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
              + G K      +  I  G   ++ LK     ++   A+  T+ +A      A +S+ 
Sbjct: 246 FTMKHGPKDAVERVRQAILTG--GLDQLKSIINDVQNCGAIEYTQQKAQEQADLAIESIA 303

Query: 300 CLPDSSWKKSLMEVVDFCLQRLN 322
            LP+S +KK+L+ + +  ++R N
Sbjct: 304 PLPESDYKKALVALANASVKRRN 326


>gi|298369461|ref|ZP_06980778.1| octaprenyl-diphosphate synthase [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282018|gb|EFI23506.1| octaprenyl-diphosphate synthase [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 324

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 203/332 (61%), Gaps = 20/332 (6%)

Query: 3   MLEDLTL------KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALM 56
           MLE+L        +D++KVN +I + + SDV +I  +  Y+I +GGKRLRP++T+     
Sbjct: 1   MLENLPYFKQHLHEDLDKVNVVINQAVKSDVALISQIGTYIISAGGKRLRPIITILAGKA 60

Query: 57  LEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116
           + Y  +    LA  +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++
Sbjct: 61  VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRETANNLFGNAAAVLVGDFLYTR 120

Query: 117 AFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAA 176
           AF +++ + S + LE ++     +AEGE+ QL    N D+TE+ Y+ VI+ KTA LF AA
Sbjct: 121 AFQLMVASGSMKILEVMADATNIIAEGEVMQLMNIGNTDITEKQYIQVIQYKTAKLFEAA 180

Query: 177 LEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTL 236
            +V +++ G   +  QALK YGM +G AFQ++DDVLDY GE  E+GKN+G+D   GKPTL
Sbjct: 181 AQVGAILGGANPAQEQALKDYGMYVGTAFQIIDDVLDYSGETEEIGKNVGDDLAEGKPTL 240

Query: 237 PVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYG----- 291
           P+I     G+++          D ++++EN  +++   + +  +V++    Y+       
Sbjct: 241 PLIYLMHNGSEQ-------AAKDVRLALENADRSY-FEKIHDYVVNSNALPYAINEARKA 292

Query: 292 -QKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322
            +KA   L  LPD+    ++ ++ +  L R++
Sbjct: 293 VEKAVACLDILPDNEITLAMRQLAEESLARVS 324


>gi|207744381|ref|YP_002260773.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate synthase)
           protein [Ralstonia solanacearum IPO1609]
 gi|206595786|emb|CAQ62713.1| octaprenyl-diphosphate synthase (octaprenyl pyrophosphate synthase)
           protein [Ralstonia solanacearum IPO1609]
          Length = 338

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 173/271 (63%), Gaps = 2/271 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +DM  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L  A  L YRG++H  LA 
Sbjct: 42  EDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANALGYRGNHHYELAA 101

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTA LLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M+++  S   
Sbjct: 102 VVEFIHTAALLHDDVVDESELRRGRQTANAVFGNAASVLVGDFLYSRAFQMMVQADSMRV 161

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           ++ L+     ++EGE+ QL    + DVTEE YL VI+ KTA LF AA ++ ++++G   +
Sbjct: 162 MQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAKLFEAAAQIGAVLSGADAA 221

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              A   YG  +G AFQ+VDD+LDY    ++MGKN G+D R GKPTLP+I     GT+ +
Sbjct: 222 TEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLREGKPTLPLIHLLSHGTEEQ 281

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRAL 280
           +   +  I  G    E+    F  ++ + AL
Sbjct: 282 RALARQAIEQG--GTEHFDAIFDAIQASGAL 310


>gi|222834545|gb|EEE73022.1| predicted protein [Populus trichocarpa]
          Length = 309

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 189/309 (61%), Gaps = 2/309 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M  V+ +I +R+ S+V +I  + +Y+I +GGKRLRP++ L +A   +Y G  H  LA  +
Sbjct: 1   MRAVDAVIRRRLSSEVPLIEQIGEYIIGAGGKRLRPVILLLSARAFDYEGHRHHELAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           EFIHTATLLHDDVVD+S LRRG+  A  V+GN  SVLVGDFL S+AF M++E  S   +E
Sbjct: 61  EFIHTATLLHDDVVDESELRRGRDTANAVFGNAASVLVGDFLYSRAFQMMVEAGSMRIME 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE+ QL    + +VT E YL VI+ KTA LF A+ ++ +++AG    + 
Sbjct: 121 ILSNATNVIAEGEVLQLLNMHDPEVTVERYLQVIRYKTAKLFEASAQLGAVLAGADAEME 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +A   YG  +G AFQL+DD+LDY     +MGKN G+D R GKPTLP++   + GT +++ 
Sbjct: 181 EAAAEYGRRIGTAFQLIDDMLDYTASAEQMGKNAGDDLREGKPTLPLLHLLEHGTAQQRE 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLM 311
             +  I  G    E+    F  +  + AL  T   A    + A+ +    PDS  K++L+
Sbjct: 241 LARDAIVQG--GTEHFDAVFSAIHASGALDVTFAAAQREAEAAEKAAMQFPDSPLKQTLI 298

Query: 312 EVVDFCLQR 320
           ++  F LQR
Sbjct: 299 DLCAFSLQR 307


>gi|269958400|ref|YP_003328187.1| octaprenyl-diphosphate synthase [Anaplasma centrale str. Israel]
 gi|269848229|gb|ACZ48873.1| octaprenyl-diphosphate synthase [Anaplasma centrale str. Israel]
          Length = 327

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 189/317 (59%), Gaps = 3/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L++L  +D+E++  LI+    SD+  I D++ +L+ SGGKR+RP++ LA   ML  + + 
Sbjct: 12  LKNLVSEDLEEMERLIVTTSNSDISYITDIINHLMLSGGKRIRPIMLLAVCKMLALQDER 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            +L+A AIEFIH+ATLLHDDVVD S  RRG   +  +WGN+ SVLVGDFLL+ AF  ++ 
Sbjct: 72  RILIAAAIEFIHSATLLHDDVVDQSESRRGTKTSNSLWGNKASVLVGDFLLATAFQWLVS 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             + E L  LS  +CT+  GE++Q+  SK+LD+T E YL +I +KTA LFSA  E + ++
Sbjct: 132 CSNFELLTTLSRASCTIVTGEIQQMVYSKSLDITREKYLEIISAKTAALFSATCESAGVL 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           +      R+ALK++G N GI FQ+VDD+LDY  +  + GK  G+D  NG+ TLP+I+A++
Sbjct: 192 SESSFDDRKALKNFGHNFGITFQIVDDLLDYTAQHEKWGKTPGQDLSNGQVTLPMIMAYE 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
                 K   +  +      V ++     I   N A     + A  Y   +   L   PD
Sbjct: 252 EADYAGKEMLRGALAGRPSDVASVHS--YISSLNVAQKAIAFAA-EYVDASHKFLEPFPD 308

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K  L  ++   LQR
Sbjct: 309 SQYKSKLSALLRSALQR 325


>gi|315634742|ref|ZP_07890026.1| octaprenyl-diphosphate synthase [Aggregatibacter segnis ATCC 33393]
 gi|315476690|gb|EFU67438.1| octaprenyl-diphosphate synthase [Aggregatibacter segnis ATCC 33393]
          Length = 329

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M  ++ L+  DM+KVN  IL ++ SDV +I  +  Y++  GGKR+RP++T+  A  L + 
Sbjct: 9   MNAIQALSQADMQKVNESILAQLNSDVVLINQLGFYIVQGGGKRIRPLITVLAARALGFE 68

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G   +  A  +EFIHTA+LLHDDVVD+S +RRG+  A   +GN  SVLVGDF+ ++AF +
Sbjct: 69  GQKAITCATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDFIYTRAFQL 128

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           V + +S + L  ++     LAEGE++QL    +   +EE+Y+ VI SKTA LF  A + +
Sbjct: 129 VAQLESLKILRIMADATNVLAEGEVQQLMNVNDPQTSEENYMRVIYSKTARLFEVAAQAA 188

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           ++IA   +   +AL++YG  LG AFQLVDDVLDY      +GKN+G+D   GKPTLP++ 
Sbjct: 189 AIIADADDEQEKALQNYGRYLGTAFQLVDDVLDYSANAKALGKNVGDDLAEGKPTLPLLH 248

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A   G +++    +  I  G    E + +   IM E+++L     RA    QKA D+++ 
Sbjct: 249 AMHHGNEQQAALIREAIEQGG-KREAIDEVLAIMAEHKSLDYAMDRAKQEAQKAVDAIQI 307

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S +K++L+ +    + R
Sbjct: 308 LPESEYKQALISLAYLSVDR 327


>gi|253702068|ref|YP_003023257.1| trans-hexaprenyltranstransferase [Geobacter sp. M21]
 gi|251776918|gb|ACT19499.1| Trans-hexaprenyltranstransferase [Geobacter sp. M21]
          Length = 322

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 189/312 (60%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D++ V     K + SDV +I  V +Y++ SGGKR+RP L L  + +  Y G+  V LA 
Sbjct: 10  EDLKNVELQFKKDLQSDVPLIRKVGEYVLSSGGKRIRPALVLLASRLCGYDGNRSVPLAS 69

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD++ LRRG  +A  +WGN+ SVLVGDFL S++F +++       
Sbjct: 70  VVEFIHTATLLHDDVVDNANLRRGLASANTLWGNEASVLVGDFLFSKSFSLMVTDGDLRI 129

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ L+     +AEGE+ QL  + +LD+T E Y+ V++SKTA+L SAA EV +++      
Sbjct: 130 LKVLADATTIIAEGEVLQLVCTCDLDITVERYIEVVRSKTAILLSAACEVGAILGEADPE 189

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
            RQAL  YGM+LGIAFQL+DD LDY     + GK+IG D   GK TLP+I   +  T++E
Sbjct: 190 HRQALADYGMDLGIAFQLMDDTLDYTASEEQFGKSIGHDLEEGKITLPLIHTLRNCTEQE 249

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           ++   S +    +S E+  +   +++    +  T   A  +    K  L   P S+ +++
Sbjct: 250 RDLIASVVEKELLSDEDFAQVLELVQRYGGIEHTVASAAEHVVLCKRHLEKFPPSATREA 309

Query: 310 LMEVVDFCLQRL 321
           L E+ ++ + R+
Sbjct: 310 LAELAEYVVTRV 321


>gi|58425655|gb|AAW74692.1| octaprenyl-diphosphate synthase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 408

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 179/322 (55%), Gaps = 2/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  ++ L   DM  V+ +I +R+ SDV +I  +  ++I +GGKRLRPML +         
Sbjct: 89  LPQIQSLAAPDMAAVDAVIRRRLASDVMLINQIADHIISAGGKRLRPMLVILAGHAAGGS 148

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  H  LA  IEFIHT+TLLHDDVVD+S LRRG+  A  +WGN  SVLVGDFL S++F +
Sbjct: 149 GPEHHQLAAIIEFIHTSTLLHDDVVDESDLRRGRSTANALWGNAPSVLVGDFLYSRSFQL 208

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E    E ++ L+     +AEGE+ QL    N D  E  YL VI+ KTAVLF+A   + 
Sbjct: 209 MVELDRMEVMQILADTTNRIAEGEVLQLLHVHNPDTDEAAYLRVIERKTAVLFAAGTRLG 268

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +L +G    V+Q L  YGM LG AFQ+ DDVLDY  E  E+GKN+G+D   GK TLP+I 
Sbjct: 269 ALASGADAQVQQQLYDYGMQLGFAFQIADDVLDYAAEAAELGKNLGDDLAEGKATLPLIH 328

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A        +   +  +  G  +   +      +     L  +  RA  Y   A+ +L  
Sbjct: 329 AMAHSDATTRERLRQIVEQGDAAA--MPDVLAAIHATGGLDYSRQRAGEYAAAAEQALDT 386

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP S    +L  +  + ++R +
Sbjct: 387 LPYSPAVAALRGLARYAVERTH 408


>gi|254284097|ref|ZP_04959065.1| octaprenyl-diphosphate synthase [gamma proteobacterium NOR51-B]
 gi|219680300|gb|EED36649.1| octaprenyl-diphosphate synthase [gamma proteobacterium NOR51-B]
          Length = 321

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 196/311 (63%), Gaps = 2/311 (0%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
            ++E+V+ LI++++ SDV+M+ +V +Y++ +GGKRLRP+L L     L    ++H+  + 
Sbjct: 11  SEVEQVDQLIIEQLHSDVDMVENVGQYIVDAGGKRLRPLLVLLAGEALGGCTESHIRFSA 70

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            +EFIHTATLLHDDVVD S LRRG+  A   +GN  SVLVGDFL ++AF ++++  + + 
Sbjct: 71  VVEFIHTATLLHDDVVDVSTLRRGRPTANEAFGNAPSVLVGDFLYTRAFQLMVQLDNMDL 130

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L  ++    T+AEGE+ QL+ + N D+ E  Y+ VI  KTA+LF++A + ++++A     
Sbjct: 131 LRHMADTTNTIAEGEVLQLARAGNPDIDESQYIDVITRKTAILFASACQGAAMLANCDIK 190

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
            +QAL  YG+NLGIAFQ++DDVLDY G+    GKNIG+D   GK TLP++   Q G+K +
Sbjct: 191 TQQALSQYGLNLGIAFQMIDDVLDYEGDPTVTGKNIGDDLNEGKTTLPLLHTMQTGSKPD 250

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           ++    ++ +   S  +L +    +R + +L  T  RA      A   L  L ++  K +
Sbjct: 251 RDLVAQSLREK--STASLSEVIAAVRRSGSLDFTRERARERHDLAMSGLDVLQENRAKAA 308

Query: 310 LMEVVDFCLQR 320
           L +++   L+R
Sbjct: 309 LSDLLHLSLER 319


>gi|91205532|ref|YP_537887.1| octaprenyl-diphosphate synthase [Rickettsia bellii RML369-C]
 gi|91069076|gb|ABE04798.1| Octaprenyl-diphosphate synthase [Rickettsia bellii RML369-C]
          Length = 334

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 204/322 (63%), Gaps = 3/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ ++N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y 
Sbjct: 12  VKIQQDLK-DEVAQLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYN 70

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 71  GDSHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 130

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  ++EGE+ QL  L++   +  E+Y  ++KSKTA LF A+  V
Sbjct: 131 MVASGSIKAMNVLAKASAIISEGEVVQLVKLNERRLINIEEYQQIVKSKTAELFGASCSV 190

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 191 GAIIANQSDDISKNMEEFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPLI 250

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
             + +  K +K   K+ I     + E   +   +M +++   D      S   +A   L 
Sbjct: 251 FLYDKLEKDDKAHLKNMIKSDNRTKEEFVQICDLMVKHKISKDIINHLNSLENEAISLLN 310

Query: 300 CLP-DSSWKKSLMEVVDFCLQR 320
            +P  + +K+ L  ++ F L R
Sbjct: 311 KIPVQNIYKEYLFSIIRFILDR 332


>gi|222054630|ref|YP_002536992.1| Polyprenyl synthetase [Geobacter sp. FRC-32]
 gi|221563919|gb|ACM19891.1| Polyprenyl synthetase [Geobacter sp. FRC-32]
          Length = 322

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 189/312 (60%)

Query: 10  KDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLAC 69
           +D+  V     K + SDV +I  V +Y++ SGGKR+RP L L +A +  Y G+ +V LA 
Sbjct: 10  EDLTNVELQFKKDLHSDVPLIRKVGEYVLASGGKRIRPALLLLSAKLCGYTGNRNVALAS 69

Query: 70  AIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEA 129
            IEFIHTATLLHDDVVD++ LRRG  +A  +WGN+ SVLVGDFL S++F +++     + 
Sbjct: 70  VIEFIHTATLLHDDVVDNANLRRGIASANTLWGNEASVLVGDFLFSKSFSLMVADGDLKI 129

Query: 130 LEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNS 189
           L+ LS     +AEGE+ QL  + +LD+T E Y+ V+K+KTA+L SAA +  +++    + 
Sbjct: 130 LKVLSGATTIIAEGEVLQLICTSDLDLTLERYIEVVKAKTAILLSAACQSGAILGQASSQ 189

Query: 190 VRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKRE 249
              AL+ +GM+LGIAFQL+DD LDY     + GK+IG D   GK TLP+I   ++ T  E
Sbjct: 190 HETALQEFGMDLGIAFQLMDDTLDYVASEEQFGKSIGHDLEEGKITLPLIHTLRQCTAEE 249

Query: 250 KNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
           ++   + I    +  ++    F ++ +   +  T   A  Y  + K  L   P+S+ K +
Sbjct: 250 RSQIGTIIEKDILEDQDFSTVFDLVGKYDGIKHTIAVANEYVNRCKGHLNVFPESTEKAA 309

Query: 310 LMEVVDFCLQRL 321
           L ++ D+ L R+
Sbjct: 310 LFDLADYVLTRV 321


>gi|291612793|ref|YP_003522950.1| trans-hexaprenyltranstransferase [Sideroxydans lithotrophicus ES-1]
 gi|291582905|gb|ADE10563.1| Trans-hexaprenyltranstransferase [Sideroxydans lithotrophicus ES-1]
          Length = 320

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/320 (39%), Positives = 188/320 (58%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           M+ L+ L   DM  V+ +I  R+ S+V ++  V +Y+I SGGKRLRP L L +A    Y 
Sbjct: 1   MENLKRLLASDMAAVDAVIRARLHSEVALVNQVGEYIINSGGKRLRPALVLLSAQAFGYG 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G +H  LA  +EFIHTATLLHDDVVD+S LRRG+  A  ++GN  SVLVGDFL S++F M
Sbjct: 61  GKHHHDLAAVVEFIHTATLLHDDVVDESELRRGRETANALFGNAASVLVGDFLYSRSFQM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           +++      ++ L+     +AEGE+ QL    +  V   +Y+ VI  KTA LF AA+ + 
Sbjct: 121 MVDVGEMRVMQTLADATNVIAEGEVLQLLNCHDASVDIPNYMRVIHCKTAKLFEAAMRLG 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++     +  +A   YGM+LG AFQL+DDVLDY  +  + GK++G+D   GKPTLP+I 
Sbjct: 181 AILGKASTADEEAAAKYGMHLGTAFQLIDDVLDYSADEAQTGKHLGDDLAEGKPTLPLIY 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A Q GT  +    +  I  G +      +   ++R+  AL  T  +A    + A  ++  
Sbjct: 241 AMQHGTGAQAAVVRDAIEQGDVG--KFTEVLTVIRDTGALEFTRQQALRETETACAAIAA 298

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           + DS +K+ L+E+  F   R
Sbjct: 299 MADSKYKQCLLELAHFAATR 318


>gi|254230032|ref|ZP_04923431.1| polyprenyl synthetase superfamily [Vibrio sp. Ex25]
 gi|151937420|gb|EDN56279.1| polyprenyl synthetase superfamily [Vibrio sp. Ex25]
          Length = 287

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 176/285 (61%), Gaps = 1/285 (0%)

Query: 36  YLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKV 95
           Y++  GGKRLRP+L + +A  L Y+G+ H + A  IEFIHTATLLHDDVVD+S +RRGK 
Sbjct: 2   YIVSGGGKRLRPLLAILSARALGYQGNGHTMAAAFIEFIHTATLLHDDVVDESDMRRGKA 61

Query: 96  AARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLD 155
            A   +GN  SVLVGDF+ +++F M+ E  S + L+ +S     +AEGE++QL    + D
Sbjct: 62  TANAAFGNAASVLVGDFIYTRSFQMMTELGSMKILKLMSNAVNVIAEGEVQQLMNCNDPD 121

Query: 156 VTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYR 215
            TEE Y+ VI SKTA LF +A ++ +++      V  A+++YG  LG AFQL+DDV+DY 
Sbjct: 122 TTEESYMQVIYSKTARLFESATQIGAILNDAPEHVEIAMQNYGKYLGTAFQLIDDVMDYT 181

Query: 216 GEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMR 275
            +  +MGKN+G+D   GKPTLP++ A +  T       +  I      ++ L+    +M+
Sbjct: 182 SDGEDMGKNVGDDLAEGKPTLPLLHAMRNTTPDNALMIREAIEKAN-GMDRLEDILAVMK 240

Query: 276 ENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320
           E  +L  T  +A     KA + L  LP+S +K++L+ +    +QR
Sbjct: 241 EAGSLEYTTQKALEEADKAIEELSVLPESEYKQALITLAHVAVQR 285


>gi|157825829|ref|YP_001493549.1| octaprenyl-diphosphate synthase [Rickettsia akari str. Hartford]
 gi|157799787|gb|ABV75041.1| octaprenyl-diphosphate synthase [Rickettsia akari str. Hartford]
          Length = 327

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 181/258 (70%), Gaps = 3/258 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+
Sbjct: 5   VKIQQDLK-DEVTKLNDLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 64  GDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  ++ GE+ QL  L++   +T E+Y  ++KSKTA LF A+ EV
Sbjct: 124 MVASGSIKAMNVLAKASAIISVGEVIQLVKLNERRIITIEEYYQIVKSKTAELFGASCEV 183

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 184 GAIIAEQVDHISKDIRYFGTLLGTIFQVIDDLLDYLGNDQQVGKNIGDDFLEGKVTLPLI 243

Query: 240 LAFQRGTKREKNFWKSTI 257
             + +  +++K  W   I
Sbjct: 244 FLYNK-LEQDKRLWLENI 260


>gi|229586816|ref|YP_002845317.1| Octaprenyl-diphosphate synthase [Rickettsia africae ESF-5]
 gi|228021866|gb|ACP53574.1| Octaprenyl-diphosphate synthase [Rickettsia africae ESF-5]
          Length = 371

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 203/316 (64%), Gaps = 5/316 (1%)

Query: 9   LKD-MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLL 67
           LKD + K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+GDNH+ L
Sbjct: 55  LKDEVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYKGDNHIKL 114

Query: 68  ACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ 127
           A A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +++ + S 
Sbjct: 115 ASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKLMVASGSI 174

Query: 128 EALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
           +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF  A  V ++IA  
Sbjct: 175 KAMNVLAKASAIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFGTACAVGAIIAEQ 234

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I  + +  
Sbjct: 235 VDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPLIFLYNK-L 293

Query: 247 KREKNFW-KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP-DS 304
            ++K  W ++ I   K + ++  K   +M ++    +T     +    A   L  +P  +
Sbjct: 294 AQDKQLWLENIIKCDKRTKDDFVKIHDLMVKHEIYNETVNYLSNLENAASKLLNKIPVQN 353

Query: 305 SWKKSLMEVVDFCLQR 320
            +K  L  ++ F L+R
Sbjct: 354 IYKDYLFSIIKFILER 369


>gi|332140074|ref|YP_004425812.1| Geranylgeranyl pyrophosphate synthase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|332143128|ref|YP_004428866.1| Geranylgeranyl pyrophosphate synthase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550096|gb|AEA96814.1| Geranylgeranyl pyrophosphate synthase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327553150|gb|AEA99868.1| Geranylgeranyl pyrophosphate synthase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 324

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/315 (40%), Positives = 188/315 (59%), Gaps = 2/315 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L+  DM+ VN LI +++ S+V +I  +  Y++ SGGKRLRP+LT+ +A  +    + H  
Sbjct: 9   LSNDDMQAVNQLIQQQVDSEVALINQLGFYIVNSGGKRLRPLLTVLSARAMGIDNNEHHT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S +RRG+  A  ++GNQ SVLVGDFL +++F M++  K 
Sbjct: 69  LAAIVEFIHTATLLHDDVVDESTMRRGRETANAIFGNQASVLVGDFLYTRSFQMMVSLKR 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E LS     +AEGE+ QL    +   TE  Y  VI  KTA LF AA ++++++   
Sbjct: 129 MRVMEILSEATNQIAEGEVLQLMNCNDAGTTEARYFDVIYGKTARLFEAATQLAAVLTEQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
              + +A++ YG +LG AFQL DD+LDY  +  EMGKN G+D   GKPTLP++ A    T
Sbjct: 189 NEHIERAMQEYGKHLGTAFQLADDILDYMADSEEMGKNAGDDLAEGKPTLPLLYAMWHAT 248

Query: 247 K-REKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
              +K   +  I      + +L +   IM E  AL  T   A    Q A DSL  + DS 
Sbjct: 249 NDSDKALIQEAIEQSN-GLPHLTRIQGIMEETGALDYTRQCAQKEVQMAIDSLSAIEDSK 307

Query: 306 WKKSLMEVVDFCLQR 320
           +K++L+ +    ++R
Sbjct: 308 YKEALIALAHISIER 322


>gi|269468820|gb|EEZ80424.1| geranylgeranyl pyrophosphate synthase [uncultured SUP05 cluster
           bacterium]
          Length = 323

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/317 (41%), Positives = 195/317 (61%), Gaps = 2/317 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           ++ L   D++K + +++KR+ S+V +I  +  Y+I +GGKRLRP+L L  A    Y+G++
Sbjct: 7   IQKLLKSDLKKTDKVLIKRLSSNVALINQMSSYIINAGGKRLRPLLLLLCAKATGYQGNH 66

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
           H L+A  IE IHTATLLHDD+VD+SA RRGK  A  VWGN  SVLVGDFL S+AF M++E
Sbjct: 67  HHLMAVVIELIHTATLLHDDIVDESATRRGKDTANEVWGNAASVLVGDFLYSRAFEMMVE 126

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
             S   ++ LS    ++AEGE+ QL   +N +++E +Y +VI+ KTA LF A+ ++  ++
Sbjct: 127 PDSMRIMKILSKTTNSIAEGEVLQLLNCQNSELSEAEYFNVIERKTACLFQASTQIGGIL 186

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           +        AL++YG++LG AFQ++DD LDY  +   MGK +G+D   GK TLP+I A  
Sbjct: 187 SNADEKQELALRNYGLHLGNAFQIIDDALDYESDAQTMGKEVGDDLAEGKTTLPMICALS 246

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
           R   +E    K+ IN+   S   + K   I+    A   T  +A      AK SL  L +
Sbjct: 247 RTLGQEHELLKNAINNADNS--KIDKIIKILDSVNAFEYTHNKAQESADLAKKSLAILEE 304

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K +L+ + D  LQR
Sbjct: 305 SDYKNALVLLCDLSLQR 321


>gi|297537721|ref|YP_003673490.1| trans-hexaprenyltranstransferase [Methylotenera sp. 301]
 gi|297257068|gb|ADI28913.1| Trans-hexaprenyltranstransferase [Methylotenera sp. 301]
          Length = 332

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 182/310 (58%), Gaps = 2/310 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+  VN +I   + S+V ++  V  Y++ SGGKRLRP+L L +  +       H  LA  
Sbjct: 23  DILAVNTVITHSLHSEVTLVNQVAHYIVNSGGKRLRPILVLLSGGLFGEVKPEHHQLAAV 82

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHTATLLHDDVVD+S+ RRG+  A  ++GN  SVLVGDF+ S+AF M++  ++   +
Sbjct: 83  VEFIHTATLLHDDVVDESSKRRGQNTANAIFGNAASVLVGDFVYSRAFQMMVAVQNMRVM 142

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E LS     +AEGE+ QL    N DVT+  YL VI  KTA LF AA  + ++I+    S 
Sbjct: 143 EVLSNATNVIAEGEVLQLLNIHNADVTDGAYLQVIHYKTAKLFEAATRLGAIISNASPSD 202

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
            +AL  YGM++G AFQL+DDVLD  G  +E+GKN+G+D   GKPTLP++ A + GT  E 
Sbjct: 203 EEALSQYGMHIGTAFQLIDDVLDLSGNASEIGKNLGDDLSEGKPTLPLLYAMRNGTADEA 262

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              K  I  G +  E+L      +    AL      A    + A  ++    DS +K+++
Sbjct: 263 ETIKRAIEHGGL--EDLVTVLSAVERTGALDHVRKVAAKESELACAAIAHFADSPYKQAM 320

Query: 311 MEVVDFCLQR 320
           + + +F + R
Sbjct: 321 LTLAEFAVAR 330


>gi|157828600|ref|YP_001494842.1| octaprenyl-diphosphate synthase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933313|ref|YP_001650102.1| decaprenyl diphosphate synthase [Rickettsia rickettsii str. Iowa]
 gi|157801081|gb|ABV76334.1| octaprenyl-diphosphate synthase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908400|gb|ABY72696.1| farnesyl pyrophosphate synthetase [Rickettsia rickettsii str. Iowa]
          Length = 355

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 206/323 (63%), Gaps = 5/323 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+
Sbjct: 33  VKIQQDLK-DEVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 91

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 92  GDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 151

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF  A  V
Sbjct: 152 MVASGSIKAMHVLAKASAIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFGTACAV 211

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 212 GTIIAEQVDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPLI 271

Query: 240 LAFQRGTKREKNFW-KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
             + +   ++K  W ++ I   K + ++  K   +M ++    +T     +    A   L
Sbjct: 272 FLYNK-LAQDKQLWLENIIKCDKRTKDDFVKIHDLMVKHEIYNETVNYLSNLENAASKLL 330

Query: 299 RCLP-DSSWKKSLMEVVDFCLQR 320
             +P  + +K  L  ++ F L R
Sbjct: 331 NKIPVQNIYKDYLFSIIKFMLDR 353


>gi|90408282|ref|ZP_01216447.1| octaprenyl-diphosphate synthase [Psychromonas sp. CNPT3]
 gi|90310583|gb|EAS38703.1| octaprenyl-diphosphate synthase [Psychromonas sp. CNPT3]
          Length = 325

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 192/320 (60%), Gaps = 1/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K ++ ++  +M KVN LI K++ SDV +I  +  Y++ SGGKR+RP++T+  A  L   
Sbjct: 5   IKHIQQISNTEMAKVNALISKQLTSDVALIKQLGFYIVNSGGKRIRPLITILAAKALNVH 64

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
            +    LA  IEF+HTATLLHDDVVD+S LRRGK  A  ++GN  SVLVGDFL +++F M
Sbjct: 65  SEKITKLAAIIEFVHTATLLHDDVVDESDLRRGKKTANALFGNAASVLVGDFLYTRSFQM 124

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + E ++ + ++ LS     +AEGE+ QL    + +++E+ Y+ +I  KTA LF AA ++ 
Sbjct: 125 MSELQNLKVMDVLSRATNIIAEGEVLQLMNCNDANISEKLYMDIIYYKTAKLFEAATQLV 184

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            ++A     +  AL +YG  LG AFQL DDV+DY     EMGKN G+D   GKPTLP+I 
Sbjct: 185 GVLAEQTPEIELALLNYGKYLGTAFQLTDDVMDYTSNAQEMGKNSGDDLAEGKPTLPLIY 244

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT+++K   K  I      +++       +    AL   + RA     KA +++  
Sbjct: 245 AMKNGTEKQKALIKDAIEKAN-GMQHFDLIMETLASTNALEYAQARAQEEADKAIEAIAI 303

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP++ +K++L+ +      R
Sbjct: 304 LPNNQYKEALVSLAHLAANR 323


>gi|241763806|ref|ZP_04761852.1| Polyprenyl synthetase [Acidovorax delafieldii 2AN]
 gi|241366938|gb|EER61343.1| Polyprenyl synthetase [Acidovorax delafieldii 2AN]
          Length = 309

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 179/298 (60%), Gaps = 2/298 (0%)

Query: 12  MEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI 71
           M +V+ +I +R+ S V ++  + +Y+I +GGKRLRP L L     L YRG++   LA  +
Sbjct: 1   MGEVDHVIAQRLTSSVPLVAQISQYIIAAGGKRLRPALLLLICGALGYRGNHRFSLAAVV 60

Query: 72  EFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALE 131
           E IHTATLLHDDVVD S LRRG+  A   +GN  SVLVGDFL +++F M++E  +   +E
Sbjct: 61  ELIHTATLLHDDVVDASTLRRGRATANQTFGNPASVLVGDFLHTRSFQMMVEAGNMRIME 120

Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVR 191
            LS     +AEGE+ QL    +  + E  YL VI+SKTA LF A+  + +++A     + 
Sbjct: 121 VLSEATNVIAEGEVLQLMNMHDASLDEAGYLQVIRSKTAKLFEASARLGAILAESPPQIE 180

Query: 192 QALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKN 251
           +A  +YG  LG AFQ++DDVLDY G   EMGKN+G+D R GK TLP+I+A QRG   +  
Sbjct: 181 EACATYGQALGTAFQIIDDVLDYDGNTAEMGKNLGDDLREGKSTLPLIVAMQRGNAEQAA 240

Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKS 309
             +  I +G  S + L     I+R   AL      A++  ++A  +   LP S++  S
Sbjct: 241 IVRHAIEEG--STDRLDDVVAIVRNTGALEAARMAAFAEARRAMTAAEQLPASNYATS 296


>gi|157827248|ref|YP_001496312.1| octaprenyl-diphosphate synthase [Rickettsia bellii OSU 85-389]
 gi|157802552|gb|ABV79275.1| Octaprenyl-diphosphate synthase [Rickettsia bellii OSU 85-389]
          Length = 327

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 128/322 (39%), Positives = 204/322 (63%), Gaps = 3/322 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ ++N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y 
Sbjct: 5   VKIQQDLK-DEVAQLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYN 63

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD+H+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 64  GDSHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 123

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  +++GE+ QL  L++   +  E+Y  ++KSKTA LF A+  V
Sbjct: 124 MVASGSIKAMNVLAKASAIISKGEVVQLVKLNERRLINIEEYQQIVKSKTAELFGASCSV 183

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 184 GAIIANQSDDISKNMEEFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPLI 243

Query: 240 LAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLR 299
             + +  K +K   K+ I     + E   +   +M +++   D      S   +A   L 
Sbjct: 244 FLYDKLEKDDKAHLKNMIKSDNRTKEEFVQICDLMVKHKISKDIINHLNSLENEAISLLN 303

Query: 300 CLP-DSSWKKSLMEVVDFCLQR 320
            +P  + +K+ L  ++ F L R
Sbjct: 304 KIPVQNIYKEYLFSIIRFILDR 325


>gi|238650786|ref|YP_002916641.1| octaprenyl-diphosphate synthase [Rickettsia peacockii str. Rustic]
 gi|238624884|gb|ACR47590.1| octaprenyl-diphosphate synthase [Rickettsia peacockii str. Rustic]
          Length = 371

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 206/323 (63%), Gaps = 5/323 (1%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +K+ +DL   ++ K+N LI+  + SD E+I  V KYL+ +GGKR+RP+LT+ TA M +Y+
Sbjct: 49  VKIQQDLK-DEVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 107

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GDNH+ LA A+EFIHTATLLHDDVVDDS LRR K  A ++WG++TS+LVGDFL SQ+F +
Sbjct: 108 GDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLFSQSFKL 167

Query: 121 VIETKSQEALEALSLVACTLAEGELRQL-SLSKNLDVTEEDYLHVIKSKTAVLFSAALEV 179
           ++ + S +A+  L+  +  ++EGE+ QL  L++   +T ++Y  ++KSKTA LF  A  V
Sbjct: 168 MVASGSIKAMNVLAKASAIISEGEVVQLVKLNERRIITIDEYQQIVKSKTAELFGTACAV 227

Query: 180 SSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVI 239
            ++IA   + + + ++ +G  LG  FQ++DD+LDY G   ++GKNIG+DF  GK TLP+I
Sbjct: 228 GAIIAEQVDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLEGKVTLPMI 287

Query: 240 LAFQRGTKREKNFW-KSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSL 298
             + +   ++K  W ++ I   K + ++  K   +M ++    +T     +    A   L
Sbjct: 288 FLYNK-LAQDKQLWLENIIKCDKRTKDDFVKIHDLMVKHEIYNETVNYLSNLENAASKLL 346

Query: 299 RCLP-DSSWKKSLMEVVDFCLQR 320
             +P  + +K  L  ++ F L R
Sbjct: 347 NKIPVQNIYKDYLFSIIKFILDR 369


>gi|68171324|ref|ZP_00544722.1| Farnesyltranstransferase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657619|ref|YP_506918.1| octaprenyl-diphosphate synthase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67999251|gb|EAM85903.1| Farnesyltranstransferase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599076|gb|ABD44545.1| octaprenyl-diphosphate synthase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 325

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 201/318 (63%), Gaps = 7/318 (2%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L+ L  +D++ +  LIL +    + +I ++V++LI SGGKR+RP++      ML    +N
Sbjct: 12  LKSLVQQDLDSMESLILHQNNKHITLITEIVQHLIKSGGKRIRPIIFFIICKMLNCNNEN 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            V +A AIE IH ATLLHDDV+D+S LRRG+  + ++WGN+ S+LVGDFLL+ +F  +I+
Sbjct: 72  KVPIAAAIELIHNATLLHDDVIDESELRRGEKTSNVIWGNKASILVGDFLLAISFQWLIK 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            K+   L  LS  +  +  GE++Q+  S N+++++E Y+ +I +KTA LFSA  E ++ +
Sbjct: 132 CKNLNILSILSQASKDVIVGEVQQMISSHNINISKEKYIEIISAKTAALFSATCESAANL 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A   N  ++ALK++G N GI+FQ++DD+LDY     + GK +G D   GK TLPVI+A+Q
Sbjct: 192 AQTSNEEKEALKNFGNNFGISFQIMDDILDYTASGEQFGKKLGNDLLTGKTTLPVIIAYQ 251

Query: 244 RGTKREKNFWKSTINDGKISVE-NLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
             T +EK FW       +ISV  NL++A   ++ + A+  +   A +Y  +AK  L    
Sbjct: 252 NATSKEKKFW------DQISVNPNLEQAISYIKVHNAIEKSISIATTYINQAKSCLNIFA 305

Query: 303 DSSWKKSLMEVVDFCLQR 320
           +S++K  L +++D  L R
Sbjct: 306 ESNYKTHLNKLLDCILYR 323


>gi|57238790|ref|YP_179926.1| octaprenyl-diphosphate synthase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578715|ref|YP_196927.1| octaprenyl-diphosphate synthase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58616777|ref|YP_195976.1| octaprenyl-diphosphate synthase [Ehrlichia ruminantium str. Gardel]
 gi|57160869|emb|CAH57771.1| octaprenyl-diphosphate synthase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58416389|emb|CAI27502.1| Octaprenyl-diphosphate synthase [Ehrlichia ruminantium str. Gardel]
 gi|58417341|emb|CAI26545.1| Octaprenyl-diphosphate synthase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 325

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 197/317 (62%), Gaps = 5/317 (1%)

Query: 4   LEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDN 63
           L+ L  +D++++  LIL +   ++ +I +++++LI SGGKR+RP++      ML Y  ++
Sbjct: 12  LKSLIQQDLDEMEHLILYQDNKNITLITEIIQHLIKSGGKRIRPIIFFIICKMLNYNKND 71

Query: 64  HVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIE 123
            V +A AIEFIH ATLLHDDV+D+S LRRG+  +  +WGN+ S+LVGDFLL+ +F  +I+
Sbjct: 72  KVYIAAAIEFIHNATLLHDDVIDESELRRGEKTSNFLWGNKASILVGDFLLAVSFQWLIQ 131

Query: 124 TKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLI 183
            K+   L  LS  + T+  GE+ Q+  S N+++++E Y+ +I +KTA LF A  E ++ +
Sbjct: 132 CKNLTILSILSKTSNTIIIGEVEQMVASYNINISQEKYIDIISAKTASLFEATCESAANL 191

Query: 184 AGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQ 243
           A V N    ALK +G NLGI+FQ++DD+LDY     + GK +G D   GK TLP+I+A+Q
Sbjct: 192 AEVNNEKIHALKQFGYNLGISFQILDDILDYTASETQFGKKLGNDLLTGKITLPIIIAYQ 251

Query: 244 RGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPD 303
               +EK FW     +  I+     KA   ++ + A+      A +Y  KAK SL    +
Sbjct: 252 NANHQEKKFWTQLSTNPDIN-----KAMFYIKSHSAIEQALNIASTYIDKAKSSLNIFAN 306

Query: 304 SSWKKSLMEVVDFCLQR 320
           S +K+ L ++++  L R
Sbjct: 307 SDYKQILDKLLNSILYR 323


>gi|118580423|ref|YP_901673.1| trans-hexaprenyltranstransferase [Pelobacter propionicus DSM 2379]
 gi|118503133|gb|ABK99615.1| Trans-hexaprenyltranstransferase [Pelobacter propionicus DSM 2379]
          Length = 322

 Score =  232 bits (592), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 187/310 (60%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+++V       + SDV +I  V +Y++ SGGKR+RP L L  A + +Y+GD  V LA  
Sbjct: 11  DLKRVEQQFRTDLESDVPLIRKVGEYVLSSGGKRVRPALLLLAARLCDYQGDKAVPLASV 70

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           IEFIHTATLLHDDVVD + LRRG  +A  +WGN+ SVLVGDFL S++F +++   S + L
Sbjct: 71  IEFIHTATLLHDDVVDSATLRRGLASANTLWGNEASVLVGDFLFSKSFSLMVAVGSLDIL 130

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           + LS     +AEGE+ QL  +  L++TEE Y+ V++SKTA+L SAA E  +++ G     
Sbjct: 131 KVLSDATTVIAEGEVMQLLCTGELELTEERYIDVVRSKTAILMSAACEAGAILGGAAPER 190

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
           RQAL  +GMNLGIAFQL+DD LDY     E GK+IG D   GK T+P+I   +  T  E+
Sbjct: 191 RQALSDFGMNLGIAFQLMDDTLDYIATEEEFGKSIGHDLEEGKITMPLIHVLRHCTPSER 250

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
           +   + +   +++++  ++   +++    +  T   A  Y Q   DSL          +L
Sbjct: 251 DQIATVVEKDEMTLDEFRQVSGLVQRYGGIDYTVDAARRYIQGCADSLSLFASGPVADAL 310

Query: 311 MEVVDFCLQR 320
           +++  + + R
Sbjct: 311 LDLAGYVVTR 320


>gi|239995268|ref|ZP_04715792.1| Geranylgeranyl pyrophosphate synthase [Alteromonas macleodii ATCC
           27126]
          Length = 324

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 128/315 (40%), Positives = 187/315 (59%), Gaps = 2/315 (0%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L+  DM+ VN LI +++ SDV +I  +  Y++ SGGKRLRP+LT+ +A  +    ++H  
Sbjct: 9   LSNDDMQAVNQLIQQQVDSDVALINQLGFYIVNSGGKRLRPLLTVLSARAMGIDNNDHHT 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  +EFIHTATLLHDDVVD+S +RRG+  A  ++GNQ SVLVGDFL +++F M++  K 
Sbjct: 69  LAAIVEFIHTATLLHDDVVDESTMRRGRETANAIFGNQASVLVGDFLYTRSFQMMVSLKR 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              +E LS     +AEGE+ QL    +   TE  Y  VI  KTA LF AA ++++++   
Sbjct: 129 MRVMEILSEATNQIAEGEVLQLMNCNDPSTTEARYFDVIYGKTARLFEAATQLAAVLTDQ 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG- 245
              +  A++ YG +LG AFQL DD+LDY  +  EMGKN G+D   GKPTLP++ A     
Sbjct: 189 NEHIEHAMQEYGKHLGTAFQLADDILDYMADSEEMGKNAGDDLAEGKPTLPLLYAMWHAR 248

Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
              +K   +  I      + +L +   IM E  AL  T   A    Q A +SL  + DS 
Sbjct: 249 NDDDKALIQEAIEQSN-GLPHLTRIQGIMEETGALDYTRECAQKEVQMAINSLNAIEDSE 307

Query: 306 WKKSLMEVVDFCLQR 320
           +K++L+ +    ++R
Sbjct: 308 YKEALIALAHISIER 322


>gi|304311022|ref|YP_003810620.1| Polyprenyl synthetase [gamma proteobacterium HdN1]
 gi|301796755|emb|CBL44967.1| Polyprenyl synthetase [gamma proteobacterium HdN1]
          Length = 322

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 186/315 (59%), Gaps = 4/315 (1%)

Query: 7   LTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL 66
           L   D   V+ +I ++I S V ++  +  Y+I +GGKRLRP+L L     + Y  ++  +
Sbjct: 9   LVADDFIAVDEIIRQQIQSKVALVQTIGDYIISAGGKRLRPLLVLLGGRAVGYHKEDLRI 68

Query: 67  LACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKS 126
           LA  IE +HTATLLHDDVVD S LRRG+  A   WGN  SVLVGD+L S++F M++   +
Sbjct: 69  LAATIELLHTATLLHDDVVDKSGLRRGRATANAQWGNAPSVLVGDYLYSRSFEMMVGLGN 128

Query: 127 QEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGV 186
              ++ LS     +AEGE  QLS  +++  +EE Y+ +I+SKT+VL  A+   ++++A  
Sbjct: 129 MPVMKILSQATRIMAEGEALQLSRVRDVSTSEETYMQIIRSKTSVLLEASSHSAAVLASA 188

Query: 187 QNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGT 246
            +  R AL+ +G +LGIAFQL+DDVLD+RG+   +GKNIG+D   GKPTLP+I   + G 
Sbjct: 189 TDYERHALRGFGEHLGIAFQLIDDVLDFRGDSQALGKNIGDDLAEGKPTLPLIFTMREGN 248

Query: 247 KREKNFWKSTI-NDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSS 305
                   + I   G   +E ++ A   +     L  T  +A+ +   A   L  LPDS 
Sbjct: 249 AESAKLIHNAILEGGSPDIEAIRSA---VETAGGLEYTANKAHEHALLACHHLDALPDSP 305

Query: 306 WKKSLMEVVDFCLQR 320
           ++++L ++  F + R
Sbjct: 306 YRQALHDLSHFAVAR 320


>gi|289209165|ref|YP_003461231.1| trans-hexaprenyltranstransferase [Thioalkalivibrio sp. K90mix]
 gi|288944796|gb|ADC72495.1| Trans-hexaprenyltranstransferase [Thioalkalivibrio sp. K90mix]
          Length = 322

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 191/320 (59%), Gaps = 2/320 (0%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           +  + +L   DM+ V+  I  R+ S V +I  +  Y+I SGGKRLRP+L   +A      
Sbjct: 3   INAIRELAADDMQAVDQCIRDRLSSPVVLINQLGHYIIHSGGKRLRPLLATLSARACAVE 62

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           GD  V+LA  +EFIHTATLLHDDVVD S +RRG   A  ++GN+ +VLVGDFL S+AF M
Sbjct: 63  GDEPVVLAAVVEFIHTATLLHDDVVDASEMRRGNETANHIFGNEAAVLVGDFLYSRAFEM 122

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           ++E  S   +E L+     +AEGE+ QL    + DV E  Y++VI+SKTA LF AA ++ 
Sbjct: 123 MVEVGSMRVMEILAHATNVIAEGEVMQLMNCHDADVDEARYMNVIQSKTAKLFEAACQLG 182

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           +++     +  ++L  YGM+LG AFQL+DDVLDY  +    GK +G+D   GKPTLP+I 
Sbjct: 183 AILGERPRAEEESLAHYGMHLGTAFQLIDDVLDYSSDDAVTGKRMGDDLAEGKPTLPLIQ 242

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A + GT  ++   +  I DG    E ++    I+    AL     RA +  + A  ++  
Sbjct: 243 AIRVGTPEQQTVVRQAIEDG--GREQVEAVLEIVHATGALDYARERAAAETEAAIAAVSV 300

Query: 301 LPDSSWKKSLMEVVDFCLQR 320
           LP+S  +++L+++  F + R
Sbjct: 301 LPESPHRQALIDLARFAVGR 320


>gi|294789130|ref|ZP_06754369.1| octaprenyl-diphosphate synthase [Simonsiella muelleri ATCC 29453]
 gi|294482871|gb|EFG30559.1| octaprenyl-diphosphate synthase [Simonsiella muelleri ATCC 29453]
          Length = 324

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 193/312 (61%), Gaps = 2/312 (0%)

Query: 11  DMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACA 70
           D+ +VN ++ + + SDV +I  +  Y+I +GGKRLRP+LT+ +   L Y  D    LA  
Sbjct: 15  DLSRVNLVVNQAVQSDVALISQIGTYIIGAGGKRLRPILTILSGKCLGYDDDKLYSLAAM 74

Query: 71  IEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEAL 130
           +EFIHT+TLLHDDVVD+S LRRG+  A  ++GN  +VLVGDFL ++AF +++ + S + L
Sbjct: 75  VEFIHTSTLLHDDVVDESELRRGRKTANNLFGNAAAVLVGDFLYTRAFQLMVGSGSLKIL 134

Query: 131 EALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSV 190
           E ++     +AEGE+ QL    N+D+TE  YL VI+ KTA LF AA +V +++AG  +  
Sbjct: 135 EVMADATNIIAEGEVMQLMNIGNIDITEAQYLQVIQYKTAKLFEAAAQVGAILAGATHEQ 194

Query: 191 RQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREK 250
             ALK++GM +G AFQ++DDVLDY G V ++GKN+G+D   GKPTLP+I   Q+G     
Sbjct: 195 ETALKNFGMYMGTAFQIIDDVLDYSGSVEQIGKNVGDDLAEGKPTLPLIYLMQQGNDVAA 254

Query: 251 NFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSL 310
              ++ + +     E   +    + E+ AL     +A     +A   L+ LP++    ++
Sbjct: 255 QDVRTALQNA--DREYFDQIHAHVTESDALNYCMEQAKKAVAQAIGCLKMLPENEVTVAM 312

Query: 311 MEVVDFCLQRLN 322
            ++ +  ++R++
Sbjct: 313 RQMAELSVERVS 324


>gi|15892647|ref|NP_360361.1| octaprenyl-diphosphate synthase [Rickettsia conorii st